HHsearch alignment for GI: 254780619 and conserved domain: TIGR02788

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR014155 This entry contains VirB11, a protein that is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer . VirB11 is believed to be an ATPase and is a homologue of the P-like conjugation system TrbB protein and the Flp pilus system protein TadA ..
Probab=93.20  E-value=0.12  Score=31.75  Aligned_cols=51  Identities=12%  Similarity=0.148  Sum_probs=33.4

Q ss_pred             HCCCCC---C-CHHHHHHHHHHHHHC--CCCHHH----HHHHHCCCCCCCCCCCCCHHCCC
Q ss_conf             406689---9-989999999998530--887889----99985753223333200000133
Q gi|254780619|r   78 VFDCPP---L-SRQMCEFVKWVADYT--FSPMGL----VARMVVSALSETEKMEEKIQFTG  128 (731)
Q Consensus        78 VlD~~~---L-~~~ll~L~~wiA~yY--~~plG~----vLk~aLP~~~k~~~~~~~~~~~~  128 (731)
T Consensus        31 ~~d~P~rkaLT~~~l~~La~~~A~~~nt~q~is~y~~P~LSa~LP~G~RvQ~V~PPAc~~~   91 (328)
T TIGR02788        31 RFDVPERKALTFSHLRRLARAVASFSNTKQSISEYENPILSATLPGGERVQIVIPPACEND   91 (328)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCCC
T ss_conf             8726752244189999999998876537862010228637888699947999806875898