HHsearch alignment for GI: 254780619 and conserved domain: pfam04216

>pfam04216 FdhE Protein involved in formate dehydrogenase formation. The function of these proteins is unknown. They may possibly be involved in the formation of formate dehydrogenase.
Probab=95.21  E-value=0.0098  Score=40.01  Aligned_cols=45  Identities=22%  Similarity=0.421  Sum_probs=29.8

Q ss_pred             CCCCCCCCEEE---EEC----CCCCCEECHHHCCCCCCC-CCCCCCCCCEECC
Q ss_conf             31014652012---113----578320000210244655-5666787411001
Q gi|254780619|r  446 LKCLHCSCWLV---EHR----SKKKLYCHQCGHSAIYSQ-SCVVCGSSGKMIA  490 (731)
Q Consensus       446 ~~C~~C~~~l~---~h~----~~~~l~Ch~Cg~~~~~~~-~Cp~Cg~~~~l~~  490 (731)
T Consensus       167 ~~CPvCGs~P~~s~~~~~~~~G~Ryl~Cs~C~teW~~~R~~C~~Cg~~~~~~~  219 (283)
T pfam04216       167 GLCPVCGSAPVASVIRGGGAQGLRYLHCSLCETEWHFVRVKCTNCGSTKGLAY  219 (283)
T ss_pred             CCCCCCCCCCHHHEEECCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCE
T ss_conf             96999998100011313787883688658887832422654799999996430