HHsearch alignment for GI: 254780619 and conserved domain: PRK13107

>PRK13107 preprotein translocase subunit SecA; Reviewed.
Probab=95.81  E-value=0.17  Score=30.61  Aligned_cols=92  Identities=20%  Similarity=0.186  Sum_probs=65.6

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHH---HHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEE
Q ss_conf             75315799999999998514684799715210013---445554303897689962355723566789999719973999
Q gi|254780619|r  226 VTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTS---AILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIV  302 (731)
Q Consensus       226 vTGSGKTEVYl~li~~~L~~GkqvLiLvPEI~Lt~---Q~~~rl~~rF~~~v~v~HS~ls~~eR~~~w~~i~~G~~~IVI  302 (731)
T Consensus       103 ~TGEGKTL~atlp~ylnal~g~gvhvvTvNdYLA~RDae~m~~vy~~lGlsvg~i~~~~~~~er~~aY~------~DitY  176 (908)
T PRK13107        103 RTGEGKTLTATLPAYLNALTGKGVHVITVNDYLARRDAENNRPLFEFLGLTVGINVAGLGQQEKKAAYN------ADITY  176 (908)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHHHHHHCCEEEECCCCCCHHHHHHHCC------CCCEE
T ss_conf             178855999999999987559970997265355475499999999981975733179999699998456------88645


Q ss_pred             ECCHHH-H---------HH----HCCCEEEEEEEC
Q ss_conf             400121-1---------00----100013677405
Q gi|254780619|r  303 GVRSAL-F---------LP----FKKLGLIVIDEE  323 (731)
Q Consensus       303 GtRSAi-f---------~P----~~nLglIIvDEE  323 (731)
T Consensus       177 ~Tn~e~gFDYLRDnm~~~~~~~vqr~~~~aivDEv  211 (908)
T PRK13107        177 GTNNEFGFDYLRDNMAFSPQERVQRPLHYALIDEV  211 (908)
T ss_pred             ECCCCCCCCCCCCCCCCCHHHHCCCCCCEEEEECH
T ss_conf             35764234235743015758753567764887422