HHsearch alignment for GI: 254780619 and conserved domain: KOG0347

>KOG0347 consensus.
Probab=98.63  E-value=1.2e-06  Score=70.02  Aligned_cols=348  Identities=16%  Similarity=0.226  Sum_probs=175.0

Q ss_pred             HCCCHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHH-HHH
Q ss_conf             0999899975245572234455410235665434466668837899999998752048961998447531579999-999
Q gi|254780619|r  160 SQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVY-LEI  238 (731)
Q Consensus       160 ~~~s~~~i~~L~~kglI~~~~~~~~~~~~~~~~~~~~~~Lt~eQ~~a~~~i~~~~~~~f~~~LL~GvTGSGKTEVY-l~l  238 (731)
T Consensus       186 l~lp~~iL~aL~~~gFs~P---------------------t~IQsl~lp~ai---~gk~-DIlGaAeTGSGKTLAFGIPi  240 (731)
T KOG0347         186 LFLPMEILRALSNLGFSRP---------------------TEIQSLVLPAAI---RGKV-DILGAAETGSGKTLAFGIPI  240 (731)
T ss_pred             CCCCHHHHHHHHHCCCCCC---------------------CCCHHHCCCHHH---CCCH-HCCCCCCCCCCCEEEECCHH
T ss_conf             8989999999986478998---------------------610441166765---4630-00033346887424412325


Q ss_pred             HH-------------HHHHCCCC--EEEEECCCHHHHHHHHHHH---CCCCCEEEEEECCCCCHHHHHHHHHHHCCCCEE
Q ss_conf             99-------------98514684--7997152100134455543---038976899623557235667899997199739
Q gi|254780619|r  239 VA-------------AVLHLGKQ--VLILLPEISLTSAILERFQ---KRFGVKPAEWHSSLSTSMREKIWRQVARGAISV  300 (731)
Q Consensus       239 i~-------------~~L~~Gkq--vLiLvPEI~Lt~Q~~~rl~---~rF~~~v~v~HS~ls~~eR~~~w~~i~~G~~~I  300 (731)
T Consensus       241 v~~l~~~s~~s~e~~~~~~k~~k~~~LV~tPTRELa~QV~~Hl~ai~~~t~i~v~si~GGLavqKQ----qRlL~~~p~I  316 (731)
T KOG0347         241 VERLLESSDDSQELSNTSAKYVKPIALVVTPTRELAHQVKQHLKAIAEKTQIRVASITGGLAVQKQ----QRLLNQRPDI  316 (731)
T ss_pred             HHHHHHCCCHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCEEEEEEECHHHHHHH----HHHHHCCCCE
T ss_conf             454330365376544677605764038963709999999999998613467278875230579999----9998529987


Q ss_pred             EEECCHHHH----------HHHCCCEEEEEEECCCCCCHHCCCCCC-CHHHHHHHH---H-HHCCCCEECCCCCCCHHHH
Q ss_conf             994001211----------001000136774055321000024432-248999997---5-1103210000245432467
Q gi|254780619|r  301 IVGVRSALF----------LPFKKLGLIVIDEEHDISYKQEEGILY-NARDMSIVR---G-KIESFPVVLVSATPSIESR  365 (731)
Q Consensus       301 VIGtRSAif----------~P~~nLglIIvDEEHd~sykq~~~pry-~aRdvA~~R---a-~~~~~~lilgSATPSles~  365 (731)
T Consensus       317 VVATPGRlweli~e~n~~l~~~k~vkcLVlDEaDRm--ve-kg-hF~Els~lL~~L~e~~~~~qrQTlVF-SATlt~~~~  391 (731)
T KOG0347         317 VVATPGRLWELIEEDNTHLGNFKKVKCLVLDEADRM--VE-KG-HFEELSKLLKHLNEEQKNRQRQTLVF-SATLTLVLQ  391 (731)
T ss_pred             EEECCHHHHHHHHHHHHHHHHHHHCEEEEECCHHHH--HH-HC-CHHHHHHHHHHHHHHHCCCCCCEEEE-EEEEEHHHC
T ss_conf             993662899999751066642332407887347777--55-11-09999999998603110510125899-877633321


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEECCC-CEEHHCCCCCCCC
Q ss_conf             753212344412432236765433211022223322245479899999988622655179974222-0000002356543
Q gi|254780619|r  366 VNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR-GYAPLTLCQVCGN  444 (731)
Q Consensus       366 ~~~~~g~~~~~~l~~R~~~~~~P~i~ivDm~~~~~~~~~~lS~~l~~~i~~~l~~g~qvll~lnRr-Gya~~~~C~~Cg~  444 (731)
T Consensus       392 ~~~~~~--------~k~~~k------------~-~----~~~~kiq~Lmk~ig~~~kpkiiD~t~q~~ta~~l~----Es  442 (731)
T KOG0347         392 QPLSSS--------RKKKDK------------E-D----ELNAKIQHLMKKIGFRGKPKIIDLTPQSATASTLT----ES  442 (731)
T ss_pred             CHHHHH--------HHCCCH------------H-H----HHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHH----HH
T ss_conf             705776--------542211------------4-5----56679999999847568982676682044788888----77


Q ss_pred             CCCCC--CCCCEEEEECCCCCCEECHHHCCCCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHCCCCCHHHHCCCCCCCCH
Q ss_conf             43101--4652012113578320000210244655566678741100135428998888520485200010232113586
Q gi|254780619|r  445 RLKCL--HCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGG  522 (731)
Q Consensus       445 ~~~C~--~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~~~l~~~G~Gte~~~e~l~~~fp~~~v~~~d~d~~~~~  522 (731)
T Consensus       443 ~I~C~~~eKD~ylyYf------l~ryPGrTlV------F~NsId-------~vKRLt~~L~~L--~i~p~~LHA~M~-QK  500 (731)
T KOG0347         443 LIECPPLEKDLYLYYF------LTRYPGRTLV------FCNSID-------CVKRLTVLLNNL--DIPPLPLHASMI-QK  500 (731)
T ss_pred             HHCCCCCCCCEEEEEE------EEECCCCEEE------EECHHH-------HHHHHHHHHHHC--CCCCCHHHHHHH-HH
T ss_conf             6358854454068998------8636983599------841188-------999999997416--999710257788-99


Q ss_pred             HHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEE
Q ss_conf             78999998621257657987044302311345201233000344310245578999998754311025667886899993
Q gi|254780619|r  523 GRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQA  602 (731)
Q Consensus       523 ~~~~~~~~~~~~~~~~ilvgTq~i~kg~~fp~v~lv~il~aD~~l~~pd~ra~E~~~qll~qv~gRagr~~~~g~v~iQt  602 (731)
T Consensus       501 qR-LknLEkF~~~~~~VLiaTDVAARGLDIp~V~HVIHYqV------P------rtseiYVHRSGRTARA~~~Gvsvml-  566 (731)
T KOG0347         501 QR-LKNLEKFKQSPSGVLIATDVAARGLDIPGVQHVIHYQV------P------RTSEIYVHRSGRTARANSEGVSVML-  566 (731)
T ss_pred             HH-HHHHHHHHCCCCEEEEEEHHHHCCCCCCCCCEEEEEEC------C------CCCCEEEECCCCCCCCCCCCEEEEE-
T ss_conf             99-87699874488817996234442588878636789606------8------7532467626653225678837998-


Q ss_pred             CCCC
Q ss_conf             2986
Q gi|254780619|r  603 YQPT  606 (731)
Q Consensus       603 ~~p~  606 (731)
T Consensus       567 ~~P~  570 (731)
T KOG0347         567 CGPQ  570 (731)
T ss_pred             ECHH
T ss_conf             6817