HHsearch alignment for GI: 254780619 and conserved domain: cd00983

>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response. RecA couples ATP hydrolysis to DNA strand exchange.
Probab=94.54  E-value=0.26  Score=29.11  Aligned_cols=79  Identities=27%  Similarity=0.302  Sum_probs=55.2

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCEE-EEEECCCCCHH-HHHHHHHH-HC
Q ss_conf             61998447531579999999999851468479971521001344555430389768-99623557235-66789999-71
Q gi|254780619|r  219 AVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKP-AEWHSSLSTSM-REKIWRQV-AR  295 (731)
Q Consensus       219 ~~~LL~GvTGSGKTEVYl~li~~~L~~GkqvLiLvPEI~Lt~Q~~~rl~~rF~~~v-~v~HS~ls~~e-R~~~w~~i-~~  295 (731)
T Consensus        56 Rivei~G~essGKTtlal~~ia~aQk~gg~~~~iDaE~a~d~~~a~~l----GVD~~~l~~~qp~~~Eq~l~i~~~li~s  131 (325)
T cd00983          56 RIIEIYGPESSGKTTLALHAIAEAQKLGGTVAFIDAEHALDPVYAKKL----GVDLDNLLISQPDTGEQALEIADSLVRS  131 (325)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHCCCHHHHHHC----CCCHHHEEEECCCHHHHHHHHHHHHHCC
T ss_conf             089998898777999999999998735983999962542598999980----9984675896663899999999997515


Q ss_pred             CCCEEE
Q ss_conf             997399
Q gi|254780619|r  296 GAISVI  301 (731)
Q Consensus       296 G~~~IV  301 (731)
T Consensus       132 ~~~dli  137 (325)
T cd00983         132 GAVDLI  137 (325)
T ss_pred             CCCCEE
T ss_conf             887679