HHsearch alignment for GI: 254780619 and conserved domain: pfam05707

>pfam05707 Zot Zonular occludens toxin (Zot). This family consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot). Zot is elaborated by bacteriophages present in toxigenic strains of Vibrio cholerae. Zot is a single polypeptide chain of 44.8 kDa, with the ability to reversibly alter intestinal epithelial tight junctions, allowing the passage of macromolecules through mucosal barriers
Probab=97.15  E-value=0.0014  Score=46.55  Aligned_cols=113  Identities=28%  Similarity=0.442  Sum_probs=63.6

Q ss_pred             CEEEEECCCCHHHHHHHHH-HHHHHHHCCCCEEEEECCCHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHCCC
Q ss_conf             6199844753157999999-999985146847997152100134455543038976899623557235667899997199
Q gi|254780619|r  219 AVSLISGVTGSGKTEVYLE-IVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGA  297 (731)
Q Consensus       219 ~~~LL~GvTGSGKTEVYl~-li~~~L~~GkqvLiLvPEI~Lt~Q~~~rl~~rF~~~v~v~HS~ls~~eR~~~w~~i~~G~  297 (731)
T Consensus         1 MI~litG~pGsGKS~~aV~~~i~~al~~GR~V~tNI~gL~-----~~~~~~~~~~~~~~---~~~~~~~~~~w~~-----   67 (183)
T pfam05707         1 MIYLITGKPGSGKTLEAVSYHILPALKKGRKVITNIDGLN-----LERFPKVFGEDVRE---RLEDIGYMDPWRT-----   67 (183)
T ss_pred             CEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEECCCCCC-----CHHCCCCCCCCCCC---CCCCCCCCHHHCC-----
T ss_conf             9799935999962299999999999878998998786535-----22101223444543---2000012223314-----


Q ss_pred             CEEEEECCHHHHHHHCCCEEEEEEECCCCCCHHCCC--C-CCCHHHHHHHHHHHCCCCEECCCCCCC
Q ss_conf             739994001211001000136774055321000024--4-322489999975110321000024543
Q gi|254780619|r  298 ISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEG--I-LYNARDMSIVRGKIESFPVVLVSATPS  361 (731)
Q Consensus       298 ~~IVIGtRSAif~P~~nLglIIvDEEHd~sykq~~~--p-ry~aRdvA~~Ra~~~~~~lilgSATPS  361 (731)
T Consensus        68 --------------~p~g~liViDE~~~~-~~~r~~~~~~~~~i~--~l~~HRH~G~DiiliTQ~~~  117 (183)
T pfam05707        68 --------------YPKGALLVIDEAQTW-FPSRRGGDKVPPVLD--AFSTHRHLGWDIILITQNPS  117 (183)
T ss_pred             --------------CCCCCEEEEECCHHH-CCCCCCCCCCCHHHH--HHHHCCCCCCEEEEEECCHH
T ss_conf             --------------999879999897655-488777888838999--99980778820899918979