HHsearch alignment for GI: 254780619 and conserved domain: KOG0343

>KOG0343 consensus.
Probab=98.89  E-value=1.7e-07  Score=76.34  Aligned_cols=313  Identities=21%  Similarity=0.288  Sum_probs=165.3

Q ss_pred             HCCCHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHH
Q ss_conf             09998999752455722344554102356654344666688378999999987520489619984475315799999999
Q gi|254780619|r  160 SQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIV  239 (731)
Q Consensus       160 ~~~s~~~i~~L~~kglI~~~~~~~~~~~~~~~~~~~~~~Lt~eQ~~a~~~i~~~~~~~f~~~LL~GvTGSGKTEVYl~li  239 (731)
T Consensus        74 lpls~~t~kgLke~~fv~---------------------~teiQ~~~Ip~a----L~G-~DvlGAAkTGSGKTLAFlvPv  127 (758)
T KOG0343          74 LPLSQKTLKGLKEAKFVK---------------------MTEIQRDTIPMA----LQG-HDVLGAAKTGSGKTLAFLVPV  127 (758)
T ss_pred             CCCCHHHHHHHHHCCCCC---------------------HHHHHHHHCCHH----CCC-CCCCCCCCCCCCCEEEEHHHH
T ss_conf             887667887676548756---------------------999987641422----057-500010235888446543999


Q ss_pred             HHHHH-------CCCCEEEEECCCHHHHHHHHHHHCC---CCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEECCHHHH
Q ss_conf             99851-------4684799715210013445554303---8976899623557235667899997199739994001211
Q gi|254780619|r  240 AAVLH-------LGKQVLILLPEISLTSAILERFQKR---FGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF  309 (731)
Q Consensus       240 ~~~L~-------~GkqvLiLvPEI~Lt~Q~~~rl~~r---F~~~v~v~HS~ls~~eR~~~w~~i~~G~~~IVIGtRSAif  309 (731)
T Consensus       128 lE~L~r~kWs~~DGlGalIISPTRELA~QtFevL~kvgk~h~fSaGLiiGG---~~--~k~E~eRi~~mNILVCTPGRLL  202 (758)
T KOG0343         128 LEALYRLKWSPTDGLGALIISPTRELALQTFEVLNKVGKHHDFSAGLIIGG---KD--VKFELERISQMNILVCTPGRLL  202 (758)
T ss_pred             HHHHHHCCCCCCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCCCEEECC---CH--HHHHHHHHHCCCEEEECHHHHH
T ss_conf             999997177887883269956529999999999998752056431136657---12--6889976625776996617899


Q ss_pred             --------HHHCCCEEEEEEECC---CCCCHHCCCCCCCHHHHHHHHHHHCCCC----EECCCCCCCHHH--HHHHHHHH
Q ss_conf             --------001000136774055---3210000244322489999975110321----000024543246--77532123
Q gi|254780619|r  310 --------LPFKKLGLIVIDEEH---DISYKQEEGILYNARDMSIVRGKIESFP----VVLVSATPSIES--RVNGISRR  372 (731)
Q Consensus       310 --------~P~~nLglIIvDEEH---d~sykq~~~pry~aRdvA~~Ra~~~~~~----lilgSATPSles--~~~~~~g~  372 (731)
T Consensus       203 QHmde~~~f~t~~lQmLvLDEADR~LDMGFk~tL------------~~Ii~~lP~~RQTLLFSATqt~svkdLaRLsL~d  270 (758)
T KOG0343         203 QHMDENPNFSTSNLQMLVLDEADRMLDMGFKKTL------------NAIIENLPKKRQTLLFSATQTKSVKDLARLSLKD  270 (758)
T ss_pred             HHHHHCCCCCCCCCEEEEECCHHHHHHHHHHHHH------------HHHHHHCCHHHEEEEEECCCCHHHHHHHHHHCCC
T ss_conf             8754167878776047873208889877678889------------9998737723304666325511399999753479


Q ss_pred             HHHHCCCCCCCCCCCC----CCEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCEEHHCCCCCCCCCCCC
Q ss_conf             4441243223676543----321102222332224547989999998862265517997422200000023565434310
Q gi|254780619|r  373 YHSVHLSTRYRNSALP----HLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKC  448 (731)
Q Consensus       373 ~~~~~l~~R~~~~~~P----~i~ivDm~~~~~~~~~~lS~~l~~~i~~~l~~g~qvll~lnRrGya~~~~C~~Cg~~~~C  448 (731)
T Consensus       271 P~~vsvhe~a~~-atP~~L~Q~y~~-v~l~-----~-Ki~~L~sFI~shlk~K--~iVF~S-------------------  321 (758)
T KOG0343         271 PVYVSVHENAVA-ATPSNLQQSYVI-VPLE-----D-KIDMLWSFIKSHLKKK--SIVFLS-------------------  321 (758)
T ss_pred             CCEEEEECCCCC-CCHHHHHHEEEE-EEHH-----H-HHHHHHHHHHHCCCCC--EEEEEE-------------------
T ss_conf             857997235333-683645332799-7601-----4-7899999998452543--699986-------------------


Q ss_pred             CCCCCEEEEECCCCCCEECHHHCCCCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHCCCCCHHHHCCCCCCCCHHHHHHH
Q ss_conf             14652012113578320000210244655566678741100135428998888520485200010232113586789999
Q gi|254780619|r  449 LHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQ  528 (731)
Q Consensus       449 ~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~~~l~~~G~Gte~~~e~l~~~fp~~~v~~~d~d~~~~~~~~~~~  528 (731)
T Consensus       322 --------------------------------scKq----------vkf~~e~F~rlrpg~~l~~L~G~~--~Q~~R~ev  357 (758)
T KOG0343         322 --------------------------------SCKQ----------VKFLYEAFCRLRPGIPLLALHGTM--SQKKRIEV  357 (758)
T ss_pred             --------------------------------HHHH----------HHHHHHHHHHCCCCCCEEEECCCH--HHHHHHHH
T ss_conf             --------------------------------0068----------999999998508998325421631--37788999


Q ss_pred             HHHHCCCCCCEEEEEHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEE
Q ss_conf             986212576579870443023113452012330003443102455789999987543110256678868999
Q gi|254780619|r  529 LSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI  600 (731)
Q Consensus       529 ~~~~~~~~~~ilvgTq~i~kg~~fp~v~lv~il~aD~~l~~pd~ra~E~~~qll~qv~gRagr~~~~g~v~i  600 (731)
T Consensus       358 ~~~F~~~~~~vLF~TDv~aRGLDFpaVdwViQ~DC-----------Pedv~tYIH-RvGRtAR~~~~G~sll  417 (758)
T KOG0343         358 YKKFVRKRAVVLFCTDVAARGLDFPAVDWVIQVDC-----------PEDVDTYIH-RVGRTARYKERGESLL  417 (758)
T ss_pred             HHHHHHHCCEEEEEEHHHHCCCCCCCCCEEEEECC-----------CHHHHHHHH-HHHHHHCCCCCCCEEE
T ss_conf             99998755558986025543689864336998068-----------205889998-7212211367785689