HHsearch alignment for GI: 254780619 and conserved domain: TIGR00376

>TIGR00376 TIGR00376 DNA helicase, putative; InterPro: IPR004483 Eukaryotic members of this family have been characterised as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT). A number of related proteins are characterised as helicases.; GO: 0003677 DNA binding, 0005524 ATP binding.
Probab=90.45  E-value=1.2  Score=24.12  Aligned_cols=73  Identities=26%  Similarity=0.423  Sum_probs=57.9

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCC--CEEEEECCCHHHHHHHHHHHCCCCCE
Q ss_conf             668837899999998752048961998447531579999999999851468--47997152100134455543038976
Q gi|254780619|r  197 PILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK--QVLILLPEISLTSAILERFQKRFGVK  273 (731)
Q Consensus       197 ~~Lt~eQ~~a~~~i~~~~~~~f~~~LL~GvTGSGKTEVYl~li~~~L~~Gk--qvLiLvPEI~Lt~Q~~~rl~~rF~~~  273 (731)
T Consensus       201 ~~l~~~~~~~~~~~~~~~----~~~~~~gp~g~g~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~d~~~~~~~~~~p~~  275 (709)
T TIGR00376       201 PNLNESQKEAVGFALSSK----DLFLIHGPPGTGKTRTLVELIRQLVKRGPEERVLVTAPSNIAVDNLLERLAPLYPDL  275 (709)
T ss_pred             CCCCHHHHHHHHHHHCCC----CEEEEECCCCCCCHHHHHHHHHHHHHCCCCCCEEEECCCCHHHHHHHHHHHHHCCCC
T ss_conf             232234677765431234----416872677776215689999999852853306762353103778888876414541