HHsearch alignment for GI: 254780619 and conserved domain: TIGR02642

>TIGR02642 phage_xxxx uncharacterized phage protein; InterPro: IPR013464 This uncharacterised protein is found in prophage regions of Shewanella oneidensis MR-1, Vibrio vulnificus (strain YJ016), Yersinia pseudotuberculosis IP 32953, and Aeromonas hydrophila ATCC7966. It appears to have regions of sequence similarity to the phage lambda antitermination protein Q..
Probab=92.30  E-value=0.07  Score=33.48  Aligned_cols=65  Identities=22%  Similarity=0.491  Sum_probs=38.4

Q ss_pred             HHHHHHHHCCCCEEEEEECCCCEEHHCCCCCCCCCCCCCCCCC-EEEEECCCCCCEECHHHCCCCCCCCCCCCCCCCEEC
Q ss_conf             9999886226551799742220000002356543431014652-012113578320000210244655566678741100
Q gi|254780619|r  411 IDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSC-WLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI  489 (731)
Q Consensus       411 ~~~i~~~l~~g~qvll~lnRrGya~~~~C~~Cg~~~~C~~C~~-~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~~~l~  489 (731)
T Consensus       157 I~~~~~~I~TE~~~L-----rd~a~~----~a~~~~~CP~C~Gtg~~~~---------------~~P~~C~~C~G~G~~~  212 (270)
T TIGR02642       157 IKALKAKIDTERRAL-----RDYAVA----KAAESRKCPRCRGTGLRLR---------------RQPEECDKCAGTGRLL  212 (270)
T ss_pred             HHHHHHHHHHHHHHH-----HHHHHH----HHHHCCCCCCCCCCCCCCC---------------CCCCCCCCCCCCCCCC
T ss_conf             999987767778889-----999999----8741488798656678889---------------7788777778643303


Q ss_pred             CCCCCHHHHHHHHHHCC
Q ss_conf             13542899888852048
Q gi|254780619|r  490 ACGFGIERIAEEVCEYF  506 (731)
Q Consensus       490 ~~G~Gte~~~e~l~~~f  506 (731)
T Consensus       213 ~-------~~e~l~ks~  222 (270)
T TIGR02642       213 P-------TVEDLSKSF  222 (270)
T ss_pred             C-------CHHHHHHHH
T ss_conf             0-------089999988