HHsearch alignment for GI: 254780619 and conserved domain: KOG0952

>KOG0952 consensus.
Probab=99.55  E-value=1e-12  Score=116.35  Aligned_cols=347  Identities=22%  Similarity=0.274  Sum_probs=212.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHHHC----------CCCEEEEECCCHHHHHHH
Q ss_conf             4666688378999999987520489619984475315799999999998514----------684799715210013445
Q gi|254780619|r  194 FSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHL----------GKQVLILLPEISLTSAIL  263 (731)
Q Consensus       194 ~~~~~Lt~eQ~~a~~~i~~~~~~~f~~~LL~GvTGSGKTEVYl~li~~~L~~----------GkqvLiLvPEI~Lt~Q~~  263 (731)
T Consensus       106 f~f~~fN~iQS~vFp~aY~Sne----NMLIcAPTGsGKT~la~L~ILr~ik~~~~~~~i~k~~fKiVYIaPmKALa~Em~  181 (1230)
T KOG0952         106 FSFEEFNRIQSEVFPVAYKSNE----NMLICAPTGSGKTVLAELCILRTIKEHEEQGDIAKDDFKIVYIAPMKALAAEMV  181 (1230)
T ss_pred             CCHHHHHHHHHHHHHHHHCCCC----CEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEECHHHHHHHHH
T ss_conf             6688887778774146514788----779977789971678999999999850145543468713999925688999999


Q ss_pred             HHHHCCCC---CEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEC--------CHHH--HHHHCCCEEEEEEECCCCCCHH
Q ss_conf             55430389---768996235572356678999971997399940--------0121--1001000136774055321000
Q gi|254780619|r  264 ERFQKRFG---VKPAEWHSSLSTSMREKIWRQVARGAISVIVGV--------RSAL--FLPFKKLGLIVIDEEHDISYKQ  330 (731)
Q Consensus       264 ~rl~~rF~---~~v~v~HS~ls~~eR~~~w~~i~~G~~~IVIGt--------RSAi--f~P~~nLglIIvDEEHd~sykq  330 (731)
T Consensus       182 ~~~~kkl~~~gi~v~ELTGD~ql~~t-----ei~--~tqiiVTTPEKwDvvTRk~~~d~~l~~~V~LviIDEVHl--Lhd  252 (1230)
T KOG0952         182 DKFSKKLAPLGISVRELTGDTQLTKT-----EIA--DTQIIVTTPEKWDVVTRKSVGDSALFSLVRLVIIDEVHL--LHD  252 (1230)
T ss_pred             HHHHHHCCCCCCEEEEECCCCHHHHH-----HHH--HCCEEEECCCCEEEEEEEECCCHHHHHHEEEEEEEEEHH--HCC
T ss_conf             99866424246258884175456677-----877--437797063400046654126265555420488530012--157


Q ss_pred             CCCCCC---CHHHHHHHHHHHCCCCEECCCCC-CCHHHHHHHHHHH--HHHHCCCCCCCCCCCCCCEECCCCCCC-CCCC
Q ss_conf             024432---24899999751103210000245-4324677532123--444124322367654332110222233-2224
Q gi|254780619|r  331 EEGILY---NARDMSIVRGKIESFPVVLVSAT-PSIESRVNGISRR--YHSVHLSTRYRNSALPHLQVIDMRGQT-IAQG  403 (731)
Q Consensus       331 ~~~pry---~aRdvA~~Ra~~~~~~lilgSAT-PSles~~~~~~g~--~~~~~l~~R~~~~~~P~i~ivDm~~~~-~~~~  403 (731)
T Consensus       253 ~RGpvlEtiVaRtlr~vessqs~IRivgLSATlPN~eDvA~fL~vn~~~glfsFd~~yRPvpL-~~~~iG~k~~~~~~~~  331 (1230)
T KOG0952         253 DRGPVLETIVARTLRLVESSQSMIRIVGLSATLPNYEDVARFLRVNPYAGLFSFDQRYRPVPL-TQGFIGIKGKKNRQQK  331 (1230)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHEEEEEEECCCCCHHHHHHHHCCCCCCCEEEECCCCCCCCE-EEEEEEEECCCCHHHH
T ss_conf             664069999999999988542005788862457877999998667875662652023203431-1168742124420024


Q ss_pred             CCCCHHHHHHHHHHHCCCCEEEEEECCCCEEHHCCCCCCCCCCCCCCCCCEEEEECCCCCCEECHHHCCCCCCCCCCCCC
Q ss_conf             54798999999886226551799742220000002356543431014652012113578320000210244655566678
Q gi|254780619|r  404 KSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCG  483 (731)
Q Consensus       404 ~~lS~~l~~~i~~~l~~g~qvll~lnRrGya~~~~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg  483 (731)
T Consensus       332 ~~~d~~~~~kv~e~~~~g~qVlvFvhsR~~Ti~tA~~l---------~~~a~-------------------------~~g  377 (1230)
T KOG0952         332 KNIDEVCYDKVVEFLQEGHQVLVFVHSRNETIRTAKKL---------RERAE-------------------------TNG  377 (1230)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHH---------HHHHH-------------------------HCC
T ss_conf             66777899999999974985999996574899999999---------99988-------------------------628


Q ss_pred             CCCEECCCCCCHHHHHHHHHHC--CCCCHHHHCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCHHHHH
Q ss_conf             7411001354289988885204--85200010232113586789999986212576579870443023113452012330
Q gi|254780619|r  484 SSGKMIACGFGIERIAEEVCEY--FPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVV  561 (731)
Q Consensus       484 ~~~~l~~~G~Gte~~~e~l~~~--fp~~~v~~~d~d~~~~~~~~~~~~~~~~~~~~~ilvgTq~i~kg~~fp~v~lv~il  561 (731)
T Consensus       378 ~~~~f~~-~~~~k~l~elf~~g~~iHhAGm~r~DR~---------l~E~~F~~G~i~vL~cTaTLAwGVNLPA~a-ViIK  446 (1230)
T KOG0952         378 EKDLFLP-SPRNKQLKELFQQGMGIHHAGMLRSDRQ---------LVEKEFKEGHIKVLCCTATLAWGVNLPAYA-VIIK  446 (1230)
T ss_pred             CCCCCCC-CHHHHHHHHHHHHHHHHCCCCCCHHHHH---------HHHHHHHCCCCEEEEECCEEEECCCCCCEE-EEEC
T ss_conf             6565678-8366789999874010202564314689---------999998559822899612133125776418-9864


Q ss_pred             HHHHHHHHHHHHHHHHH-----HHHHHHHHHCCCC--CCCCCEEEEEECCC
Q ss_conf             00344310245578999-----9987543110256--67886899993298
Q gi|254780619|r  562 DGDLGLTNADLRSSERT-----FQLLSQVTGRAGR--FGLKSLGLIQAYQP  605 (731)
Q Consensus       562 ~aD~~l~~pd~ra~E~~-----~qll~qv~gRagr--~~~~g~v~iQt~~p  605 (731)
T Consensus       447 G------T~~ydsskg~f~dlgilDVlQifGRAGRPqFd~~G~giIiTt~d  491 (1230)
T KOG0952         447 G------TQVYDSSKGSFVDLGILDVLQIFGRAGRPQFDSSGEGIIITTRD  491 (1230)
T ss_pred             C------CCCCCCCCCCEEEEHHHHHHHHHHCCCCCCCCCCCEEEEEECCC
T ss_conf             8------74113566843540288889987206899877776289996650