HHsearch alignment for GI: 254780619 and conserved domain: TIGR00631

>TIGR00631 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 All proteins in this family for which functions are known are DNA helicases that function in the nucleotide excision repair and are endonucleases that make the 3' incision next to DNA damage. They are part of a pathway requiring UvrA, UvrB, UvrC, and UvrD homologs.; GO: 0009381 excinuclease ABC activity, 0006289 nucleotide-excision repair, 0005737 cytoplasm, 0009380 excinuclease repair complex.
Probab=99.78  E-value=8.4e-17  Score=147.60  Aligned_cols=129  Identities=24%  Similarity=0.367  Sum_probs=90.2

Q ss_pred             HHHHHHHHHHCCC--CCHHHHCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEHHHCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             8998888520485--20001023211358678999998621257657987044302311345201233000344310245
Q gi|254780619|r  495 IERIAEEVCEYFP--LARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADL  572 (731)
Q Consensus       495 te~~~e~l~~~fp--~~~v~~~d~d~~~~~~~~~~~~~~~~~~~~~ilvgTq~i~kg~~fp~v~lv~il~aD~~l~~pd~  572 (731)
T Consensus       456 TKkMAEdLTdYl~E~Gikv~YLHSeId-t~E-R~eiirdLR~G~fDVLVGINLLREGLDlPEVSLVAILDADKEGFL---  530 (667)
T TIGR00631       456 TKKMAEDLTDYLKELGIKVRYLHSEID-TLE-RVEIIRDLRLGEFDVLVGINLLREGLDLPEVSLVAILDADKEGFL---  530 (667)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCHHH-HHH-HHHHHHHHCCCCCEEEEECCHHHCCCCCHHHHHHHHHCCCCCCCC---
T ss_conf             167788999997058837987145578-999-999999844788408860002002465114889976327888998---


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCHHEEEEE
Q ss_conf             578999998754311025667886899993298648889999589799999999999981888801189998
Q gi|254780619|r  573 RSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVI  644 (731)
Q Consensus       573 ra~E~~~qll~qv~gRagr~~~~g~v~iQt~~p~~~~~~~~~~~d~~~f~~~el~~R~~~~~PPf~~~~~i~  644 (731)
T Consensus       531 RS----erSLIQTIGRAARN~~-G~VilYAD~iT-~sM~~AI~---------ET~RRR~~Q~-~YNe~HgIt  586 (667)
T TIGR00631       531 RS----ERSLIQTIGRAARNVN-GKVILYADKIT-DSMQKAIE---------ETERRRKIQI-AYNEEHGIT  586 (667)
T ss_pred             CC----CCHHHHHHHHHHHCCC-CEEEEECCCCC-HHHHHHHH---------HHHHHHHHHH-HHHHHCCCC
T ss_conf             66----3027889888752579-65999728700-78999999---------8788899999-999753897