HHsearch alignment for GI: 254780619 and conserved domain: cd03115

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The SRP-polypeptide complex is then targeted to the membrane by an interaction between SRP and its cognated receptor (SR). In mammals, SRP consists of six protein subunits and a 7SL RNA. One of these subunits is a 54 kd protein (SRP54), which is a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 is a multidomain protein that consists of an N-terminal domain, followed by a central G (GTPase) domain and a C-terminal M domain.
Probab=93.33  E-value=0.7  Score=25.85  Aligned_cols=36  Identities=31%  Similarity=0.483  Sum_probs=30.4

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             619984475315799999999998514684799715
Q gi|254780619|r  219 AVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLP  254 (731)
Q Consensus       219 ~~~LL~GvTGSGKTEVYl~li~~~L~~GkqvLiLvP  254 (731)
T Consensus         1 ~Vi~lvGptGvGKTTTiaKLA~~~~~~~~kV~lit~   36 (173)
T cd03115           1 TVILLVGLQGVGKTTTAAKLALYLKKKGKKVLLVAA   36 (173)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             999998999998899999999999976992899974