HHsearch alignment for GI: 254780619 and conserved domain: pfam08423

>pfam08423 Rad51 Rad51. Rad51 is a DNA repair and recombination protein and is a homologue of the bacterial ATPase RecA protein.
Probab=91.80  E-value=0.78  Score=25.48  Aligned_cols=53  Identities=17%  Similarity=0.255  Sum_probs=36.7

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHHHH---H---CCCCEEEEECCCHHHHHHHHHHHCCCC
Q ss_conf             6199844753157999999999985---1---468479971521001344555430389
Q gi|254780619|r  219 AVSLISGVTGSGKTEVYLEIVAAVL---H---LGKQVLILLPEISLTSAILERFQKRFG  271 (731)
Q Consensus       219 ~~~LL~GvTGSGKTEVYl~li~~~L---~---~GkqvLiLvPEI~Lt~Q~~~rl~~rF~  271 (731)
T Consensus        44 ~ITEi~G~~gsGKTQlc~qlav~~qlp~~~gg~~g~vvyIDTEg~f~~eRl~qia~~~~  102 (261)
T pfam08423        44 SITEVFGEFRTGKTQLCHTLCVTCQLPLEMGGGEGKALYIDTEGTFRPERIVAIAERFG  102 (261)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHCHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             29999899888789999999999407096569997289993688869899999999829