HHsearch alignment for GI: 254780619 and conserved domain: PRK11192

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional.
Probab=96.25  E-value=0.049  Score=34.66  Aligned_cols=119  Identities=13%  Similarity=0.208  Sum_probs=77.7

Q ss_pred             CHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEECCHH
Q ss_conf             31579999999999851468479971521001344555430389768996235572356678999971997399940012
Q gi|254780619|r  228 GSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA  307 (731)
Q Consensus       228 GSGKTEVYl~li~~~L~~GkqvLiLvPEI~Lt~Q~~~rl~~rF~~~v~v~HS~ls~~eR~~~w~~i~~G~~~IVIGtRSA  307 (731)
T Consensus       231 ~~~k~~~L~~ll~~--~~~~k~iIF~~t~~~~~~l~~~L~~~-g~~~~~lhg~l~q~~R~~~l~~F~~g~~~vLVaTDva  307 (417)
T PRK11192        231 LEHKTALLCHLLKQ--EEVTRSIVFVRTRERVHELAGWLRKA-GINCCYLEGEMVQKKRNEAIKRLTDGRVNVLVATDVA  307 (417)
T ss_pred             HHHHHHHHHHHHHC--CCCCCCEEEECCHHHHHHHHHHHHCC-CCCEEEECCCCCHHHHHHHHHHHHCCCCCEEEECCHH
T ss_conf             89999999999853--47665215311246676898865314-8835754001799999999999976999899981243


Q ss_pred             H-HHHHCCCEEEEE-EECCC-CCCHHCCCCCCCHHHHHHHHHHHCCCCEECCC
Q ss_conf             1-100100013677-40553-21000024432248999997511032100002
Q gi|254780619|r  308 L-FLPFKKLGLIVI-DEEHD-ISYKQEEGILYNARDMSIVRGKIESFPVVLVS  357 (731)
Q Consensus       308 i-f~P~~nLglIIv-DEEHd-~sykq~~~pry~aRdvA~~Ra~~~~~~lilgS  357 (731)
T Consensus       308 aRGiDi~~V~~VInyd~P~~~~~YvHRiG-----R---TGR~G~~G~ait~v~  352 (417)
T PRK11192        308 ARGIDIDDISHVINFDMPRSADTYLHRIG-----R---TGRAGKKGTAISLVE  352 (417)
T ss_pred             HCCCCCCCCCEEEEECCCCCHHHHHHHCC-----H---HHCCCCCEEEEEEEC
T ss_conf             46777046988999799998889233067-----7---234899548999874