HHsearch alignment for GI: 254780619 and conserved domain: pfam00271

>pfam00271 Helicase_C Helicase conserved C-terminal domain. The Prosite family is restricted to DEAD/H helicases, whereas this domain family is found in a wide variety of helicases and helicase related proteins. It may be that this is not an autonomously folding unit, but an integral part of the helicase.
Probab=91.23  E-value=0.52  Score=26.83  Aligned_cols=53  Identities=25%  Similarity=0.340  Sum_probs=42.1

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEECCHHHH-HHHCCCEEEEEE
Q ss_conf             38976899623557235667899997199739994001211-001000136774
Q gi|254780619|r  269 RFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF-LPFKKLGLIVID  321 (731)
Q Consensus       269 rF~~~v~v~HS~ls~~eR~~~w~~i~~G~~~IVIGtRSAif-~P~~nLglIIvD  321 (731)
T Consensus         5 ~~g~~~~~i~g~~~~~~R~~~~~~f~~~~~~ilv~t~~~~~Gid~~~~~~vi~~   58 (78)
T pfam00271         5 KPGIKVARLHGGLSQEEREEILEDFRNGKSKVLVATDVAGRGIDLPDVNVVINY   58 (78)
T ss_pred             HCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCEEEEE
T ss_conf             689859998697999999999999987997399992565256778789999997