HHsearch alignment for GI: 254780619 and conserved domain: KOG0345

>KOG0345 consensus.
Probab=99.34  E-value=2.6e-10  Score=97.90  Aligned_cols=301  Identities=17%  Similarity=0.179  Sum_probs=159.8

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHH-H-----CCC--CEEEEECCCHHHHHHHHHH---
Q ss_conf             6883789999999875204896199844753157999999999985-1-----468--4799715210013445554---
Q gi|254780619|r  198 ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVL-H-----LGK--QVLILLPEISLTSAILERF---  266 (731)
Q Consensus       198 ~Lt~eQ~~a~~~i~~~~~~~f~~~LL~GvTGSGKTEVYl~li~~~L-~-----~Gk--qvLiLvPEI~Lt~Q~~~rl---  266 (731)
T Consensus        28 ~mTpVQa~tIPlll~~-----KDVvveavTGSGKTlAFllP~le~i~rr~~~~~~~~vgalIIsPTRELa~QI~~V~~~F  102 (567)
T KOG0345          28 KMTPVQAATIPLLLKN-----KDVVVEAVTGSGKTLAFLLPMLEIIYRREAKTPPGQVGALIISPTRELARQIREVAQPF  102 (567)
T ss_pred             CCCHHHHHHHHHHHCC-----CCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCHHHHHHHHHHHHHH
T ss_conf             3687787466788527-----85689856788710668999999998611578965124799657199999999999999


Q ss_pred             HCC-CCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEECCH---------HHHHHHCCCEEEEEEECCCCCCHHCCCCCC
Q ss_conf             303-8976899623557235667899997199739994001---------211001000136774055321000024432
Q gi|254780619|r  267 QKR-FGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS---------ALFLPFKKLGLIVIDEEHDISYKQEEGILY  336 (731)
Q Consensus       267 ~~r-F~~~v~v~HS~ls~~eR~~~w~~i~~G~~~IVIGtRS---------Aif~P~~nLglIIvDEEHd~sykq~~~pry  336 (731)
T Consensus       103 ~~~l~~l~~~l~vGG~~v~~Di---~~fkee~~nIlVgTPGRL~di~~~~~~~l~~rsLe~LVLDEAD-rL--ldmgFe~  176 (567)
T KOG0345         103 LEHLPNLNCELLVGGRSVEEDI---KTFKEEGPNILVGTPGRLLDILQREAEKLSFRSLEILVLDEAD-RL--LDMGFEA  176 (567)
T ss_pred             HHHCCCCCEEEEECCCCHHHHH---HHHHHHCCCEEEECCHHHHHHHHCHHHCCCCCCCCEEEECCHH-HH--HCCCHHH
T ss_conf             9850365459997686477799---9999709958994762499998453000361331157751467-67--4432799


Q ss_pred             CHHHHHHHHHHHCCCCEECCCCCC--CHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             248999997511032100002454--324677532123444124322367654332110222233222454798999999
Q gi|254780619|r  337 NARDMSIVRGKIESFPVVLVSATP--SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGI  414 (731)
Q Consensus       337 ~aRdvA~~Ra~~~~~~lilgSATP--Sles~~~~~~g~~~~~~l~~R~~~~~~P~i~ivDm~~~~~~~~~~lS~~l~~~i  414 (731)
T Consensus       177 ~~n~ILs~LPKQRRTGLF--SATq~~~v~dL~r--aG----L--------RN----------------------------  212 (567)
T KOG0345         177 SVNTILSFLPKQRRTGLF--SATQTQEVEDLAR--AG----L--------RN----------------------------  212 (567)
T ss_pred             HHHHHHHHCCCCCCCCCC--EEHHHHHHHHHHH--HH----C--------CC----------------------------
T ss_conf             999999866210002443--0021466889998--53----5--------68----------------------------


Q ss_pred             HHHHCCCCEEEEEECCCCE--EH------HCCCCCCCCCCCCCCCCCEEEEECCCCCCEECHHHCCC-CCCCCCCCCCCC
Q ss_conf             8862265517997422200--00------00235654343101465201211357832000021024-465556667874
Q gi|254780619|r  415 RHTLARNEQTLLFLNRRGY--AP------LTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSA-IYSQSCVVCGSS  485 (731)
Q Consensus       415 ~~~l~~g~qvll~lnRrGy--a~------~~~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~-~~~~~Cp~Cg~~  485 (731)
T Consensus       213 --------pv~V~V~~k~~~~tPS~L~~~Y~v~~a~eK~~----------------~lv~~L~~~~~kK~iVFF~TCasV  268 (567)
T KOG0345         213 --------PVRVSVKEKSKSATPSSLALEYLVCEADEKLS----------------QLVHLLNNNKDKKCIVFFPTCASV  268 (567)
T ss_pred             --------CEEEEECCCCCCCCCHHHHHEEEEECHHHHHH----------------HHHHHHHCCCCCCEEEEECCCCHH
T ss_conf             --------63654123445558423111256757788899----------------999999624546279993475409


Q ss_pred             CEECCCCCCHHHHHHHHHHCCCCCHHHHCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             11001354289988885204852000102321135867899999862125765798704430231134520123300034
Q gi|254780619|r  486 GKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDL  565 (731)
Q Consensus       486 ~~l~~~G~Gte~~~e~l~~~fp~~~v~~~d~d~~~~~~~~~~~~~~~~~~~~~ilvgTq~i~kg~~fp~v~lv~il~aD~  565 (731)
T Consensus       269 e---Yf~~-------~~~~~l~~~~i~~iHGK~-~q-~~R~k~~~~F~~~~~~vl~~TDVaARGlDip~iD~VvQ~DpP~  336 (567)
T KOG0345         269 E---YFGK-------LFSRLLKKREIFSIHGKM-SQ-KARAKVLEAFRKLSNGVLFCTDVAARGLDIPGIDLVVQFDPPK  336 (567)
T ss_pred             H---HHHH-------HHHHHHCCCCEEEECCHH-CC-HHHHHHHHHHHHCCCCEEEEEHHHHCCCCCCCCEEEEECCCCC
T ss_conf             9---9998-------888760787479862201-23-4688999998715686188604555368988970799707999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEE
Q ss_conf             431024557899999875431102566788689999
Q gi|254780619|r  566 GLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQ  601 (731)
Q Consensus       566 ~l~~pd~ra~E~~~qll~qv~gRagr~~~~g~v~iQ  601 (731)
T Consensus       337 ~------------~~~FvHR~GRTaR~gr~G~Aivf  360 (567)
T KOG0345         337 D------------PSSFVHRCGRTARAGREGNAIVF  360 (567)
T ss_pred             C------------HHHHHHHCCHHHHCCCCCCEEEE
T ss_conf             8------------14777741214435676634899