HHsearch alignment for GI: 254780619 and conserved domain: PRK06835

>PRK06835 DNA replication protein DnaC; Validated.
Probab=95.71  E-value=0.049  Score=34.64  Aligned_cols=60  Identities=25%  Similarity=0.353  Sum_probs=43.0

Q ss_pred             HHHHHHHHH---HHCCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHC
Q ss_conf             999999987---52048961998447531579999999999851468479971521001344555430
Q gi|254780619|r  204 QDVVEQVVP---LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQK  268 (731)
Q Consensus       204 ~~a~~~i~~---~~~~~f~~~LL~GvTGSGKTEVYl~li~~~L~~GkqvLiLvPEI~Lt~Q~~~rl~~  268 (731)
T Consensus       166 ~~i~~~~~~fi~~F~~~~~nLlf~G~~G~GKTfLa~~IA~ell~~g~sViy~t-----a~~L~~~l~~  228 (330)
T PRK06835        166 ENILEKCLNFIKNFDKNNENLLFYGNTGTGKTFLSNCIAKELLDRGKTVIYRT-----SDELIENLRE  228 (330)
T ss_pred             HHHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEE-----HHHHHHHHHH
T ss_conf             99999999998724788886698899999889999999999998799499962-----9999999999