HHsearch alignment for GI: 254780619 and conserved domain: KOG0953

>KOG0953 consensus.
Probab=95.95  E-value=0.018  Score=38.04  Aligned_cols=103  Identities=20%  Similarity=0.342  Sum_probs=61.2

Q ss_pred             HHCC--CCCCEEEEEHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHCCCCCCCC-CEEEEEECCC-
Q ss_conf             6212--576579870443023113452012330003443102455789-9999875431102566788-6899993298-
Q gi|254780619|r  531 AIAK--GEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSE-RTFQLLSQVTGRAGRFGLK-SLGLIQAYQP-  605 (731)
Q Consensus       531 ~~~~--~~~~ilvgTq~i~kg~~fp~v~lv~il~aD~~l~~pd~ra~E-~~~qll~qv~gRagr~~~~-g~v~iQt~~p-  605 (731)
T Consensus       402 ~FNd~~~e~dvlVAsDAIGMGLNL-~IrRiiF~s----l~Kysg~e~~~it~sqikQIAGRAGRf~s~~~~G~vTtl~~e  476 (700)
T KOG0953         402 LFNDPSNECDVLVASDAIGMGLNL-NIRRIIFYS----LIKYSGRETEDITVSQIKQIAGRAGRFGSKYPQGEVTTLHSE  476 (700)
T ss_pred             HHCCCCCCCCEEEEECCCCCCCCC-CEEEEEEEE----CCCCCCCCCEECCHHHHHHHHHCCCCCCCCCCCCEEEEEEHH
T ss_conf             737988762568862321455444-311798750----356776621025689999885101544567767457774186


Q ss_pred             CCHHHHHHHHCCHHH------HHHHHHHHHHHCCCCCCH
Q ss_conf             648889999589799------999999999981888801
Q gi|254780619|r  606 THPVMQALVSGDADS------FYESEIRARESVNLPPFG  638 (731)
Q Consensus       606 ~~~~~~~~~~~d~~~------f~~~el~~R~~~~~PPf~  638 (731)
T Consensus       477 DL~~L~~~l~~p~epi~~agl~pt~eqie~fa~~~Pd~t  515 (700)
T KOG0953         477 DLKLLKRILKRPVEPIKNAGLWPTDEQIELFAYHLPDAT  515 (700)
T ss_pred             HHHHHHHHHHCCCHHHHHCCCCCCHHHHHHHHHHCCCCC
T ss_conf             699999998479567776357863999999998689824