HHsearch alignment for GI: 254780619 and conserved domain: PRK04023

>PRK04023 DNA polymerase II large subunit; Validated.
Probab=93.14  E-value=0.044  Score=35.04  Aligned_cols=35  Identities=26%  Similarity=0.451  Sum_probs=23.5

Q ss_pred             CCCCCCCCCEEEEECCCCCCEECHHHCCCCCCCCCCCCCCC
Q ss_conf             43101465201211357832000021024465556667874
Q gi|254780619|r  445 RLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSS  485 (731)
Q Consensus       445 ~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~  485 (731)
T Consensus       633 ~R~Cp~Cg~e------T~~~~C~~CG~~T~~~~~c~~C~~~  667 (1128)
T PRK04023        633 NRKCPSCGKE------TFYRRCPFCGTHTEPVYRCPRCGIE  667 (1128)
T ss_pred             EEECCCCCCC------CCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             0288999983------5755787779966543247766665