HHsearch alignment for GI: 254780619 and conserved domain: pfam09332

>pfam09332 Mcm10 Mcm10 replication factor. Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha.
Probab=91.20  E-value=0.11  Score=31.97  Aligned_cols=57  Identities=21%  Similarity=0.372  Sum_probs=41.4

Q ss_pred             HHCCCCCCCCCCC-----CCCCCCEEEEECCCC-CCEECHHHCCC----CCC-CCCCCCCCCCEECCCC
Q ss_conf             0002356543431-----014652012113578-32000021024----465-5566678741100135
Q gi|254780619|r  435 PLTLCQVCGNRLK-----CLHCSCWLVEHRSKK-KLYCHQCGHSA----IYS-QSCVVCGSSGKMIACG  492 (731)
Q Consensus       435 ~~~~C~~Cg~~~~-----C~~C~~~l~~h~~~~-~l~Ch~Cg~~~----~~~-~~Cp~Cg~~~~l~~~G  492 (731)
T Consensus       253 k~V~C~~CkYt~f~~se~Ck~e~H~l~~~da~KRFFkC~dC~~Rtisl~r~P~~~C~~Cg~~k-weR~~  320 (346)
T pfam09332       253 KAVTCKQCKYTAFKAADRCVEENHDLHWHDAVKRFFKCPDCGNRTISLDRLPKKHCKNCGLFK-WERDA  320 (346)
T ss_pred             EEEEECCCCCEEECHHHHHHHCCCCEEEEECEEEEEECCCCCCCEEEEECCCCCCCCCCCCCC-EEEHH
T ss_conf             589823566613262677886089517860333224568878744562107622232367751-10011