HHsearch alignment for GI: 254780619 and conserved domain: PRK04023

>PRK04023 DNA polymerase II large subunit; Validated.
Probab=95.12  E-value=0.022  Score=37.36  Aligned_cols=61  Identities=20%  Similarity=0.526  Sum_probs=40.2

Q ss_pred             HHHHHHCCCCEEEEEECCCCEEHHCCCCCCCCC---CCCCCCCCEEEEECCCCCCEECHHHCCCCCCCCCCCCCCC
Q ss_conf             998862265517997422200000023565434---3101465201211357832000021024465556667874
Q gi|254780619|r  413 GIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNR---LKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSS  485 (731)
Q Consensus       413 ~i~~~l~~g~qvll~lnRrGya~~~~C~~Cg~~---~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~  485 (731)
T Consensus       616 ~I~~Aa~~~g~i~vev------g~R~Cp~Cg~eT~~~~C~~CG~~-----T~~~~~c~~C~~~~~-~~~c~~c~~~  679 (1128)
T PRK04023        616 SINKAAEKGGTIEVEV------GNRKCPSCGKETFYRRCPFCGTH-----TEPVYRCPRCGIEVD-EEVCPKCGRE  679 (1128)
T ss_pred             HHHHHHHCCCCEEEEE------EEEECCCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCCCC-CCCCCCCCCC
T ss_conf             3999983369369998------20288999983575578777996-----654324776666556-6535445776