HHsearch alignment for GI: 254780619 and conserved domain: PRK00349

>PRK00349 uvrA excinuclease ABC subunit A; Reviewed.
Probab=95.99  E-value=0.028  Score=36.50  Aligned_cols=67  Identities=21%  Similarity=0.274  Sum_probs=35.3

Q ss_pred             HHHHHHHHHHCCCCEEEEEECCCCEEHHCCCCCCCCCCCCCCCCCEEEEECCCCCCEECHHHCCCCCCCCCCCCCCCCEE
Q ss_conf             99999988622655179974222000000235654343101465201211357832000021024465556667874110
Q gi|254780619|r  409 EMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM  488 (731)
Q Consensus       409 ~l~~~i~~~l~~g~qvll~lnRrGya~~~~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~~~l  488 (731)
T Consensus       707 g~~d~IR~lFA~~~~a----k~rg~~~~~FSfN~-~gGrC~~C~G~G~~~~~m~--------Fl~d~~~~C~~C~G~-R~  772 (944)
T PRK00349        707 GVFDPIRELFAGTPEA----KARGYKPGRFSFNV-KGGRCEACQGDGVIKIEMH--------FLPDVYVPCDVCKGK-RY  772 (944)
T ss_pred             CCHHHHHHHHHCCHHH----HHHCCCCCCCCCCC-CCCCCCCCCCCCCEEEEHH--------CCCCCEEECCCCCCC-CC
T ss_conf             4579999998419487----97099976067799-8964887654472898410--------289853479998984-56


Q ss_pred             C
Q ss_conf             0
Q gi|254780619|r  489 I  489 (731)
Q Consensus       489 ~  489 (731)
T Consensus       773 ~  773 (944)
T PRK00349        773 N  773 (944)
T ss_pred             C
T ss_conf             9