HHsearch alignment for GI: 254780619 and conserved domain: PRK13766

>PRK13766 Hef nuclease; Provisional.
Probab=99.77  E-value=2.7e-17  Score=151.30  Aligned_cols=153  Identities=25%  Similarity=0.294  Sum_probs=114.5

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHHHC-CCCEEEEECCCHHHHHHHHHHHCCC
Q ss_conf             344666688378999999987520489619984475315799999999998514-6847997152100134455543038
Q gi|254780619|r  192 LYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHL-GKQVLILLPEISLTSAILERFQKRF  270 (731)
Q Consensus       192 ~~~~~~~Lt~eQ~~a~~~i~~~~~~~f~~~LL~GvTGSGKTEVYl~li~~~L~~-GkqvLiLvPEI~Lt~Q~~~rl~~rF  270 (731)
T Consensus         9 ~~p~~ie~R~YQ~el~~~Al~~------NtiVvLPTG~GKT~IA~lvi~~~l~~~~gKilFLaPT~pLV~Qq~~~~~~~l   82 (764)
T PRK13766          9 IKPNTIEARLYQQLLAAKALKG------NTLVVLPTGLGKTAIALLVIAERLQKYGGKVLILAPTKPLVEQHAEFFRKFL   82 (764)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHC------CEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHHC
T ss_conf             5868776538799999999858------9899959986689999999999997489889998588889999999999970


Q ss_pred             C---CEEEEEECCCCCHHHHHHHHHHHCCCCEEEEECCHHH-------HHHHCCCEEEEEEECCCCCCHHCCCCCCCHHH
Q ss_conf             9---7689962355723566789999719973999400121-------10010001367740553210000244322489
Q gi|254780619|r  271 G---VKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL-------FLPFKKLGLIVIDEEHDISYKQEEGILYNARD  340 (731)
Q Consensus       271 ~---~~v~v~HS~ls~~eR~~~w~~i~~G~~~IVIGtRSAi-------f~P~~nLglIIvDEEHd~sykq~~~pry~aRd  340 (731)
T Consensus        83 ~i~~~~i~~ltG~~~~~~r~~~w~-----~~~Viv~TPQvl~ndL~~g~i~l~dv~lLVfDEaHha~---Gnh~-Y--~~  151 (764)
T PRK13766         83 NIDPEKIVVLTGEISPEKRAALWE-----KAKVIVATPQVIENDLLAGRISLEDVSLLIFDEAHRAV---GNYA-Y--VF  151 (764)
T ss_pred             CCCCCEEEEEECCCCHHHHHHHHC-----CCCEEEECCHHHHHHHHHCCCCHHHCCEEEEECCCCCC---CCCC-H--HH
T ss_conf             999552899988878276899860-----79999999089999998298678882289997466666---7762-8--99


Q ss_pred             HHHHHHHHCCCCEECC-CCCCC
Q ss_conf             9999751103210000-24543
Q gi|254780619|r  341 MSIVRGKIESFPVVLV-SATPS  361 (731)
Q Consensus       341 vA~~Ra~~~~~~lilg-SATPS  361 (731)
T Consensus       152 I~~~y~~~~~~PrILGLTASPG  173 (764)
T PRK13766        152 IAERYHEDAKNPLVLGLTASPG  173 (764)
T ss_pred             HHHHHHHCCCCCEEEEECCCCC
T ss_conf             9999985377855885036887