HHsearch alignment for GI: 254780619 and conserved domain: PRK03846

>PRK03846 adenylylsulfate kinase; Provisional.
Probab=90.40  E-value=1.4  Score=23.48  Aligned_cols=67  Identities=22%  Similarity=0.267  Sum_probs=46.4

Q ss_pred             HCCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHH
Q ss_conf             20489619984475315799999999998514684799715210013445554303897689962355723566789999
Q gi|254780619|r  214 CTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQV  293 (731)
Q Consensus       214 ~~~~f~~~LL~GvTGSGKTEVYl~li~~~L~~GkqvLiLvPEI~Lt~Q~~~rl~~rF~~~v~v~HS~ls~~eR~~~w~~i  293 (731)
T Consensus        20 ~~~kg~viWlTGLSGSGKTTlA~~L~~~L~~~~~~~~~LDG---------D~lR~~l~~dl-----gfs~~dR~~n~~r~   85 (198)
T PRK03846         20 HGHKGVVLWFTGLSGSGKSTVAGALEEALHELGVHTYLLDG---------DNVRHGLCSDL-----GFSDADRKENIRRV   85 (198)
T ss_pred             HCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECH---------HHHHHHHCCCC-----CCCHHHHHHHHHHH
T ss_conf             68998699987999998899999999999975997599777---------99987436678-----98999999999999


Q ss_pred             H
Q ss_conf             7
Q gi|254780619|r  294 A  294 (731)
Q Consensus       294 ~  294 (731)
T Consensus        86 ~   86 (198)
T PRK03846         86 G   86 (198)
T ss_pred             H
T ss_conf             9