HHsearch alignment for GI: 254780619 and conserved domain: TIGR02759

>TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD; InterPro: IPR014128 The TraD protein performs an essential coupling function in conjugative type IV secretion systems. This protein sits at the inner membrane in contact with the assembled pilus and its scaffold as well as the relaxosome-plasmid DNA complex (through TraM) , .; GO: 0000746 conjugation.
Probab=95.74  E-value=0.013  Score=38.98  Aligned_cols=126  Identities=16%  Similarity=0.228  Sum_probs=69.6

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCEE-EEEECCCCCHHHHHHHHHHHCCC
Q ss_conf             61998447531579999999999851468479971521001344555430389768-99623557235667899997199
Q gi|254780619|r  219 AVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKP-AEWHSSLSTSMREKIWRQVARGA  297 (731)
Q Consensus       219 ~~~LL~GvTGSGKTEVYl~li~~~L~~GkqvLiLvPEI~Lt~Q~~~rl~~rF~~~v-~v~HS~ls~~eR~~~w~~i~~G~  297 (731)
T Consensus       209 Qh~L~~GTtG~GKs~~lr~LL~~iR~rGd~AIiYDkgC~-------f~~~fyd~~~DviLNP~D~RCA~Wd~W~Ec~~~-  280 (613)
T TIGR02759       209 QHILIHGTTGSGKSVALRKLLRWIRQRGDRAIIYDKGCT-------FVSRFYDPSQDVILNPLDERCANWDVWRECKDK-  280 (613)
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCC-------CCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCC-
T ss_conf             252664541743899999999999863985899825742-------021326888874606744355548835035889-


Q ss_pred             CEEEEECCHHHHHHHCCCEEEEEEECCCCCCHHCCCCCC--CHHH----HHHH-HHHHCCCC------EECCCCCCCHHH
Q ss_conf             739994001211001000136774055321000024432--2489----9999-75110321------000024543246
Q gi|254780619|r  298 ISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILY--NARD----MSIV-RGKIESFP------VVLVSATPSIES  364 (731)
Q Consensus       298 ~~IVIGtRSAif~P~~nLglIIvDEEHd~sykq~~~pry--~aRd----vA~~-Ra~~~~~~------lilgSATPSles  364 (731)
T Consensus       281 ~d--Fen~A~~LIPm~------~~~sm--------DPFW~~SARtiF~S~A~~m~~d~~rcs~~~Ll~~lL---t~~Le~  341 (613)
T TIGR02759       281 TD--FENMAEALIPMH------GDGSM--------DPFWVDSARTIFTSTAYKMRNDPKRCSTSKLLDLLL---TSELEE  341 (613)
T ss_pred             CC--HHHHHHHHCCCC------CCCCC--------CCHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHC---CHHHHH
T ss_conf             88--789999838898------88887--------712243236789999999730256788899998750---402678


Q ss_pred             HHHHHHH
Q ss_conf             7753212
Q gi|254780619|r  365 RVNGISR  371 (731)
Q Consensus       365 ~~~~~~g  371 (731)
T Consensus       342 L~~~L~g  348 (613)
T TIGR02759       342 LRDYLKG  348 (613)
T ss_pred             HHHHHCC
T ss_conf             8876347