HHsearch alignment for GI: 254780619 and conserved domain: PRK11823

>PRK11823 DNA repair protein RadA; Provisional.
Probab=92.54  E-value=0.057  Score=34.15  Aligned_cols=156  Identities=27%  Similarity=0.374  Sum_probs=87.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCC---CEEEEEECCCCCHHHHHHHHHHHC
Q ss_conf             61998447531579999999999851468479971521001344555430389---768996235572356678999971
Q gi|254780619|r  219 AVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFG---VKPAEWHSSLSTSMREKIWRQVAR  295 (731)
Q Consensus       219 ~~~LL~GvTGSGKTEVYl~li~~~L~~GkqvLiLvPEI~Lt~Q~~~rl~~rF~---~~v~v~HS~ls~~eR~~~w~~i~~  295 (731)
T Consensus        91 S~iLlgGePGIGKSTLlLQ~a~~-la~~~~vLYvSGEES~-~Qik~RA~-RLg~~~~~l~l~~----et~l~~Il~~i~~  163 (454)
T PRK11823         91 SVVLIGGDPGIGKSTLLLQVAAA-LAAGGKVLYVSGEESL-QQIKLRAE-RLGLPSDNLYLLA----ETNLEDILATIEE  163 (454)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHH-HHCCCCEEEECCCHHH-HHHHHHHH-HHCCCCCCCEEEE----CCCHHHHHHHHHH
T ss_conf             48995079988899999999999-8559957998150157-89999999-7588888737885----3689999999986


Q ss_pred             CCCEEEEECCHHHHHHHCCCEEEEEEECCCCCCHH--CCCCC--CCHHHHHHH---HHHHCCCCEECCCC--------CC
Q ss_conf             99739994001211001000136774055321000--02443--224899999---75110321000024--------54
Q gi|254780619|r  296 GAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQ--EEGIL--YNARDMSIV---RGKIESFPVVLVSA--------TP  360 (731)
Q Consensus       296 G~~~IVIGtRSAif~P~~nLglIIvDEEHd~sykq--~~~pr--y~aRdvA~~---Ra~~~~~~lilgSA--------TP  360 (731)
T Consensus       164 -----------------~~P~~lIIDSIQT~-~~~~~~s~pGsvsQVre~a~~L~~~AK~~~i~~~lVGHVTKdG~iAGP  225 (454)
T PRK11823        164 -----------------EKPDLVVIDSIQTM-YSPELESAPGSVSQVRECAAELTRLAKQSGIAVFLVGHVTKEGAIAGP  225 (454)
T ss_pred             -----------------HCCCEEEEECHHEE-EECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCC
T ss_conf             -----------------09988999431115-415667789978999999999999997449828999977267764661


Q ss_pred             -CHHHHHHH-------HHHHHHHHC-CCCCCCCCCCCCCEECCCCCCCCC
Q ss_conf             -32467753-------212344412-432236765433211022223322
Q gi|254780619|r  361 -SIESRVNG-------ISRRYHSVH-LSTRYRNSALPHLQVIDMRGQTIA  401 (731)
Q Consensus       361 -Sles~~~~-------~~g~~~~~~-l~~R~~~~~~P~i~ivDm~~~~~~  401 (731)
T Consensus       226 kvLEHmVDtVl~fEGd~~~~~RiLR~~KNRFG~t~--EiGvFeM~~~GL~  273 (454)
T PRK11823        226 RVLEHMVDTVLYFEGDRHSRFRILRAVKNRFGATN--EIGVFEMTEKGLR  273 (454)
T ss_pred             HHHHHHHCEEEEECCCCCCCCEEEEEECCCCCCCC--EEEEEEECCCCCE
T ss_conf