BLAST/PSIBLAST alignment of GI: 254780619 and GI: 209551229 at iteration 1
>gi|209551229|ref|YP_002283146.1| primosome assembly protein PriA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 738
>gi|209536985|gb|ACI56920.1| primosomal protein N' [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 738
 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/731 (56%), Positives = 525/731 (71%), Gaps = 6/731 (0%)

Query: 5   GSSVEGVVCSRVI-ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE 63
           G+  E    +R + +L+      PY YSVP  M VE GS+V+VPL  R V+G+VW   E+
Sbjct: 10  GALFEAPPANRTVPVLVPMPAPKPYSYSVPDGMAVEPGSVVQVPLGPRQVIGVVWDGGED 69

Query: 64  KYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKME 121
              +D  KLRPI +VFDCPPL+R+M +F+ WVA YT SP GLVARM + A +  E E M 
Sbjct: 70  G--VDPKKLRPISHVFDCPPLTREMRDFIDWVAAYTLSPPGLVARMALRAPNAFEPEPMV 127

Query: 122 EKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFE 181
           E ++F G  P   T AR RVLD   DG  W +  L  A+ VS+ V+DGL   G+ + IF 
Sbjct: 128 EGLKFVGGEPERMTPARARVLDTASDGLSWTRSGLAHAAGVSTSVVDGLITLGIFETIFL 187

Query: 182 VISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVA 240
              PVV  P+  F+   L+  Q++   ++V    KG F+VSLI GVTGSGKTEVY E +A
Sbjct: 188 PPPPVVALPDPEFTAARLEGPQKEAAAEIVSDVRKGDFSVSLIDGVTGSGKTEVYFEAIA 247

Query: 241 AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV 300
             L  GKQVLILLPEI+LT++ LERFQ RFG KPAEWHS L+  MREK+WRQ   G + V
Sbjct: 248 ETLKRGKQVLILLPEIALTASFLERFQDRFGAKPAEWHSDLAPRMREKVWRQAVTGEVRV 307

Query: 301 IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP 360
           + G RSALFLPF+ LGLI++DEEHD +YKQE+ + YNARDM++VRG+I  FPV+LVSATP
Sbjct: 308 VAGARSALFLPFEDLGLIIVDEEHDPAYKQEDRVFYNARDMAVVRGRIGDFPVILVSATP 367

Query: 361 SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR 420
           S+ES+VNG S RY +VHL TR+ ++ALP L +IDMR     +G  LSP +I  I  T+ +
Sbjct: 368 SVESQVNGQSGRYSTVHLPTRFGDAALPDLHLIDMRRHAPERGGFLSPVLIRAIGKTVEK 427

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
            EQ LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEHR +K+L CHQCGH+    ++C 
Sbjct: 428 REQALLFLNRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRKQLQCHQCGHAERTPEACP 487

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
            CG+   ++ACG G+ERIAEEV  +FP AR  +LSSD+ GG  RL+L+L AIAKGE DI+
Sbjct: 488 ECGTLDHLVACGPGVERIAEEVERHFPEARTIVLSSDIMGGVKRLRLELEAIAKGEADIV 547

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQLVAKGHNFP M+LVG+VD DLGL N D R++ERTFQLLSQVTGRAGR GLKS GL+
Sbjct: 548 IGTQLVAKGHNFPLMTLVGIVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSHGLL 607

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           Q YQP HPVMQA+VSGD+D+FYE EI  RE   LPPFGRLA++I+S     + EN+A  +
Sbjct: 608 QTYQPQHPVMQAIVSGDSDAFYEREITERERAILPPFGRLASIIVSAETRHDAENHARGM 667

Query: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
           +  AP+ S I V GPAE+PL +VRGR+RFRLL+HG+RNS++QGF   M   + K   +++
Sbjct: 668 RNAAPQVSGISVLGPAEAPLALVRGRHRFRLLVHGRRNSDMQGFLRAMLSQSPKERGSVQ 727

Query: 721 VQFDIDPQNFL 731
           VQ DIDPQ+FL
Sbjct: 728 VQLDIDPQSFL 738