HHsearch alignment for GI: 254780619 and conserved domain: PRK00564

>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional.
Probab=92.53  E-value=0.086  Score=32.81  Aligned_cols=35  Identities=26%  Similarity=0.396  Sum_probs=23.0

Q ss_pred             CCEEEEECCCCCCEECHHHCCCCCC----CCCCCCCCCC
Q ss_conf             5201211357832000021024465----5566678741
Q gi|254780619|r  452 SCWLVEHRSKKKLYCHQCGHSAIYS----QSCVVCGSSG  486 (731)
Q Consensus       452 ~~~l~~h~~~~~l~Ch~Cg~~~~~~----~~Cp~Cg~~~  486 (731)
T Consensus        60 ~A~L~Ie~~p~~~~C~~Cg~~f~~~~~~~~~CP~Cgs~~   98 (117)
T PRK00564         60 DAILDIVDEKVELECKDCSHVFKPNALDYGVCEKCHSKN   98 (117)
T ss_pred             CCEEEEEEECCEEECCCCCCEEECCCCCCCCCCCCCCCC
T ss_conf             979999973878991008998822774068590988999