HHsearch alignment for GI: 254780619 and conserved domain: smart00489

>smart00489 DEXDc3 DEAD-like helicases superfamily.
Probab=95.58  E-value=0.13  Score=31.44  Aligned_cols=45  Identities=22%  Similarity=0.320  Sum_probs=35.1

Q ss_pred             CHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHHHHHHHC
Q ss_conf             8378999999987520489619984475315799999999998514
Q gi|254780619|r  200 DKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHL  245 (731)
Q Consensus       200 t~eQ~~a~~~i~~~~~~~f~~~LL~GvTGSGKTEVYl~li~~~L~~  245 (731)
T Consensus        10 y~~Q~e~m~~v~~~l~~~-~~~llEaPTGtGKTlalL~~al~~~~~   54 (289)
T smart00489       10 YPIQYEFMEELKRVLDRG-KIGILESPTGTGKTLSLLCLTLTWLRS   54 (289)
T ss_pred             CHHHHHHHHHHHHHHHCC-CEEEEECCCCHHHHHHHHHHHHHHHHH
T ss_conf             989999999999999749-979998999651899999999999996