HHsearch alignment for GI: 254780619 and conserved domain: TIGR02928

>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277 This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes. The proteins in this entry are found exclusively in the archaea. Several members may be found in a genome and interact with each other..
Probab=96.02  E-value=0.057  Score=34.15  Aligned_cols=134  Identities=20%  Similarity=0.181  Sum_probs=75.7

Q ss_pred             CCCCCHHHHHHHHHHHHHHCC-C--CCEEEEECCCCHHHHHHHHHHHHHHHHC--CCCEE-EEEC----CCHH-HHHHHH
Q ss_conf             666883789999999875204-8--9619984475315799999999998514--68479-9715----2100-134455
Q gi|254780619|r  196 LPILDKNQQDVVEQVVPLCTK-G--FAVSLISGVTGSGKTEVYLEIVAAVLHL--GKQVL-ILLP----EISL-TSAILE  264 (731)
Q Consensus       196 ~~~Lt~eQ~~a~~~i~~~~~~-~--f~~~LL~GvTGSGKTEVYl~li~~~L~~--GkqvL-iLvP----EI~L-t~Q~~~  264 (731)
T Consensus        18 ~i~hRdeqI~~l~~~L~~~l~PG~~P~Ni~iYGkTGtGKT~vt~~v~~~l~~~~~~~d~~D~~~~~~NC~~~~T~y~~~~   97 (383)
T TIGR02928        18 RIVHRDEQIEELAKALRPILRPGSRPSNIFIYGKTGTGKTAVTKYVMKELEEAAEDRDVRDVSTVYINCQILDTSYQVLV   97 (383)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHH
T ss_conf             46686789999999988750674898725887888987889999999999998622699715899977854684699999


Q ss_pred             HHHCCC---CCEEEEEECCCCCHHHHHHHHHHHC-CCCEEEEECCHHHHHHHCCCEEE-EEEECCCCCC-HHCCCCCCCH
Q ss_conf             543038---9768996235572356678999971-99739994001211001000136-7740553210-0002443224
Q gi|254780619|r  265 RFQKRF---GVKPAEWHSSLSTSMREKIWRQVAR-GAISVIVGVRSALFLPFKKLGLI-VIDEEHDISY-KQEEGILYNA  338 (731)
Q Consensus       265 rl~~rF---~~~v~v~HS~ls~~eR~~~w~~i~~-G~~~IVIGtRSAif~P~~nLglI-IvDEEHd~sy-kq~~~pry~a  338 (731)
T Consensus        98 ~L~~~ln~~~~~~~vP~tG~s~~~~~~~l~~~l~~~~----------------~~~~~ivLDEi-D~Lv~~~~d~PAyS~  160 (383)
T TIGR02928        98 ELANQLNRRGSGEEVPTTGLSTSEVFRELYKELNRER----------------GDSLIIVLDEI-DKLVRKDDDDPAYSK  160 (383)
T ss_pred             HHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHC----------------CCEEEEEECCC-CHHHCCCCCCHHHHH
T ss_conf             9999851577888898877878999999999983201----------------88799986231-022158888807878


Q ss_pred             HHHHHHHH
Q ss_conf             89999975
Q gi|254780619|r  339 RDMSIVRG  346 (731)
Q Consensus       339 RdvA~~Ra  346 (731)
T Consensus       161 ~LY~L~Ra  168 (383)
T TIGR02928       161 LLYQLSRA  168 (383)
T ss_pred             HHHHHHHH
T ss_conf             85343310