HHsearch alignment for GI: 254780619 and conserved domain: PRK13889

>PRK13889 conjugal transfer relaxase TraA; Provisional.
Probab=91.82  E-value=1.1  Score=24.46  Aligned_cols=103  Identities=17%  Similarity=0.195  Sum_probs=65.1

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHHH-CCCCEEEEECC----------CHHHHHHHHH
Q ss_conf             668837899999998752048961998447531579999999999851-46847997152----------1001344555
Q gi|254780619|r  197 PILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH-LGKQVLILLPE----------ISLTSAILER  265 (731)
Q Consensus       197 ~~Lt~eQ~~a~~~i~~~~~~~f~~~LL~GvTGSGKTEVYl~li~~~L~-~GkqvLiLvPE----------I~Lt~Q~~~r  265 (731)
T Consensus       345 ~~Ls~EQ~~A~~hiT~~----~~iavVvG~AGtGKStm-L~aAReawEa~GyrV~GaALsGkAAegLe~~sGI~SrTlAs  419 (992)
T PRK13889        345 LVLSGEQADALAHVTDG----RDLGVVVGYAGTGKSAM-LGVAREAWEAAGYEVRGAALSGIAAENLEGGSGIASRTIAS  419 (992)
T ss_pred             CCCCHHHHHHHHHHCCC----CCEEEEEECCCCCHHHH-HHHHHHHHHHCCCEEEEECCCHHHHHHHHHCCCCCCHHHHH
T ss_conf             88799999999986478----97589983388878899-99999999977988981150068999765347943167999


Q ss_pred             HHCCC-------C-CEEE-EEECCCCCHHHHHHHHHHH--CCCCEEEEEC
Q ss_conf             43038-------9-7689-9623557235667899997--1997399940
Q gi|254780619|r  266 FQKRF-------G-VKPA-EWHSSLSTSMREKIWRQVA--RGAISVIVGV  304 (731)
Q Consensus       266 l~~rF-------~-~~v~-v~HS~ls~~eR~~~w~~i~--~G~~~IVIGt  304 (731)
T Consensus       420 ~e~~w~~g~~~L~~~dVlVVDEAGMVgSRqMarll~~Ae~AGAKVVLVGD  469 (992)
T PRK13889        420 LEHGWGQGRDLLTARDVLVIDEAGMVGTRQLERVLSHAADAGAKVVLVGD  469 (992)
T ss_pred             HHHHHHCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             99987467334789858999676557749999999999984998999488