HHsearch alignment for GI: 254780619 and conserved domain: PRK05973

>PRK05973 replicative DNA helicase; Provisional.
Probab=93.25  E-value=0.3  Score=28.64  Aligned_cols=113  Identities=19%  Similarity=0.212  Sum_probs=67.2

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCC------CCCEEEEE-ECCCCCHHHHHHHH
Q ss_conf             619984475315799999999998514684799715210013445554303------89768996-23557235667899
Q gi|254780619|r  219 AVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKR------FGVKPAEW-HSSLSTSMREKIWR  291 (731)
Q Consensus       219 ~~~LL~GvTGSGKTEVYl~li~~~L~~GkqvLiLvPEI~Lt~Q~~~rl~~r------F~~~v~v~-HS~ls~~eR~~~w~  291 (731)
T Consensus        65 DLIIlAARPsMGKTafaLnla~~A~k~g~~v~fFSLEM~-~~ql~~RL~~~~~~~~~~~~~~~iD~sd~i~~~~i---~r  140 (237)
T PRK05973         65 DLVLLGARPGQGKTLLGLELAVEAMKSGRTGVFFTLEYT-EKDVLDRLRALGVDRAQFADLFEFDTSDAICADYI---IA  140 (237)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCC-HHHHHHHHHHCCCCHHHCCCCCEECCCHHHHHHHH---HH
T ss_conf             779994289887899999999999995996699961599-99999999972778334067510038303339999---99


Q ss_pred             HHHCCCCEEEEECCHHHHHHHCCCEEEEEEECCCCCCHHCCC-----CCC--CHHHHHHHHHHHCCCCEECCCC
Q ss_conf             997199739994001211001000136774055321000024-----432--2489999975110321000024
Q gi|254780619|r  292 QVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEG-----ILY--NARDMSIVRGKIESFPVVLVSA  358 (731)
Q Consensus       292 ~i~~G~~~IVIGtRSAif~P~~nLglIIvDEEHd~sykq~~~-----pry--~aRdvA~~Ra~~~~~~lilgSA  358 (731)
T Consensus       141 ----------------rl~~~~~~~LIVID------YLQLM~~~r~~~eiseisRsL-K~lAkEl~vPVvaLSQ  191 (237)
T PRK05973        141 ----------------RLASAPRGTLVVID------YLQLLDQRREKPDLSVQVRAL-KSFARKRGVILVFISQ  191 (237)
T ss_pred             ----------------HHHHCCCCCEEEEE------CHHHHCCCCCCCCHHHHHHHH-HHHHHHHCCCEEEEEC
T ss_conf             ----------------98527899689997------677526677886689999999-9999986993999400