BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780619|ref|YP_003065032.1| primosome assembly protein
PriA [Candidatus Liberibacter asiaticus str. psy62]
         (731 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780619|ref|YP_003065032.1| primosome assembly protein PriA [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040296|gb|ACT57092.1| primosome assembly protein PriA [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 731

 Score = 1496 bits (3874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/731 (100%), Positives = 731/731 (100%)

Query: 1   MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYN 60
           MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYN
Sbjct: 1   MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYN 60

Query: 61  SEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKM 120
           SEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKM
Sbjct: 61  SEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKM 120

Query: 121 EEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIF 180
           EEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIF
Sbjct: 121 EEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIF 180

Query: 181 EVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVA 240
           EVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVA
Sbjct: 181 EVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVA 240

Query: 241 AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV 300
           AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV
Sbjct: 241 AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV 300

Query: 301 IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP 360
           IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP
Sbjct: 301 IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP 360

Query: 361 SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR 420
           SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR
Sbjct: 361 SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR 420

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
           NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV
Sbjct: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
           VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII
Sbjct: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI
Sbjct: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL
Sbjct: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660

Query: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
           KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR
Sbjct: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720

Query: 721 VQFDIDPQNFL 731
           VQFDIDPQNFL
Sbjct: 721 VQFDIDPQNFL 731


>gi|315121820|ref|YP_004062309.1| primosome assembly protein PriA [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495222|gb|ADR51821.1| primosome assembly protein PriA [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 729

 Score = 1227 bits (3174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/731 (80%), Positives = 659/731 (90%), Gaps = 2/731 (0%)

Query: 1   MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYN 60
           M SS +S E  VCS V++LLLQAVS PY YSVPS M+V LGSIVRVPLRSRTVLG+VWY+
Sbjct: 1   MVSSVTSSEAEVCSSVVVLLLQAVSSPYTYSVPSDMRVGLGSIVRVPLRSRTVLGVVWYD 60

Query: 61  SEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKM 120
           S   Y  D+LKLRPIEYVFDCPPLS++MCEF+KWVA+YTFS MGLVARMVVSALSETEKM
Sbjct: 61  S--VYTGDNLKLRPIEYVFDCPPLSQEMCEFIKWVANYTFSSMGLVARMVVSALSETEKM 118

Query: 121 EEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIF 180
           EEKIQFTGI PRINT ARLRVL++IKDGKIW KR+L+ ASQVSSHVIDGLK QGV+K+IF
Sbjct: 119 EEKIQFTGILPRINTAARLRVLNEIKDGKIWGKRNLMLASQVSSHVIDGLKEQGVVKKIF 178

Query: 181 EVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVA 240
           EV SPVV+SPN  F LP LD+NQ+DVVEQ++PLC+ GF+VSLISGVTGSGKTEVYLEI++
Sbjct: 179 EVASPVVESPNPNFFLPTLDQNQKDVVEQIMPLCSTGFSVSLISGVTGSGKTEVYLEIIS 238

Query: 241 AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV 300
           +VL LGKQVLILLPEISL SAIL+RFQKRFGVKPAEWHSSLS  MREKIWRQ+A+G ISV
Sbjct: 239 SVLRLGKQVLILLPEISLASAILDRFQKRFGVKPAEWHSSLSAGMREKIWRQIAQGTISV 298

Query: 301 IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP 360
           +VGVRSALFLPFKKLG+IVIDEEHDISYKQE+GILYNARDMSIVRGKIESFPV+LVSATP
Sbjct: 299 VVGVRSALFLPFKKLGIIVIDEEHDISYKQEDGILYNARDMSIVRGKIESFPVILVSATP 358

Query: 361 SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR 420
           SIESRVNG+S RYH  HLSTRY NSALPHL+VIDMR Q + +GK LS EM++ IR+TL R
Sbjct: 359 SIESRVNGLSGRYHFFHLSTRYHNSALPHLRVIDMRDQAVERGKFLSLEMLNSIRNTLER 418

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
           +EQ LLFLNRRGYAPLTLCQVCG+R+KC +CSCWLVEHR +KKL+CHQCG+   Y QSC 
Sbjct: 419 DEQALLFLNRRGYAPLTLCQVCGHRIKCPYCSCWLVEHRFRKKLHCHQCGYVEAYPQSCA 478

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
            CG+SGKMIACG G+ERIAEEV +YFPLARISILSSDL+GG  +L+LQL AIAKGE DI+
Sbjct: 479 ACGTSGKMIACGPGVERIAEEVRDYFPLARISILSSDLDGGIKKLRLQLEAIAKGEFDIV 538

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQLVAKGHNFPRMSLVGV+DGDLGL NADLRSSERTFQLLSQVTGRAGRFGLKS+GLI
Sbjct: 539 IGTQLVAKGHNFPRMSLVGVIDGDLGLANADLRSSERTFQLLSQVTGRAGRFGLKSIGLI 598

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           QAYQP HPVMQAL+SGDADSFYESEIRAR+ V LPPFGRLAAVI+SG K QEV+ YA NL
Sbjct: 599 QAYQPIHPVMQALISGDADSFYESEIRARKEVGLPPFGRLAAVIVSGKKCQEVKKYACNL 658

Query: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
           KE AP SSDIVVFGPAE+PLFMVRG YRFRLLIHGKRNSNLQ FF+ MYDNT K+SN+LR
Sbjct: 659 KEKAPMSSDIVVFGPAEAPLFMVRGFYRFRLLIHGKRNSNLQKFFAYMYDNTPKKSNSLR 718

Query: 721 VQFDIDPQNFL 731
           VQFD+DPQ+FL
Sbjct: 719 VQFDMDPQSFL 729


>gi|190893721|ref|YP_001980263.1| primosomal protein N' (replication factor Y) protein [Rhizobium
           etli CIAT 652]
 gi|190699000|gb|ACE93085.1| primosomal protein N' (replication factor Y) protein [Rhizobium
           etli CIAT 652]
          Length = 738

 Score =  857 bits (2213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/719 (57%), Positives = 520/719 (72%), Gaps = 5/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY YSVP  M VE GS+V+VPL  R V+G+VW   E+   +D  KLRPI
Sbjct: 22  VPVLVPMPAPKPYSYSVPEGMAVEPGSVVQVPLGPRQVIGVVWDGGEDG--VDPKKLRPI 79

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTGIFPRI 133
            +VFDCPPLSR+M +F+ WVA YT SP GLVARM + A +  E E M E ++F G  P  
Sbjct: 80  SHVFDCPPLSREMRDFIDWVAAYTLSPPGLVARMALRAPNAFEPEPMVEGLKFVGGEPER 139

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR RVLD   DG  W +  L  A+ VS+ V+DGL   G+ + IF    PVV  P+  
Sbjct: 140 MTPARARVLDTASDGLSWTRSGLAHAAGVSTSVVDGLITLGIFETIFLPPPPVVAMPDPD 199

Query: 194 FSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           F+   L+  Q++   ++V    KG FAVSLI GVTGSGKTEVY E +A  L  G+QVLIL
Sbjct: 200 FAAARLEGPQKEAAAEIVADVRKGEFAVSLIDGVTGSGKTEVYFEAIAETLKRGRQVLIL 259

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           LPEI+LT++ +ERFQ RFG KPAEWHS L+  MREK+WRQ   G + V+ G RSALFLPF
Sbjct: 260 LPEIALTASFMERFQDRFGAKPAEWHSDLAPRMREKVWRQAVTGEVRVVAGARSALFLPF 319

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
           + LGLI++DEEHD +YKQE+ + YNARDM++VRG+I  FPVVLVSATPS+ES+VNG S R
Sbjct: 320 EDLGLIIVDEEHDPAYKQEDRVFYNARDMAVVRGRIGDFPVVLVSATPSVESQVNGQSGR 379

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y +VHL TR+ ++ALP L +IDMR     +G  LSP +I  I  T+ R EQ LLFLNRRG
Sbjct: 380 YSTVHLPTRFGDAALPDLHLIDMRRHAPERGGFLSPVLIRAIGKTVERREQALLFLNRRG 439

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+VCG+R +C  CS WLVEHR +K+L CHQCGH+    ++C  CG+   ++ACG
Sbjct: 440 YAPLTLCRVCGHRFQCPQCSSWLVEHRFRKQLQCHQCGHAERTPEACPECGTLDHLVACG 499

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ERIAEEV  +FP AR  +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAKGHNF
Sbjct: 500 PGVERIAEEVERHFPEARTIVLSSDIMGGVKRLRLELDAIAKGEADIVIGTQLVAKGHNF 559

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P M+LVG++D DLGL N D R++ERTFQLLSQVTGRAGR GLKS GL+Q YQP HPVMQA
Sbjct: 560 PLMTLVGIIDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSHGLLQTYQPQHPVMQA 619

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           +VSGD+D+FYE EI  RE   LPPFGRLA++I+S     + EN+A  ++  AP+ S I V
Sbjct: 620 IVSGDSDAFYEREITERERAALPPFGRLASIIVSAETRHDAENHARGMRNAAPQVSGISV 679

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL +VRGR+RFRLL+HG+RNS++QGF   M   + K   +++VQ DIDPQ+FL
Sbjct: 680 LGPAEAPLALVRGRHRFRLLVHGRRNSDMQGFLRAMLSQSPKERGSVQVQLDIDPQSFL 738


>gi|241206630|ref|YP_002977726.1| primosome assembly protein PriA [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860520|gb|ACS58187.1| primosomal protein N' [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 738

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/731 (56%), Positives = 524/731 (71%), Gaps = 6/731 (0%)

Query: 5   GSSVEGVVCSRVI-ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE 63
           G+  E    +R + +L+      PY YSVP  M VE GS+V+VPL  R V+G+VW   E+
Sbjct: 10  GALFEAPPANRTVPVLVPMPAPKPYSYSVPDGMAVEPGSVVQVPLGPRQVIGVVWDGGED 69

Query: 64  KYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKME 121
              +D  KLRPI +VFDCPPL+R+M +F+ WVA YT SP GLVARM + A +  E E M 
Sbjct: 70  G--VDPKKLRPISHVFDCPPLAREMRDFIDWVATYTLSPPGLVARMALRAPNAFEPEPMV 127

Query: 122 EKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFE 181
           E ++  G  P   T AR RVLD   DG  W +  L  A+ VS+ V+DGL   G+ + IF 
Sbjct: 128 EGLKLVGGEPERMTPARARVLDTASDGFSWTRSGLAHAAGVSTSVVDGLITLGIFEAIFL 187

Query: 182 VISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVA 240
              PVV  P+  F+   L+  Q+   E++V    KG F+VSLI GVTGSGKTEVY E +A
Sbjct: 188 PPPPVVAMPDPDFAAARLEGPQKQAAEEIVADVRKGEFSVSLIDGVTGSGKTEVYFEAIA 247

Query: 241 AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV 300
             L  GKQVLILLPEI+LT++ +ERFQ RFG KPAEWHS L+  MREK+WRQ   G + V
Sbjct: 248 ETLKRGKQVLILLPEIALTASFMERFQDRFGAKPAEWHSDLAPRMREKVWRQAVTGEVRV 307

Query: 301 IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP 360
           + G RSALFLPF+ LGLI++DEEHD +YKQE+ + YNARDM++VRG+I  FPV+LVSATP
Sbjct: 308 VAGARSALFLPFEDLGLIIVDEEHDPAYKQEDRVFYNARDMAVVRGRIGDFPVILVSATP 367

Query: 361 SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR 420
           S+ES+VNG S RY +VHL TR+ ++A+P L ++DMR     +G  LSP +I  I  T+ +
Sbjct: 368 SVESQVNGQSGRYSTVHLPTRFGDAAMPDLHLVDMRRHAPERGGFLSPVLIRAIGKTVDK 427

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
            EQ LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEHR +K+L CHQCGH+    ++C 
Sbjct: 428 REQALLFLNRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRKQLQCHQCGHAERTPEACP 487

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
            CG+   ++ACG G+ERIAEEV  +FP AR  +LSSD+ GG  RL+L+L AIAKGE DI+
Sbjct: 488 ECGTLDHLVACGPGVERIAEEVERHFPEARTIVLSSDIMGGVKRLRLELEAIAKGEADIV 547

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQLVAKGHNFP M+LVG+VD DLGL N D R++ERTFQLLSQVTGRAGR GLKS GL+
Sbjct: 548 IGTQLVAKGHNFPLMTLVGIVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSHGLL 607

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           Q YQP HPVMQA+VSGD+D+FYE EI  RE   LPPFGRLA++I+S     + EN+A  +
Sbjct: 608 QTYQPQHPVMQAIVSGDSDAFYEREITERERAILPPFGRLASIIVSAETRHDAENHARGM 667

Query: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
           +  AP+ S I V GPAE+PL +VRGR+RFRLL+HG+RNS++QGF   M   + K   +++
Sbjct: 668 RNAAPQVSGISVLGPAEAPLALVRGRHRFRLLVHGRRNSDMQGFLRAMLSQSPKERGSVQ 727

Query: 721 VQFDIDPQNFL 731
           VQ DIDPQ+FL
Sbjct: 728 VQLDIDPQSFL 738


>gi|327188924|gb|EGE56116.1| primosomal protein N' (replication factor Y) protein [Rhizobium
           etli CNPAF512]
          Length = 809

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/719 (57%), Positives = 519/719 (72%), Gaps = 5/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY YSVP  M VE GS+V+VPL  R V+G+VW   E+   +D  KLRPI
Sbjct: 93  VPVLVPMPAPKPYSYSVPEGMAVEPGSVVQVPLGPRQVIGVVWDGGEDG--VDPKKLRPI 150

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTGIFPRI 133
            +VFDCPPLSR+M +F+ WVA YT SP GLVARM + A +  E E M E ++F G  P  
Sbjct: 151 SHVFDCPPLSREMRDFIDWVAAYTLSPPGLVARMALRAPNAFEPEPMVEGLKFVGGVPER 210

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR RVL+   DG  W +  L  A+ VS+ V+DGL   G+ + IF    PVV   +  
Sbjct: 211 LTPARARVLETASDGLSWTRSGLAHAAGVSTSVVDGLVTLGIFETIFLPPPPVVAVADPD 270

Query: 194 FSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           F+   L+  Q++   ++V    KG FAVSLI GVTGSGKTEVY E +A  L  G+QVLIL
Sbjct: 271 FAAARLEGPQKEAAAELVADVRKGEFAVSLIDGVTGSGKTEVYFEAIAETLKRGRQVLIL 330

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           LPEI+LT++ +ERFQ RFG KPAEWHS L+  MREK+WRQ   G + V+ G RSALFLPF
Sbjct: 331 LPEIALTASFMERFQDRFGAKPAEWHSDLAPRMREKVWRQAVTGEVRVVAGARSALFLPF 390

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
           + LGLI++DEEHD +YKQE+ + YNARDM++VRG+I  FPVVLVSATPS+ES+VNG S R
Sbjct: 391 EDLGLIIVDEEHDPAYKQEDRVFYNARDMAVVRGRIGDFPVVLVSATPSVESQVNGQSGR 450

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y +VHL TR+ ++ALP L +IDMR     +G  LSP +I  I  T+ R EQ LLFLNRRG
Sbjct: 451 YSTVHLPTRFGDAALPDLHLIDMRRHAPERGGFLSPVLIRAIGKTVERREQALLFLNRRG 510

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+VCG+R +C  CS WLVEHR +K+L CHQCGH+    ++C  CG+   ++ACG
Sbjct: 511 YAPLTLCRVCGHRFQCPQCSSWLVEHRFRKQLQCHQCGHAERTPEACPECGTLDHLVACG 570

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ERIAEEV  +FP AR  +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAKGHNF
Sbjct: 571 PGVERIAEEVERHFPEARTIVLSSDIMGGVKRLRLELDAIAKGEADIVIGTQLVAKGHNF 630

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P M+LVG++D DLGL N D R++ERTFQLLSQVTGRAGR GLKS GL+Q YQP HPVMQA
Sbjct: 631 PLMTLVGIIDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSHGLLQTYQPQHPVMQA 690

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           +VSGD+D+FYE EI  RE   LPPFGRLA++I+S     + EN+A  ++  AP+ S I V
Sbjct: 691 IVSGDSDAFYEREITERERAALPPFGRLASIIVSAETRHDAENHARGMRNAAPQVSGISV 750

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL +VRGR+RFRLL+HG+RNS++QGF   M   + K   +++VQ DIDPQ+FL
Sbjct: 751 LGPAEAPLALVRGRHRFRLLVHGRRNSDMQGFLRAMLSQSPKERGSVQVQLDIDPQSFL 809


>gi|116254144|ref|YP_769982.1| primosome assembly protein PriA [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258792|emb|CAK09898.1| putative primosomal protein N' (replication factor y) [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 738

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/731 (56%), Positives = 525/731 (71%), Gaps = 6/731 (0%)

Query: 5   GSSVEGVVCSRVI-ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE 63
           G+  E    +R + +L+      PY YSVP  M VE GS+V+VPL  R V+G+VW + E+
Sbjct: 10  GALFEAPPANRTVPVLVPMPAPKPYSYSVPDGMAVEPGSVVQVPLGPRQVIGVVWDSGED 69

Query: 64  KYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKME 121
              +D  KLRPI +VFDCPPL+R+M +F+ WVA YT SP GLVARM + A +  E E M 
Sbjct: 70  G--VDPKKLRPISHVFDCPPLAREMRDFIDWVATYTLSPPGLVARMALRAPNAFEPEPMV 127

Query: 122 EKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFE 181
           E ++  G  P   T AR RVLD   DG  W +  L  A+ VS+ V+DGL   G+ + +F 
Sbjct: 128 EGLKLVGGEPERMTPARARVLDTASDGFSWTRSGLAHAAGVSTSVVDGLITLGIFETVFL 187

Query: 182 VISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVA 240
              PVV  P+  F+   L+  Q+   E++V    KG F+VSLI GVTGSGKTEVY E +A
Sbjct: 188 PPPPVVAMPDPDFAAARLEGPQKQAAEEIVSDVRKGEFSVSLIDGVTGSGKTEVYFEAIA 247

Query: 241 AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV 300
             L  GKQVLILLPEI+LT++ +ERFQ RFG KPAEWHS L+  MREK+WRQ   G + V
Sbjct: 248 ETLKRGKQVLILLPEIALTASFMERFQDRFGAKPAEWHSDLAPRMREKVWRQAVTGEVRV 307

Query: 301 IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP 360
           + G RSALFLPF+ LGLI++DEEHD +YKQE+ + YNARDM++VRG+I  FPV+LVSATP
Sbjct: 308 VAGARSALFLPFEDLGLIIVDEEHDPAYKQEDRVFYNARDMAVVRGRIGDFPVILVSATP 367

Query: 361 SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR 420
           S+ES+VNG S RY +VHL TR+ ++A+P L ++DMR     +G  LSP +I  I  T+ +
Sbjct: 368 SVESQVNGQSGRYSTVHLPTRFGDAAMPDLHLVDMRRHAPERGGFLSPVLIRAIGKTVEK 427

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
            EQ LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEHR +K+L CHQCGH+    ++C 
Sbjct: 428 REQALLFLNRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRKQLQCHQCGHAERTPEACP 487

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
            CG+   ++ACG G+ERIAEEV  +FP AR  +LSSD+ GG  RL+L+L AIAKGE DI+
Sbjct: 488 ECGTLDHLVACGPGVERIAEEVERHFPEARTIVLSSDIMGGVKRLRLELEAIAKGEADIV 547

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQLVAKGHNFP M+LVG+VD DLGL N D R++ERTFQLLSQVTGRAGR GLKS GL+
Sbjct: 548 IGTQLVAKGHNFPLMTLVGIVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSHGLL 607

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           Q YQP HPVMQA+VSGD+D+FYE EI  RE   LPPFGRLA++I+S     + EN+A  +
Sbjct: 608 QTYQPQHPVMQAIVSGDSDAFYEREITERERALLPPFGRLASIIVSAETRHDAENHARGM 667

Query: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
           +  AP+ S I V GPAE+PL +VRGR+RFRLL+HG+RNS++QGF   M   + K   +++
Sbjct: 668 RNAAPQVSGISVLGPAEAPLALVRGRHRFRLLVHGRRNSDMQGFLRVMLSQSPKERGSVQ 727

Query: 721 VQFDIDPQNFL 731
           VQ DIDPQ+FL
Sbjct: 728 VQLDIDPQSFL 738


>gi|86359456|ref|YP_471348.1| primosome assembly protein PriA [Rhizobium etli CFN 42]
 gi|86283558|gb|ABC92621.1| primosomal protein N` (replication factor Y) [Rhizobium etli CFN
           42]
          Length = 738

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/731 (56%), Positives = 524/731 (71%), Gaps = 6/731 (0%)

Query: 5   GSSVEGVVCSRVI-ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE 63
           G+  E    +R + +L+      PY YSVP  M VE GS+V+VPL  R V+G+VW   E+
Sbjct: 10  GALFEAPPANRTVPVLVPMPAPKPYSYSVPEGMAVEPGSVVQVPLGPRQVIGVVWDGGED 69

Query: 64  KYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKME 121
              +D  KLRPI +VFDCPPLS++M +F+ WVA YT SP GLVARM + A +  E E M 
Sbjct: 70  G--VDPKKLRPISHVFDCPPLSKEMRDFIDWVASYTLSPPGLVARMALRAPNAFEPEPMV 127

Query: 122 EKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFE 181
           E ++F G  P   T AR RVL+   DG  W +  L  A+ VS+ V+DGL   G+ + +F 
Sbjct: 128 EGLKFVGGEPERMTPARARVLETASDGLSWTRSGLAHAAGVSTSVVDGLITLGIFESMFL 187

Query: 182 VISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVA 240
              PVV  P+  F+   L+  Q++   ++V    +G F+VSLI GVTGSGKTEVY E +A
Sbjct: 188 PPPPVVAMPDPDFAAARLEGPQKEAAAEIVSGVRRGEFSVSLIDGVTGSGKTEVYFEAIA 247

Query: 241 AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV 300
             L  GKQVLILLPEI+LT++ LERFQ RFG KPAEWHS L+  MREK+WRQ   G + V
Sbjct: 248 ETLKRGKQVLILLPEIALTASFLERFQDRFGAKPAEWHSDLAPRMREKVWRQAVTGEVRV 307

Query: 301 IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP 360
           + G RSALFLPF+ LGLI++DEEHD +YKQE+ + YNARDM++VRG+I  FPV+LVSATP
Sbjct: 308 VAGARSALFLPFEDLGLIIVDEEHDPAYKQEDRVFYNARDMAVVRGRIGDFPVILVSATP 367

Query: 361 SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR 420
           S+ES+VNG   RY +VHL TR+ ++ALP L +IDMR     +G  LSP +I  I  T+ R
Sbjct: 368 SVESQVNGQIGRYSTVHLPTRFGDAALPDLHLIDMRRHAPERGGFLSPVLIRAISKTVER 427

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
            EQ LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEHR +K+L CHQCGH+    ++C 
Sbjct: 428 REQALLFLNRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRKQLQCHQCGHAERTPEACP 487

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
            CG+   ++ACG G+ERIAEEV  +FP AR  +LSSD+ GG  RL+L+L AIAKGE DI+
Sbjct: 488 ECGTLDHLVACGPGVERIAEEVERHFPEARTIVLSSDMMGGVKRLRLELDAIAKGEADIV 547

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQLVAKGHNFP M+LVG+VD DLGL N D R++ERTFQLLSQVTGRAGR GLKS GL+
Sbjct: 548 IGTQLVAKGHNFPLMTLVGIVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSHGLL 607

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           Q YQP HPVMQA+VSGD+D+FYE EI  RE   LPPFGRLA++I+S     + EN+A  +
Sbjct: 608 QTYQPQHPVMQAIVSGDSDAFYEREITERERAALPPFGRLASIIVSAETRHDAENHARGM 667

Query: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
           +  AP+ S I V GPAE+PL +VRGR+RFRLL+HG+RNS++QGF   M   + K   +++
Sbjct: 668 RNAAPQVSGISVLGPAEAPLALVRGRHRFRLLVHGRRNSDMQGFLRAMLSQSPKERGSVQ 727

Query: 721 VQFDIDPQNFL 731
           VQ DIDPQ+F+
Sbjct: 728 VQLDIDPQSFV 738


>gi|209551229|ref|YP_002283146.1| primosome assembly protein PriA [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536985|gb|ACI56920.1| primosomal protein N' [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 738

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/731 (56%), Positives = 525/731 (71%), Gaps = 6/731 (0%)

Query: 5   GSSVEGVVCSRVI-ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE 63
           G+  E    +R + +L+      PY YSVP  M VE GS+V+VPL  R V+G+VW   E+
Sbjct: 10  GALFEAPPANRTVPVLVPMPAPKPYSYSVPDGMAVEPGSVVQVPLGPRQVIGVVWDGGED 69

Query: 64  KYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKME 121
              +D  KLRPI +VFDCPPL+R+M +F+ WVA YT SP GLVARM + A +  E E M 
Sbjct: 70  G--VDPKKLRPISHVFDCPPLTREMRDFIDWVAAYTLSPPGLVARMALRAPNAFEPEPMV 127

Query: 122 EKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFE 181
           E ++F G  P   T AR RVLD   DG  W +  L  A+ VS+ V+DGL   G+ + IF 
Sbjct: 128 EGLKFVGGEPERMTPARARVLDTASDGLSWTRSGLAHAAGVSTSVVDGLITLGIFETIFL 187

Query: 182 VISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVA 240
              PVV  P+  F+   L+  Q++   ++V    KG F+VSLI GVTGSGKTEVY E +A
Sbjct: 188 PPPPVVALPDPEFTAARLEGPQKEAAAEIVSDVRKGDFSVSLIDGVTGSGKTEVYFEAIA 247

Query: 241 AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV 300
             L  GKQVLILLPEI+LT++ LERFQ RFG KPAEWHS L+  MREK+WRQ   G + V
Sbjct: 248 ETLKRGKQVLILLPEIALTASFLERFQDRFGAKPAEWHSDLAPRMREKVWRQAVTGEVRV 307

Query: 301 IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP 360
           + G RSALFLPF+ LGLI++DEEHD +YKQE+ + YNARDM++VRG+I  FPV+LVSATP
Sbjct: 308 VAGARSALFLPFEDLGLIIVDEEHDPAYKQEDRVFYNARDMAVVRGRIGDFPVILVSATP 367

Query: 361 SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR 420
           S+ES+VNG S RY +VHL TR+ ++ALP L +IDMR     +G  LSP +I  I  T+ +
Sbjct: 368 SVESQVNGQSGRYSTVHLPTRFGDAALPDLHLIDMRRHAPERGGFLSPVLIRAIGKTVEK 427

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
            EQ LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEHR +K+L CHQCGH+    ++C 
Sbjct: 428 REQALLFLNRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRKQLQCHQCGHAERTPEACP 487

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
            CG+   ++ACG G+ERIAEEV  +FP AR  +LSSD+ GG  RL+L+L AIAKGE DI+
Sbjct: 488 ECGTLDHLVACGPGVERIAEEVERHFPEARTIVLSSDIMGGVKRLRLELEAIAKGEADIV 547

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQLVAKGHNFP M+LVG+VD DLGL N D R++ERTFQLLSQVTGRAGR GLKS GL+
Sbjct: 548 IGTQLVAKGHNFPLMTLVGIVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSHGLL 607

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           Q YQP HPVMQA+VSGD+D+FYE EI  RE   LPPFGRLA++I+S     + EN+A  +
Sbjct: 608 QTYQPQHPVMQAIVSGDSDAFYEREITERERAILPPFGRLASIIVSAETRHDAENHARGM 667

Query: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
           +  AP+ S I V GPAE+PL +VRGR+RFRLL+HG+RNS++QGF   M   + K   +++
Sbjct: 668 RNAAPQVSGISVLGPAEAPLALVRGRHRFRLLVHGRRNSDMQGFLRAMLSQSPKERGSVQ 727

Query: 721 VQFDIDPQNFL 731
           VQ DIDPQ+FL
Sbjct: 728 VQLDIDPQSFL 738


>gi|222087443|ref|YP_002545980.1| primosomal protein N' [Agrobacterium radiobacter K84]
 gi|221724891|gb|ACM28047.1| primosomal protein N' [Agrobacterium radiobacter K84]
          Length = 743

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/729 (55%), Positives = 522/729 (71%), Gaps = 4/729 (0%)

Query: 6   SSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKY 65
           +  + V+   V +L+    S PY Y+VP  M VE GS+V+VPL  R V+G+VW   +E  
Sbjct: 16  APAKAVMTRTVPVLVPMPASKPYSYAVPEGMAVEPGSVVQVPLGPRQVIGVVWDGGDEG- 74

Query: 66  KIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEK 123
            +D  KLRPI  VFDCPPL++QM +F+ WVA YT SP GLVARM   V A  + E M E 
Sbjct: 75  GVDPKKLRPISRVFDCPPLAKQMRDFIDWVAAYTLSPPGLVARMALRVPAAFDPEPMVEG 134

Query: 124 IQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVI 183
           ++F G  P   T AR+RV++   DG  W +  L  A+ VS+ VIDGL  QGV + +F   
Sbjct: 135 LRFAGGTPERLTPARVRVMEMANDGLSWTRSGLAHAAGVSTSVIDGLITQGVFETVFLPP 194

Query: 184 SPVVDSPNLYFSLPILDKNQQDVVEQV-VPLCTKGFAVSLISGVTGSGKTEVYLEIVAAV 242
            P+V  P+  ++   L+  Q++  +++ V +  + F+VSLI GVTGSGKTEVY E +A  
Sbjct: 195 PPLVAKPDPDYAASRLEGPQREAADEILVEVRKQEFSVSLIDGVTGSGKTEVYFEAIAET 254

Query: 243 LHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIV 302
           L  GKQVLILLPEI+LT++ LERFQ RFG KPAEWHS L+   REK+WRQ   G + V+ 
Sbjct: 255 LKRGKQVLILLPEIALTASFLERFQDRFGAKPAEWHSDLAPRTREKVWRQAVTGEVRVVA 314

Query: 303 GVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSI 362
           G RSALFLPF+ LGLI++DEEHD +YKQE+ + YNARDM++VRG+I  FPVVLVSATPS+
Sbjct: 315 GARSALFLPFEDLGLIIVDEEHDPAYKQEDRVYYNARDMAVVRGRIADFPVVLVSATPSV 374

Query: 363 ESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNE 422
           ES+VNG S RY ++HL TR+ ++A+P L ++DMR     +G  LSP +I  I  T+ + +
Sbjct: 375 ESQVNGQSGRYSTIHLPTRFGDAAMPDLHLVDMRRHAPERGGFLSPLLIRAIGKTVEKGQ 434

Query: 423 QTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVC 482
           Q+LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG++    ++C  C
Sbjct: 435 QSLLFLNRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLQCHQCGYAERTPEACPEC 494

Query: 483 GSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIG 542
           G+   ++ACG G+ERIAEEV  +FP AR  +LSSD+ GG  RL+L+L AIAKGE DI+IG
Sbjct: 495 GTLDHLVACGPGVERIAEEVERHFPEARTIVLSSDIMGGVKRLRLELDAIAKGEADIVIG 554

Query: 543 TQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQA 602
           TQLVAKGHNFP M+LVG++D DLGL N D R++ERTFQLLSQVTGRAGR GLKS GL+Q 
Sbjct: 555 TQLVAKGHNFPLMTLVGIIDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSHGLLQT 614

Query: 603 YQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE 662
           YQP HPVMQA+VSGDA +FYE EI  RE   LPPFGRLA++I+S    Q+ E +A +++ 
Sbjct: 615 YQPQHPVMQAIVSGDASAFYEREISERERAVLPPFGRLASIIVSAETRQDAETHARSMRS 674

Query: 663 HAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQ 722
            AP+   I V GPAE+PL +VRGR+RFRLL+HGKRNS++QGF   +     K   ++ VQ
Sbjct: 675 AAPQVQGISVLGPAEAPLALVRGRHRFRLLVHGKRNSDMQGFLRALLAQAPKERGSVHVQ 734

Query: 723 FDIDPQNFL 731
            DIDPQ+FL
Sbjct: 735 LDIDPQSFL 743


>gi|319780911|ref|YP_004140387.1| DEAD/DEAH helicase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166799|gb|ADV10337.1| primosomal protein N' [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 727

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/717 (57%), Positives = 511/717 (71%), Gaps = 5/717 (0%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +L+      PY Y+VP+ M+V  GSIVRVPL  R V GIVW  + EK  +D+ KLRPIE 
Sbjct: 13  VLVPMPAERPYTYAVPAGMRVAPGSIVRVPLGPRQVAGIVWDGAVEK--VDAKKLRPIEQ 70

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTGIFPRINT 135
           VFDCPP+ R M  FV WVA YT SP G+VARM++ A    + E   E +Q T + P   T
Sbjct: 71  VFDCPPIDRAMRRFVDWVAQYTLSPPGMVARMLLRAPEAFDPEPWIEGLQRTLLAPDRMT 130

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
            AR RVL+  + G  W +  L  A+ VSS VIDGL+AQGV + +     PVV +P+  ++
Sbjct: 131 GARQRVLETAEGGLAWTRSGLAHAAGVSSTVIDGLRAQGVFETVMIPPRPVVAAPDPGYA 190

Query: 196 LPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLP 254
           +P L  +Q    + +      G F V+L+ GVTGSGKTEVY E VAA L  G+QVLILLP
Sbjct: 191 IPELMPDQGAAAQMLRANVAAGVFNVALLDGVTGSGKTEVYFEAVAAALDQGRQVLILLP 250

Query: 255 EISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKK 314
           EI+LT A LERFQ+RFG KP EWHS L   MRE++WRQVA G + V+ G RSALFLPFK+
Sbjct: 251 EIALTHAFLERFQQRFGAKPGEWHSDLPPRMRERVWRQVAEGGVRVVAGARSALFLPFKE 310

Query: 315 LGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYH 374
           LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPS+ESRVN    +Y+
Sbjct: 311 LGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSVESRVNASQGKYN 370

Query: 375 SVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYA 434
              LS R+  +ALPHL+ +DMR    A+G  LSP ++D +R TL R EQ+LLFLNRRGYA
Sbjct: 371 RAVLSARFAEAALPHLKAVDMRRAPPARGGFLSPVLLDQMRQTLERQEQSLLFLNRRGYA 430

Query: 435 PLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFG 494
           PLTLC+VCG+R  C  CS WLVEHR + +L CH CGH+    ++C  CG+   ++ACG G
Sbjct: 431 PLTLCRVCGHRFGCPVCSAWLVEHRFRGQLVCHHCGHNERRPEACPECGTLDHLVACGPG 490

Query: 495 IERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPR 554
           +ERIAEEV  +FP AR  +LSSDL GG  RL+L+L AIA GE DI+IGTQLVAKGHNFP 
Sbjct: 491 VERIAEEVVTHFPDARTIVLSSDLMGGVRRLRLELEAIADGEADIVIGTQLVAKGHNFPN 550

Query: 555 MSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALV 614
           M+LVGVVD DLGL N D R++ERTFQLLSQVTGRAGR G KSLGL+Q +QP HPVM+A+V
Sbjct: 551 MTLVGVVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGKKSLGLLQTFQPDHPVMRAIV 610

Query: 615 SGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFG 674
           SGDA++FYE EI  RE   LPPFGRLA VI+S     E E +A  L+  AP +SD+ V G
Sbjct: 611 SGDAEAFYEREIAERERAALPPFGRLAGVIVSAVTRAEAEGHARGLRRAAPEASDLFVLG 670

Query: 675 PAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           PAE+PL ++ GR+RFRLLI G+R +++QGF   M  N  K+  ++RVQ D+DPQ+FL
Sbjct: 671 PAEAPLSLLGGRHRFRLLIQGERRADMQGFIRTMLANGPKQRGSVRVQVDVDPQSFL 727


>gi|150398124|ref|YP_001328591.1| primosome assembly protein PriA [Sinorhizobium medicae WSM419]
 gi|150029639|gb|ABR61756.1| primosomal protein N' [Sinorhizobium medicae WSM419]
          Length = 734

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/736 (55%), Positives = 523/736 (71%), Gaps = 7/736 (0%)

Query: 1   MASSGSSVEGVVCSRVIILLLQAVSGP--YIYSVPSAMKVELGSIVRVPLRSRTVLGIVW 58
           M    + + G V  R ++ +L  +  P  Y Y+VP  M VE GSIV+VPL  R V+G+VW
Sbjct: 1   MTLDSTDLFGPVLDRRVVPVLVPMPAPRAYSYAVPEGMAVEPGSIVQVPLGPRFVVGVVW 60

Query: 59  YNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--E 116
            + E+   +D  KLR IE VFDCPPLS +M  F+ WVA YT +P GLVARM + A +  +
Sbjct: 61  -DGEDDGGVDPKKLRAIEKVFDCPPLSPEMRAFLDWVAAYTLTPPGLVARMALRAPAAFD 119

Query: 117 TEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVI 176
            E M E ++ T + P   T AR RVL +  DG  W +  L  A+ VSS VIDGL +QGV 
Sbjct: 120 PEPMVEALRLTDMRPERMTTARERVLARASDGLSWTRSGLAHAAGVSSSVIDGLASQGVF 179

Query: 177 KQIFEVISPVVDSPNLYFSLPILDKNQ-QDVVEQVVPLCTKGFAVSLISGVTGSGKTEVY 235
           + +F    PVV  P+  F+ P L+  Q Q  V+ +  +  + F+VSLI G+TGSGKTEVY
Sbjct: 180 ETVFMPPPPVVALPDPAFAAPRLEGPQRQAAVDLLAAVEERKFSVSLIDGITGSGKTEVY 239

Query: 236 LEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVAR 295
            E +AA L  G+QVLILLPEI+LT++ LERFQ RFG KPAEWHS L+   REK+WRQV  
Sbjct: 240 FEAIAATLRAGRQVLILLPEIALTASFLERFQDRFGAKPAEWHSDLAPRTREKVWRQVTT 299

Query: 296 GAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVL 355
           G + V+ G RSALFLPF++LGLI++DEEHD +YKQE+ + YNARDM++VRG+I +FPVVL
Sbjct: 300 GQVRVVAGARSALFLPFEELGLIIVDEEHDPAYKQEDRVFYNARDMAVVRGRIGNFPVVL 359

Query: 356 VSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIR 415
           VSATPS+ESRVNG   RY  +HL TRY ++ALP L ++DMR     +G  LSP +++ I 
Sbjct: 360 VSATPSVESRVNGEMGRYRPIHLPTRYGDAALPDLGIVDMRRHPPERGGFLSPVLVNHIG 419

Query: 416 HTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIY 475
            T+ R++Q LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEHR + ++ CH CG+S   
Sbjct: 420 KTIGRSQQALLFLNRRGYAPLTLCRVCGHRFQCPDCSSWLVEHRFRGQIQCHHCGYSERT 479

Query: 476 SQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKG 535
            ++C  CG+   ++ACG G+ERIAEEV  +FP AR  +LSSDL  G  RL+L+L AIA+G
Sbjct: 480 PEACPECGTLDHLVACGPGVERIAEEVERHFPDARTIVLSSDLM-GVKRLRLELEAIARG 538

Query: 536 EIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLK 595
           E DI+IGTQLVAKGHNFP M+LVG+VD DLGL N D R++ERTFQLLSQVTGRAGR GLK
Sbjct: 539 EADIVIGTQLVAKGHNFPNMTLVGIVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLK 598

Query: 596 SLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVEN 655
           SLGL+Q YQP HPVMQA+VSGD+D+FY+ EI  RE   LPPFGRLA++I+S     + E 
Sbjct: 599 SLGLLQTYQPQHPVMQAIVSGDSDAFYQREIHERERAALPPFGRLASIIVSADSRGDAEG 658

Query: 656 YAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKR 715
           +A  L+  APR   I + GPAE+PL ++RGR+RFRLL+HG+RNS++Q F   M     K 
Sbjct: 659 HARGLRNAAPRVDGIAILGPAEAPLALIRGRHRFRLLVHGRRNSDMQTFVRAMIAAGPKE 718

Query: 716 SNALRVQFDIDPQNFL 731
             ++ VQ DIDPQ+FL
Sbjct: 719 RGSISVQLDIDPQSFL 734


>gi|260466808|ref|ZP_05812993.1| primosomal protein N' [Mesorhizobium opportunistum WSM2075]
 gi|259029420|gb|EEW30711.1| primosomal protein N' [Mesorhizobium opportunistum WSM2075]
          Length = 727

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/717 (57%), Positives = 506/717 (70%), Gaps = 5/717 (0%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +L+      PY Y+VP+ M+V  GSIVRVPL  R V GIVW    E   ID+ KLRPIE 
Sbjct: 13  VLVPMPAERPYTYAVPAGMRVVPGSIVRVPLGPRQVAGIVWDGVVEN--IDAKKLRPIEQ 70

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTGIFPRINT 135
           VFDCPP+ R M  FV WVA YT S  G+VARM++ A    + E   E +Q T + P   T
Sbjct: 71  VFDCPPIDRSMRRFVDWVAQYTLSAPGMVARMLLRAPEAFDPEPWIEGLQRTLLVPDRMT 130

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
            AR RVL+  + G  W +  L  A+ VSS VI+GLKAQGV + +     PVV +P+  ++
Sbjct: 131 SARERVLEVAEGGLAWTRSGLAHAAGVSSTVIEGLKAQGVFETVMIPPRPVVAAPDSLYA 190

Query: 196 LPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLP 254
           +P L  +Q D    +      G F V+L+ GVTGSGKTEVY E VAA L  GKQVLILLP
Sbjct: 191 VPELMPDQNDAASMLRANVAAGTFNVALLDGVTGSGKTEVYFEAVAAALDQGKQVLILLP 250

Query: 255 EISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKK 314
           EI+LT A LERFQ+RFG KP EWHS L   MREK+WRQVA G + V+ G RSALFLPFK+
Sbjct: 251 EIALTHAFLERFQQRFGAKPGEWHSDLPPRMREKVWRQVAEGTVRVVAGARSALFLPFKE 310

Query: 315 LGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYH 374
           LGLIV+DEEHD +YKQE+ + YNARDM++VRG I  FPVVL SATPS+ESRVN    +Y+
Sbjct: 311 LGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGGFPVVLASATPSVESRVNASQGKYN 370

Query: 375 SVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYA 434
              LS R+  +ALP L+ IDMR    A+G  LSP ++D +R TL R EQ+LLFLNRRGYA
Sbjct: 371 RAILSARFAEAALPQLKSIDMRRAPPARGGFLSPVLLDHMRQTLERKEQSLLFLNRRGYA 430

Query: 435 PLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFG 494
           PLTLC+VCG+R  C  CS WLVEHR + +L CH CGH+    ++C  CG+   ++ACG G
Sbjct: 431 PLTLCRVCGHRFGCPVCSAWLVEHRFRGQLVCHHCGHNERRPEACPECGTLDHLVACGPG 490

Query: 495 IERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPR 554
           +ERIAEEV  +FP AR  +LSSDL GG  RL+L+L AIA GE DI+IGTQLVAKGHNFP 
Sbjct: 491 VERIAEEVVAHFPDARTIVLSSDLMGGVRRLRLELEAIADGEADIVIGTQLVAKGHNFPN 550

Query: 555 MSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALV 614
           M+LVGVVD DLGL N D R++ERTFQLLSQVTGRAGR G KSLGL+Q +QP HPVM+A+V
Sbjct: 551 MTLVGVVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGKKSLGLLQTFQPDHPVMRAIV 610

Query: 615 SGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFG 674
           SGDA++FYE EI  RE   LPPFGRLA VI+S     E E +A  L+  AP SSD+ V G
Sbjct: 611 SGDAEAFYEREIAERERAALPPFGRLAGVIVSAVTRAEAEGHARGLRRAAPESSDLFVLG 670

Query: 675 PAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           PAE+PL ++ GR+RFRLLI G+R +++QGF   M  N  K+  ++RVQ DIDPQ+FL
Sbjct: 671 PAEAPLSLLGGRHRFRLLIQGERRADMQGFIRAMLANGPKQRGSVRVQVDIDPQSFL 727


>gi|13473463|ref|NP_105030.1| primosome assembly protein PriA [Mesorhizobium loti MAFF303099]
 gi|14024212|dbj|BAB50816.1| primosomal replication factor Y; primosomal protein N'
           [Mesorhizobium loti MAFF303099]
          Length = 727

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/717 (57%), Positives = 506/717 (70%), Gaps = 5/717 (0%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +L+      PY Y+VP+ M+V  GSIVRVPL  R V GIVW  + E   +D+ KLR IE 
Sbjct: 13  VLVPMPAERPYTYAVPAGMRVVPGSIVRVPLGPRQVAGIVWDGAVET--VDAKKLRSIEQ 70

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTGIFPRINT 135
           VFDCPP+ R M  FV WVA YT S  G+VARM++ A    + E   E +Q T I P   T
Sbjct: 71  VFDCPPIDRSMRRFVDWVAQYTLSAPGMVARMLLRAPEAFDPEPWIEGLQRTLIIPDRMT 130

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
            AR RVL+  + G  W +  L  A+ VSS VI+GLKAQGV + +     PVV +P+  ++
Sbjct: 131 DARARVLETAEGGLAWTRSGLAHAAGVSSTVIEGLKAQGVFETVMIPPRPVVAAPDPSYA 190

Query: 196 LPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLP 254
           +P L  +Q D    +      G F V+L+ GVTGSGKTEVY E VAA L  GKQVLILLP
Sbjct: 191 VPELMPDQSDAASMLRANVAAGAFNVALLDGVTGSGKTEVYFEAVAAALDQGKQVLILLP 250

Query: 255 EISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKK 314
           EI+LT A LERFQ+RFG KP EWHS L   MREK+WRQVA G + V+ G RSALFLPFK+
Sbjct: 251 EIALTHAFLERFQQRFGAKPGEWHSDLPPRMREKVWRQVAEGTVRVVAGARSALFLPFKE 310

Query: 315 LGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYH 374
           LGLIV+DEEHD +YKQE+ + YNARDM++VRG I  FPVVL SATPS+ESRVN    +Y+
Sbjct: 311 LGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGGFPVVLASATPSVESRVNASQGKYN 370

Query: 375 SVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYA 434
              LS R+  +ALP L+ IDMR    A+G  LSP +ID +R TL + EQ+LLFLNRRGYA
Sbjct: 371 RAILSARFAEAALPQLKSIDMRRAPPARGGFLSPVLIDHMRKTLEKKEQSLLFLNRRGYA 430

Query: 435 PLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFG 494
           PLTLC+VCG+R  C  CS WLVEHR + +L CH CGH+    ++C  CG+   ++ACG G
Sbjct: 431 PLTLCRVCGHRFGCPVCSAWLVEHRFRGQLVCHHCGHNERRPEACPECGTLDHLVACGPG 490

Query: 495 IERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPR 554
           +ERIAEEV  +FP AR  +LSSDL GG  RL+L+L AIA GE DI+IGTQLVAKGHNFP 
Sbjct: 491 VERIAEEVVTHFPDARTIVLSSDLMGGVRRLRLELEAIADGEADIVIGTQLVAKGHNFPN 550

Query: 555 MSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALV 614
           M+LVGVVD DLGL N D R++ERTFQLLSQVTGRAGR G KSLGL+Q +QP HPVM+A+V
Sbjct: 551 MTLVGVVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGKKSLGLLQTFQPDHPVMRAIV 610

Query: 615 SGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFG 674
           SGDA++FYE EI  RE   LPPFGRLA VI+S     E E +A  L+  AP +SD+ V G
Sbjct: 611 SGDAEAFYEREIAERERAALPPFGRLAGVIVSAVTRAEAEGHARGLRRAAPEASDLFVLG 670

Query: 675 PAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           PAE+PL ++ GR+RFRLLI G+R +++QGF   M  N  K+  ++RVQ DIDPQ+FL
Sbjct: 671 PAEAPLSLLGGRHRFRLLIQGERRADMQGFIRAMLANGPKQRGSVRVQVDIDPQSFL 727


>gi|325293996|ref|YP_004279860.1| primosome assembly protein PriA [Agrobacterium sp. H13-3]
 gi|325061849|gb|ADY65540.1| primosome assembly protein PriA [Agrobacterium sp. H13-3]
          Length = 738

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/719 (56%), Positives = 509/719 (70%), Gaps = 5/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+     GPY Y+VP  M VE GSIV+VPL  R V G+VW ++ EK  +D  KLRPI
Sbjct: 22  VPVLVPMPAPGPYSYAVPDDMVVETGSIVQVPLGPRQVFGVVWDDAGEK-SVDPKKLRPI 80

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTGIFPRI 133
              F+CPPL  +M  F+ WVA YT SP GLVARM + A +  + E M E ++ T   P  
Sbjct: 81  TKSFECPPLKAEMRRFIDWVAAYTLSPPGLVARMALRAPAAFDPEPMIEGLRLTEGRPER 140

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR RV++   +G  W K  L  A+ VS+ V+DGL  QGV + +F    PVV  P+  
Sbjct: 141 LTPARARVMELAAEGHGWTKSGLAHAAGVSTSVVDGLVKQGVFETVFLPAPPVVAEPDPD 200

Query: 194 FSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           ++ P L+  Q+    +++    KG F VSLI GVTGSGKTEVY E VA  L  GKQVLIL
Sbjct: 201 YAEPRLEGPQKQAASEILEDVRKGGFHVSLIDGVTGSGKTEVYFEAVAETLRQGKQVLIL 260

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           LPEI+LT+A L+RF  RFG KPAEWHS LS  MREK+WRQ   G + V+ G RSALFLPF
Sbjct: 261 LPEIALTAAFLDRFHDRFGAKPAEWHSDLSPRMREKVWRQAVTGEVKVVAGARSALFLPF 320

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
             LGLI++DEEHD +YKQE+ + YNARDM++VR +I  FPVVLVSATPS+ES+VNG S R
Sbjct: 321 DNLGLIIVDEEHDPAYKQEDRVFYNARDMAVVRARIGDFPVVLVSATPSVESQVNGSSGR 380

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y+++HL TR+ ++A+P L +IDMR     +G  LSP ++ GI  T+ + EQ+LLFLNRRG
Sbjct: 381 YNTIHLHTRFGDAAMPDLHLIDMRRHPPERGGFLSPVLLRGIGKTIEKGEQSLLFLNRRG 440

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCGH+      C  CG+   ++ACG
Sbjct: 441 YAPLTLCRVCGHRFQCPQCSSWLVEHRFRNQLQCHQCGHNEPTPDHCPECGTFDHLVACG 500

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ERIAEEV ++FP AR  +LSSDL  G  RL+L+L AI KGE DI+IGTQLVAKGHNF
Sbjct: 501 PGVERIAEEVEKHFPEARTIVLSSDLM-GVKRLRLELEAIVKGEADIVIGTQLVAKGHNF 559

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P M+LVG+VD DLGL N D R++ERTFQLLSQVTGRAGR GLKS GL+Q YQP HPVMQA
Sbjct: 560 PLMTLVGIVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSHGLLQTYQPQHPVMQA 619

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           +VSGDA +FYE EI  RE   LPPFGRLA++I+S     E E +A  L+  AP+ + I++
Sbjct: 620 IVSGDASAFYEREIVEREKAVLPPFGRLASIIVSADTRAEAETHARGLRAAAPQVTGIML 679

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL ++RGR+RFRLL+HG+RNS++Q F   +  N  K   ++ VQ DIDPQ+FL
Sbjct: 680 LGPAEAPLALIRGRHRFRLLVHGRRNSDMQSFLRTLLANGPKERGSVHVQLDIDPQSFL 738


>gi|159185300|ref|NP_355563.2| primosome assembly protein PriA [Agrobacterium tumefaciens str.
           C58]
 gi|159140558|gb|AAK88348.2| primosomal protein N' [Agrobacterium tumefaciens str. C58]
          Length = 738

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/719 (56%), Positives = 510/719 (70%), Gaps = 5/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+     GPY Y+VP  M VE GS+V+VPL  R V G+VW ++ EK  +D  KLRPI
Sbjct: 22  VPVLVPLPAPGPYSYAVPEDMVVETGSVVQVPLGPRQVFGVVWDDAGEK-GVDPKKLRPI 80

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTGIFPRI 133
              F+CPPL  +M  FV WVA YT SP GLVARM + A +  + E M E ++ T   P  
Sbjct: 81  TKSFECPPLKVEMRRFVDWVAAYTLSPPGLVARMALRAPAAFDPEPMIEGLRLTEGRPER 140

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR RV++   +G+ W K  L  A+ VS+ VIDGL  QGV + +F    PVV  P+  
Sbjct: 141 LTPARERVMELAAEGQGWTKSGLAHAAGVSTSVIDGLVKQGVFETVFLPAPPVVAEPDPD 200

Query: 194 FSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           +  P L+  Q+    +++    KG F VSLI GVTGSGKTEVY E VA  L  GKQVLIL
Sbjct: 201 YVEPRLEGPQKQAASEIIEDVRKGGFHVSLIDGVTGSGKTEVYFEAVAETLRQGKQVLIL 260

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           LPEI+LT+A LERFQ RFG KPAEWHS LS  MREK+WRQ   G I V+ G RSALFLPF
Sbjct: 261 LPEIALTAAFLERFQDRFGAKPAEWHSDLSPRMREKVWRQAVTGEIKVVAGARSALFLPF 320

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
             LGLI++DEEHD +YKQE+ + YNARDM++VR +I  FPVVLVSATPS+ES+VNG S R
Sbjct: 321 DNLGLIIVDEEHDPAYKQEDRVFYNARDMAVVRARIAEFPVVLVSATPSVESQVNGSSGR 380

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y+++HL TR+ ++A+P L ++DMR     +G  LSP ++ GI  T+ + EQ+LLFLNRRG
Sbjct: 381 YNTIHLHTRFGDAAMPDLHLVDMRRHPPERGGFLSPVLLRGIGKTIEKGEQSLLFLNRRG 440

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCGH+      C  CG+   ++ACG
Sbjct: 441 YAPLTLCRVCGHRFQCPQCSSWLVEHRFRNQLQCHQCGHNEPTPDHCPECGTFDHLVACG 500

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ERIAEEV ++FP AR  +LSSDL  G  RL+L+L AI KGE DI+IGTQLVAKGHNF
Sbjct: 501 PGVERIAEEVEKHFPEARTIVLSSDLM-GVKRLRLELEAIVKGEADIVIGTQLVAKGHNF 559

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P M+LVG+VD DLGL N D R++ERTFQLLSQVTGRAGR GLKS GL+Q YQP HPVMQA
Sbjct: 560 PLMTLVGIVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSHGLLQTYQPQHPVMQA 619

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           +VSGDA +FYE EI  RE   LPPFGRLA++I+S     E E +A  L+  AP+ + I++
Sbjct: 620 IVSGDASAFYEREIVEREKAVLPPFGRLASIIVSADTRAEAETHARGLRAAAPQVTGIML 679

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL ++RGR+RFRLL+HG+RNS++Q F   +  +  K   ++ VQ DIDPQ+FL
Sbjct: 680 LGPAEAPLALIRGRHRFRLLVHGRRNSDMQSFLRTLLASGPKERGSVHVQLDIDPQSFL 738


>gi|227823631|ref|YP_002827604.1| primosome assembly protein PriA [Sinorhizobium fredii NGR234]
 gi|227342633|gb|ACP26851.1| primosomal protein N' [Sinorhizobium fredii NGR234]
          Length = 734

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/719 (56%), Positives = 513/719 (71%), Gaps = 5/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y+VP  M VE GSIV+VPL  R V+G+VW + ++   +DS KL+ I
Sbjct: 18  VPVLVPMPAPRPYSYAVPEGMAVEPGSIVQVPLGPRLVVGVVW-DGDDDGMVDSKKLKEI 76

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTGIFPRI 133
           E VFDCPPL+R M  F+ WVA YT +P GLVARM + A +  + E M E ++ T   P  
Sbjct: 77  EKVFDCPPLTRDMRTFLDWVASYTITPPGLVARMALRAPTAFDPEPMVEALRLTERRPER 136

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR RVL    DG  W +  L  A+ VSS VIDGL AQGV + +F    PVV  P+  
Sbjct: 137 MTAARERVLATAGDGFSWTRSGLAHAAGVSSGVIDGLAAQGVFETVFMPPPPVVAVPDPD 196

Query: 194 FSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           F+ P L+  Q++    ++     G F+VSLI GVTGSGKTEVY E +AA L  GKQVLIL
Sbjct: 197 FAAPRLEGVQKEAAADLLAAVEDGKFSVSLIDGVTGSGKTEVYFEAIAATLRAGKQVLIL 256

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           LPEI+LT+  LERFQ RFG KPAEWHS L+   REK+WRQV  G + V+ G RSALFLPF
Sbjct: 257 LPEIALTAGFLERFQDRFGAKPAEWHSDLAPRTREKVWRQVTTGQVRVVAGARSALFLPF 316

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
           ++LGLI++DEEHD +YKQE+ + YNARDM++VRG+I +FPVVLVSATPS+ESRVNG   R
Sbjct: 317 EELGLIIVDEEHDPAYKQEDRVFYNARDMAVVRGRISAFPVVLVSATPSVESRVNGEVGR 376

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  +HL TR+ ++ALPHL V+DMR     +G  LSP +++ +   + R +Q LLFLNRRG
Sbjct: 377 YRPIHLPTRFGDAALPHLGVVDMRRHPPERGGFLSPVLLNQVGKAIGRGQQALLFLNRRG 436

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+VCG+R +C  CS WLVEHR + ++ CH CG+S    ++C  CG+   ++ACG
Sbjct: 437 YAPLTLCRVCGHRFQCPDCSSWLVEHRFRGQIQCHHCGYSERTPEACPECGTLDHLVACG 496

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ERIAEEV  +FP AR  +LSSDL  G  RL+L+L AIA+GE DI+IGTQLVAKGHNF
Sbjct: 497 PGVERIAEEVERHFPEARTIVLSSDLM-GVKRLRLELEAIARGEADIVIGTQLVAKGHNF 555

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P M+LVG+VD DLGL N D R++ERTFQLLSQVTGRAGR GLKSLGL+Q YQP HPVMQA
Sbjct: 556 PMMTLVGIVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSLGLLQTYQPQHPVMQA 615

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           +VSGD+D+FYE EI  RE   LPPFGRLA++I+S     + E +A  L+  APR   I V
Sbjct: 616 IVSGDSDAFYEREIHERERAVLPPFGRLASIIVSADTRSDAEGHARGLRNAAPRVDGISV 675

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL ++RGR+RFRLL+HG+RNS++Q F   M  +  K   ++ VQ D+DPQ+FL
Sbjct: 676 LGPAEAPLALIRGRHRFRLLVHGRRNSDMQSFLKAMISSGPKERGSVSVQLDVDPQSFL 734


>gi|195970129|ref|NP_387145.2| primosome assembly protein PriA [Sinorhizobium meliloti 1021]
 gi|307301620|ref|ZP_07581379.1| primosomal protein N' [Sinorhizobium meliloti BL225C]
 gi|187904220|emb|CAC47618.2| Probable primosomal protein N' (replication factor Y)
           [Sinorhizobium meliloti 1021]
 gi|306903318|gb|EFN33907.1| primosomal protein N' [Sinorhizobium meliloti BL225C]
          Length = 734

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/736 (55%), Positives = 518/736 (70%), Gaps = 7/736 (0%)

Query: 1   MASSGSSVEGVVCSRVIILLLQAVSGP--YIYSVPSAMKVELGSIVRVPLRSRTVLGIVW 58
           M    + + G V  R ++ +L  +  P  Y Y+VP  M VE GSIV+VPL  R V+G+VW
Sbjct: 1   MTLDSTDLFGPVLDRRVVPVLVPMPAPRAYSYAVPDGMAVEPGSIVQVPLGPRFVVGVVW 60

Query: 59  YNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--E 116
            + E+   +D  KL+ IE VFDCPPL   M  F+ WVA YT +P GLV RM + A +  +
Sbjct: 61  -DGEDDGGVDPKKLKQIEKVFDCPPLGPDMRAFLDWVAAYTLTPPGLVVRMALRAPTAFD 119

Query: 117 TEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVI 176
            E M E ++ T + P   T AR RVL    DG  W +  L  A+ VSS VIDGL +QGV 
Sbjct: 120 PEPMVEALRLTEMRPERMTAARERVLATASDGLSWTRSGLAHAAGVSSSVIDGLTSQGVF 179

Query: 177 KQIFEVISPVVDSPNLYFSLPILDKNQ-QDVVEQVVPLCTKGFAVSLISGVTGSGKTEVY 235
           + +F    PVV +P+  F+ P L+  Q Q   + +  +  + F+VSLI G+TGSGKTEVY
Sbjct: 180 ETVFMPPPPVVAAPDPAFAAPRLEGPQKQAAADLLAAVEERKFSVSLIDGITGSGKTEVY 239

Query: 236 LEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVAR 295
            E +AA L  GKQVLILLPEI+LT++ LERFQ RFG KPAEWHS L+  MREK+WRQV  
Sbjct: 240 FEAIAATLRAGKQVLILLPEIALTASFLERFQDRFGAKPAEWHSDLAPRMREKVWRQVTT 299

Query: 296 GAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVL 355
           G + V+ G RSALFLPF+ LGLI++DEEHD +YKQE+ + YNARDM++VRG+I +FPVVL
Sbjct: 300 GQVRVVAGARSALFLPFEDLGLIIVDEEHDPAYKQEDRVFYNARDMAVVRGRIGNFPVVL 359

Query: 356 VSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIR 415
           VSATPS+ESRVNG   RY  +HL TR+ ++ALP L ++DMR     +G  LSP +++ I 
Sbjct: 360 VSATPSVESRVNGEVGRYRPIHLPTRFGDAALPDLGIVDMRRHPPERGGFLSPVLVNQIG 419

Query: 416 HTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIY 475
            T+ R EQ LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEHR + ++ CH CG+S   
Sbjct: 420 KTIGRREQALLFLNRRGYAPLTLCRVCGHRFQCPDCSSWLVEHRFRGQIQCHHCGYSERT 479

Query: 476 SQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKG 535
            ++C  CG+   ++ACG G+ERIAEEV  +FP AR  +LSSDL  G  RL+L+L AIA+G
Sbjct: 480 PEACPECGTLDHLVACGPGVERIAEEVERHFPDARTIVLSSDLM-GVKRLRLELEAIARG 538

Query: 536 EIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLK 595
           E DI+IGTQLVAKGHNFP M+LVG+VD DLGL N D R++ERTFQLLSQVTGRAGR GLK
Sbjct: 539 EADIVIGTQLVAKGHNFPNMTLVGIVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLK 598

Query: 596 SLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVEN 655
           SLGL+Q YQP HPVMQA+VSGD+D+FYE EI  RE   LPPFGRLA+VI+S     + E 
Sbjct: 599 SLGLLQTYQPQHPVMQAIVSGDSDAFYEREIHERERAVLPPFGRLASVIVSADTRGDAEG 658

Query: 656 YAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKR 715
           +A  L+  APR   I + GPAE+PL ++RGR+RFRLL+HG+RNS++Q F   M     K 
Sbjct: 659 HARGLRNAAPRVDGIAILGPAEAPLALIRGRHRFRLLVHGRRNSDMQSFVRAMIAAGPKE 718

Query: 716 SNALRVQFDIDPQNFL 731
             ++ VQ DIDPQ+FL
Sbjct: 719 RGSVSVQLDIDPQSFL 734


>gi|239832883|ref|ZP_04681212.1| primosomal protein N' [Ochrobactrum intermedium LMG 3301]
 gi|239825150|gb|EEQ96718.1| primosomal protein N' [Ochrobactrum intermedium LMG 3301]
          Length = 740

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/719 (54%), Positives = 498/719 (69%), Gaps = 5/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP+ M V+ GSIVRVPL  R V GIV     E   +D+ KLR I
Sbjct: 24  VPVLVPMPAERPYSYMVPAGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDARKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTGIFPRI 133
             VFDCPP+   M  F++W ADYT SP G+VARMV  V A  + E     ++++G  P  
Sbjct: 82  SEVFDCPPVGADMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPSVPGLRYSGGEPER 141

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQGV +++      VV  P++ 
Sbjct: 142 MTDARSRVMELARDGLAWTRSGLAHAAGVSMTVVDGLKAQGVFEEVMLPPPAVVARPDID 201

Query: 194 FSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  +  G+QVLIL
Sbjct: 202 YARATLSEDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKAIEQGRQVLIL 261

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           LPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQ+A G + V+ G RSALFLPF
Sbjct: 262 LPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQIAEGTVRVVAGARSALFLPF 321

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
           K+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I  FPVVL SATPSIES+VN    R
Sbjct: 322 KELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHISGFPVVLASATPSIESQVNAEQGR 381

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFLNRRG
Sbjct: 382 YRRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFLNRRG 441

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   ++ACG
Sbjct: 442 YAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHLVACG 501

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAKGHNF
Sbjct: 502 PGVERIAEEVAATFDKARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAKGHNF 561

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGL+Q YQP HPVM+A
Sbjct: 562 PNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLLQTYQPDHPVMRA 621

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           +VSGDA++FY  EI  RE   LPP+GRLAA+IIS     + EN+A  L+  AP S ++ V
Sbjct: 622 IVSGDAEAFYAREIEERERSALPPYGRLAALIISADNRPDAENHARALRRAAPSSPEVSV 681

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL +VRGR+RFR+L+HG + +++QGF   +  N  K   ++RVQ DIDPQ+FL
Sbjct: 682 LGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLANGPKEKGSIRVQVDIDPQSFL 740


>gi|307316356|ref|ZP_07595800.1| primosomal protein N' [Sinorhizobium meliloti AK83]
 gi|306898196|gb|EFN28938.1| primosomal protein N' [Sinorhizobium meliloti AK83]
          Length = 734

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/725 (55%), Positives = 514/725 (70%), Gaps = 7/725 (0%)

Query: 12  VCSRVIILLLQAVSGP--YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDS 69
           V  R ++ +L  +  P  Y Y+VP  M VE GSIV+VPL  R V+G+VW + E+   +D 
Sbjct: 12  VLDRRVVPVLVPMPAPRAYSYAVPDGMAVEPGSIVQVPLGPRFVVGVVW-DGEDDGGVDP 70

Query: 70  LKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFT 127
            KL+ IE VFDCPPL   M  F+ WVA YT +P GLV RM + A +  + E M E ++ T
Sbjct: 71  KKLKQIEKVFDCPPLGPDMRAFLDWVAAYTLTPPGLVVRMALRAPTAFDPEPMVEALRLT 130

Query: 128 GIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVV 187
            + P   T AR RVL    DG  W +  L  A+ VSS VIDGL +QGV + +F    PVV
Sbjct: 131 EMRPERMTAARERVLATASDGLSWTRSGLAHAAGVSSSVIDGLTSQGVFETVFMPPPPVV 190

Query: 188 DSPNLYFSLPILDKNQ-QDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
            +P+  F+ P L+  Q Q   + +  +  + F+VSLI G+TGSGKTEVY E +AA L  G
Sbjct: 191 AAPDPAFAAPRLEGPQKQAAADLLAAVEERKFSVSLIDGITGSGKTEVYFEAIAATLRAG 250

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           KQVLILLPEI+LT++ LERFQ RFG KPAEWHS L+  MREK+WRQV  G + V+ G RS
Sbjct: 251 KQVLILLPEIALTASFLERFQDRFGAKPAEWHSDLAPRMREKVWRQVTTGQVRVVAGARS 310

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLPF+ LGLI++DEEHD +YKQE+ + YNARDM++VRG+I +FPVVLVSATPS+ESRV
Sbjct: 311 ALFLPFEDLGLIIVDEEHDPAYKQEDRVFYNARDMAVVRGRIGNFPVVLVSATPSVESRV 370

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           NG   RY  +HL TR+ ++ALP L ++DMR     +G  LSP +++ I  T+ R EQ LL
Sbjct: 371 NGEVGRYRPIHLPTRFGDAALPDLGIVDMRRHPPERGGFLSPVLVNQIGKTIGRREQALL 430

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRGYAPLTLC+VCG+R +C  CS WLVEHR + ++ CH CG+S    ++C  CG+  
Sbjct: 431 FLNRRGYAPLTLCRVCGHRFQCPDCSSWLVEHRFRGQIQCHHCGYSERTPEACPECGTLD 490

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
            ++ACG G+ERIAEEV  +FP AR  +LSSDL  G  RL+L+L AIA+GE DI+IGTQLV
Sbjct: 491 HLVACGPGVERIAEEVERHFPDARTIVLSSDLM-GVKRLRLELEAIARGEADIVIGTQLV 549

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGHNFP M+LVG+VD DLGL N D R++ERTFQLLSQVTGRAGR GLKSLGL+Q YQP 
Sbjct: 550 AKGHNFPNMTLVGIVDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSLGLLQTYQPQ 609

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR 666
           HPVMQA+VSGD+D+FYE EI  RE   LPPFGRLA+VI+S     + E +A  L+  APR
Sbjct: 610 HPVMQAIVSGDSDAFYEREIHERERAVLPPFGRLASVIVSADTRGDAEGHARGLRNAAPR 669

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
              I + GPAE+PL ++RGR+RFRLL+HG+RNS++Q F   M     K   ++ VQ DID
Sbjct: 670 VDGIAILGPAEAPLALIRGRHRFRLLVHGRRNSDMQSFVRAMIAAGPKERGSVSVQLDID 729

Query: 727 PQNFL 731
           PQ+FL
Sbjct: 730 PQSFL 734


>gi|306844784|ref|ZP_07477369.1| primosomal protein N'' [Brucella sp. BO1]
 gi|306274956|gb|EFM56726.1| primosomal protein N'' [Brucella sp. BO1]
          Length = 744

 Score =  803 bits (2075), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/723 (55%), Positives = 494/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +D  KLR I
Sbjct: 24  VPVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDPRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VFDCPP+  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFDCPPVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 321

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I  FPVVL SATPSIES+VN 
Sbjct: 322 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGGFPVVLASATPSIESQVNA 381

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP M + +  T+ R EQ LLFL
Sbjct: 382 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPAMTEAVGKTVERGEQALLFL 441

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 442 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 501

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 502 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAK 561

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 562 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 621

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 622 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCAPSSR 681

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 682 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQLDIDPQ 741

Query: 729 NFL 731
           +FL
Sbjct: 742 SFL 744


>gi|306839489|ref|ZP_07472297.1| primosomal protein N'' [Brucella sp. NF 2653]
 gi|306405434|gb|EFM61705.1| primosomal protein N'' [Brucella sp. NF 2653]
          Length = 733

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/723 (55%), Positives = 495/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +D  KLR I
Sbjct: 13  VPVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDPRKLREI 70

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CPP+  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 71  SEVFNCPPVGLEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 130

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 131 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 190

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 191 PDTDYARATLSQDQQAAAEMLSDAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 250

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 251 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 310

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 311 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 370

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFL
Sbjct: 371 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFL 430

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 431 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 490

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 491 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAK 550

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 551 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 610

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 611 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCAPSSR 670

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 671 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVDIDPQ 730

Query: 729 NFL 731
           +FL
Sbjct: 731 SFL 733


>gi|153008434|ref|YP_001369649.1| primosome assembly protein PriA [Ochrobactrum anthropi ATCC 49188]
 gi|151560322|gb|ABS13820.1| primosomal protein N' [Ochrobactrum anthropi ATCC 49188]
          Length = 740

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/719 (54%), Positives = 494/719 (68%), Gaps = 5/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +D+ KLR I
Sbjct: 24  VPVLVPMPAERPYSYMVPEGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDARKLRAI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTGIFPRI 133
             VFDCPP+   M  F++W ADYT SP G+VARMV  V A  + E     ++++G  P  
Sbjct: 82  SEVFDCPPVGADMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPSVPGLRYSGGEPER 141

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR RV++  +DG  W +  L  A+ VS  V+DGLK QG+ +++      VV  P++ 
Sbjct: 142 MTEARSRVMELARDGLAWTRSGLAHAAGVSMTVVDGLKTQGIFEEVMLPPPAVVAKPDID 201

Query: 194 FSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           ++   L ++QQ   E +        F+VSL+ GVTGSGKTEVY E VA  +  GKQVLIL
Sbjct: 202 YARATLSEDQQAAAEMLSEAVEADCFSVSLLDGVTGSGKTEVYFEAVAKAIEQGKQVLIL 261

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           LPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQ+A G + V+ G RSALFLPF
Sbjct: 262 LPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQIAEGTVRVVAGARSALFLPF 321

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
           K+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I  FPVVL SATPSIES+VN    R
Sbjct: 322 KELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHISGFPVVLASATPSIESQVNAEQGR 381

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFLNRRG
Sbjct: 382 YKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGRTVERGEQALLFLNRRG 441

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     ++C  CG+   ++ACG
Sbjct: 442 YAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPEACPECGTLDHLVACG 501

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAKGHNF
Sbjct: 502 PGVERIAEEVAATFSEARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAKGHNF 561

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HPVM+A
Sbjct: 562 PNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHPVMRA 621

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           +VS DAD+FY  EI  RE   LPPFGRLAA+IIS     + EN+A  L+  AP S +I V
Sbjct: 622 IVSSDADAFYAREIEERERSTLPPFGRLAALIISADNRPDAENHARALRRAAPSSPEISV 681

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL +VRGR+RFR+L+HG + +++QGF   +  N  K   ++RVQ DIDPQ+FL
Sbjct: 682 LGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRVLLANGPKEKGSIRVQVDIDPQSFL 740


>gi|254719792|ref|ZP_05181603.1| primosome assembly protein PriA [Brucella sp. 83/13]
 gi|265984811|ref|ZP_06097546.1| primosome assembly protein PriA [Brucella sp. 83/13]
 gi|264663403|gb|EEZ33664.1| primosome assembly protein PriA [Brucella sp. 83/13]
          Length = 744

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/723 (55%), Positives = 495/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +D  KLR I
Sbjct: 24  VPVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDPRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CPP+  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFNCPPVGLEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSDAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 321

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 322 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 381

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFL
Sbjct: 382 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFL 441

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 442 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 501

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 502 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAK 561

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 562 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 621

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 622 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCAPSSR 681

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 682 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVDIDPQ 741

Query: 729 NFL 731
           +FL
Sbjct: 742 SFL 744


>gi|254689957|ref|ZP_05153211.1| primosome assembly protein PriA [Brucella abortus bv. 6 str. 870]
 gi|256258212|ref|ZP_05463748.1| primosome assembly protein PriA [Brucella abortus bv. 9 str. C68]
 gi|260755492|ref|ZP_05867840.1| primosome assembly protein PriA [Brucella abortus bv. 6 str. 870]
 gi|260884513|ref|ZP_05896127.1| primosome assembly protein PriA [Brucella abortus bv. 9 str. C68]
 gi|297249061|ref|ZP_06932769.1| primosomal protein [Brucella abortus bv. 5 str. B3196]
 gi|260675600|gb|EEX62421.1| primosome assembly protein PriA [Brucella abortus bv. 6 str. 870]
 gi|260874041|gb|EEX81110.1| primosome assembly protein PriA [Brucella abortus bv. 9 str. C68]
 gi|297174194|gb|EFH33551.1| primosomal protein [Brucella abortus bv. 5 str. B3196]
          Length = 744

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/723 (55%), Positives = 496/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +DS KLR I
Sbjct: 24  VSVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDSRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CP +  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFNCPLVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 321

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 322 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 381

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFL
Sbjct: 382 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFL 441

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 442 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 501

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 502 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAK 561

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 562 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 621

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+ +AP S 
Sbjct: 622 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRYAPSSR 681

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 682 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVDIDPQ 741

Query: 729 NFL 731
           +FL
Sbjct: 742 SFL 744


>gi|189024881|ref|YP_001935649.1| primosome assembly protein PriA [Brucella abortus S19]
 gi|189020453|gb|ACD73175.1| DEAD/DEAH box helicase [Brucella abortus S19]
          Length = 733

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/723 (55%), Positives = 495/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +DS KLR I
Sbjct: 13  VSVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDSRKLREI 70

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CP +  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 71  SEVFNCPLVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 130

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 131 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 190

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 191 PDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 250

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 251 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 310

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 311 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 370

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFL
Sbjct: 371 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFL 430

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 431 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 490

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 491 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAK 550

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 551 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 610

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 611 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCAPSSR 670

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 671 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVDIDPQ 730

Query: 729 NFL 731
           +FL
Sbjct: 731 SFL 733


>gi|254694449|ref|ZP_05156277.1| primosome assembly protein PriA [Brucella abortus bv. 3 str. Tulya]
 gi|261214763|ref|ZP_05929044.1| primosome assembly protein PriA [Brucella abortus bv. 3 str. Tulya]
 gi|260916370|gb|EEX83231.1| primosome assembly protein PriA [Brucella abortus bv. 3 str. Tulya]
          Length = 744

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/723 (55%), Positives = 495/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +DS KLR I
Sbjct: 24  VSVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDSRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CP +  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFNCPLVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSEAAEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 321

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 322 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 381

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFL
Sbjct: 382 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFL 441

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 442 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 501

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 502 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAK 561

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 562 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 621

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 622 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCAPSSR 681

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 682 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVDIDPQ 741

Query: 729 NFL 731
           +FL
Sbjct: 742 SFL 744


>gi|23502657|ref|NP_698784.1| primosome assembly protein PriA [Brucella suis 1330]
 gi|23348665|gb|AAN30699.1| primosomal protein N [Brucella suis 1330]
          Length = 744

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/723 (55%), Positives = 495/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +DS KLR I
Sbjct: 24  VPVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDSRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CP +  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFNCPLVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 321

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 322 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 381

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFL
Sbjct: 382 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFL 441

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 442 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 501

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 502 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGETDIVIGTQLVAK 561

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 562 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 621

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 622 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCAPSSR 681

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 682 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVDIDPQ 741

Query: 729 NFL 731
           +FL
Sbjct: 742 SFL 744


>gi|148559034|ref|YP_001259643.1| primosome assembly protein PriA [Brucella ovis ATCC 25840]
 gi|163845381|ref|YP_001623036.1| primosome assembly protein PriA [Brucella suis ATCC 23445]
 gi|254708343|ref|ZP_05170171.1| primosome assembly protein PriA [Brucella pinnipedialis M163/99/10]
 gi|254708804|ref|ZP_05170615.1| primosome assembly protein PriA [Brucella pinnipedialis B2/94]
 gi|254714646|ref|ZP_05176457.1| primosome assembly protein PriA [Brucella ceti M644/93/1]
 gi|254717544|ref|ZP_05179355.1| primosome assembly protein PriA [Brucella ceti M13/05/1]
 gi|256030330|ref|ZP_05443944.1| primosome assembly protein PriA [Brucella pinnipedialis M292/94/1]
 gi|256061828|ref|ZP_05451963.1| primosome assembly protein PriA [Brucella neotomae 5K33]
 gi|256160501|ref|ZP_05458190.1| primosome assembly protein PriA [Brucella ceti M490/95/1]
 gi|256255707|ref|ZP_05461243.1| primosome assembly protein PriA [Brucella ceti B1/94]
 gi|260168004|ref|ZP_05754815.1| primosome assembly protein PriA [Brucella sp. F5/99]
 gi|261219378|ref|ZP_05933659.1| primosome assembly protein PriA [Brucella ceti M13/05/1]
 gi|261222918|ref|ZP_05937199.1| primosome assembly protein PriA [Brucella ceti B1/94]
 gi|261315843|ref|ZP_05955040.1| primosome assembly protein PriA [Brucella pinnipedialis M163/99/10]
 gi|261316297|ref|ZP_05955494.1| primosome assembly protein PriA [Brucella pinnipedialis B2/94]
 gi|261322440|ref|ZP_05961637.1| primosome assembly protein PriA [Brucella ceti M644/93/1]
 gi|261325832|ref|ZP_05965029.1| primosome assembly protein PriA [Brucella neotomae 5K33]
 gi|261757449|ref|ZP_06001158.1| DEAD/DEAH box helicase [Brucella sp. F5/99]
 gi|265987364|ref|ZP_06099921.1| primosome assembly protein PriA [Brucella pinnipedialis M292/94/1]
 gi|265998877|ref|ZP_06111434.1| primosome assembly protein PriA [Brucella ceti M490/95/1]
 gi|148370291|gb|ABQ60270.1| primosomal protein N' [Brucella ovis ATCC 25840]
 gi|163676104|gb|ABY40214.1| primosomal protein N' [Brucella suis ATCC 23445]
 gi|260921502|gb|EEX88155.1| primosome assembly protein PriA [Brucella ceti B1/94]
 gi|260924467|gb|EEX91035.1| primosome assembly protein PriA [Brucella ceti M13/05/1]
 gi|261295130|gb|EEX98626.1| primosome assembly protein PriA [Brucella ceti M644/93/1]
 gi|261295520|gb|EEX99016.1| primosome assembly protein PriA [Brucella pinnipedialis B2/94]
 gi|261301812|gb|EEY05309.1| primosome assembly protein PriA [Brucella neotomae 5K33]
 gi|261304869|gb|EEY08366.1| primosome assembly protein PriA [Brucella pinnipedialis M163/99/10]
 gi|261737433|gb|EEY25429.1| DEAD/DEAH box helicase [Brucella sp. F5/99]
 gi|262553566|gb|EEZ09335.1| primosome assembly protein PriA [Brucella ceti M490/95/1]
 gi|264659561|gb|EEZ29822.1| primosome assembly protein PriA [Brucella pinnipedialis M292/94/1]
          Length = 744

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/723 (55%), Positives = 495/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +DS KLR I
Sbjct: 24  VPVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDSRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CP +  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFNCPLVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 321

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 322 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 381

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFL
Sbjct: 382 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFL 441

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 442 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 501

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 502 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAK 561

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 562 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 621

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 622 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCAPSSR 681

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 682 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVDIDPQ 741

Query: 729 NFL 731
           +FL
Sbjct: 742 SFL 744


>gi|82700584|ref|YP_415158.1| primosome assembly protein PriA [Brucella melitensis biovar Abortus
           2308]
 gi|237816171|ref|ZP_04595166.1| primosomal protein N' [Brucella abortus str. 2308 A]
 gi|254698108|ref|ZP_05159936.1| primosome assembly protein PriA [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254730992|ref|ZP_05189570.1| primosome assembly protein PriA [Brucella abortus bv. 4 str. 292]
 gi|260547095|ref|ZP_05822833.1| DEAD/DEAH box helicase [Brucella abortus NCTC 8038]
 gi|260758715|ref|ZP_05871063.1| primosome assembly protein PriA [Brucella abortus bv. 4 str. 292]
 gi|260762549|ref|ZP_05874886.1| primosome assembly protein PriA [Brucella abortus bv. 2 str.
           86/8/59]
 gi|82616685|emb|CAJ11768.1| DEAD/DEAH box helicase:Helicase, C-terminal:ATP/GTP-binding site
           motif A (P-loop):Primosomal protein n [Brucella
           melitensis biovar Abortus 2308]
 gi|237788633|gb|EEP62846.1| primosomal protein N' [Brucella abortus str. 2308 A]
 gi|260095460|gb|EEW79338.1| DEAD/DEAH box helicase [Brucella abortus NCTC 8038]
 gi|260669033|gb|EEX55973.1| primosome assembly protein PriA [Brucella abortus bv. 4 str. 292]
 gi|260672975|gb|EEX59796.1| primosome assembly protein PriA [Brucella abortus bv. 2 str.
           86/8/59]
          Length = 744

 Score =  798 bits (2060), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/723 (55%), Positives = 495/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +DS KLR I
Sbjct: 24  VSVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDSRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CP +  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFNCPLVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 321

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 322 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 381

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFL
Sbjct: 382 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFL 441

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 442 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 501

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 502 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAK 561

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 562 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 621

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 622 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCAPSSR 681

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 682 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVDIDPQ 741

Query: 729 NFL 731
           +FL
Sbjct: 742 SFL 744


>gi|254700448|ref|ZP_05162276.1| primosome assembly protein PriA [Brucella suis bv. 5 str. 513]
 gi|261750949|ref|ZP_05994658.1| primosome assembly protein PriA [Brucella suis bv. 5 str. 513]
 gi|261740702|gb|EEY28628.1| primosome assembly protein PriA [Brucella suis bv. 5 str. 513]
          Length = 744

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/723 (55%), Positives = 495/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +DS KLR I
Sbjct: 24  VPVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDSRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CP +  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFNCPLVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DG+KAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGVKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 321

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 322 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 381

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFL
Sbjct: 382 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFL 441

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 442 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 501

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 502 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAK 561

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 562 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 621

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 622 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCAPSSR 681

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 682 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVDIDPQ 741

Query: 729 NFL 731
           +FL
Sbjct: 742 SFL 744


>gi|256370208|ref|YP_003107719.1| primosome assembly protein PriA [Brucella microti CCM 4915]
 gi|256000371|gb|ACU48770.1| primosome assembly protein PriA [Brucella microti CCM 4915]
          Length = 744

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/723 (55%), Positives = 494/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +DS KLR I
Sbjct: 24  VPVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDSRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CP +  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFNCPLVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 321

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FL FK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 322 FLSFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 381

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFL
Sbjct: 382 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFL 441

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 442 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 501

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 502 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAK 561

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 562 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 621

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 622 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCAPSSR 681

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 682 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVDIDPQ 741

Query: 729 NFL 731
           +FL
Sbjct: 742 SFL 744


>gi|225853248|ref|YP_002733481.1| primosome assembly protein PriA [Brucella melitensis ATCC 23457]
 gi|256045400|ref|ZP_05448294.1| primosome assembly protein PriA [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256114368|ref|ZP_05455101.1| primosome assembly protein PriA [Brucella melitensis bv. 3 str.
           Ether]
 gi|256263264|ref|ZP_05465796.1| DEAD/DEAH box helicase [Brucella melitensis bv. 2 str. 63/9]
 gi|260565708|ref|ZP_05836191.1| DEAD/DEAH box helicase [Brucella melitensis bv. 1 str. 16M]
 gi|265991829|ref|ZP_06104386.1| primosome assembly protein PriA [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995668|ref|ZP_06108225.1| primosome assembly protein PriA [Brucella melitensis bv. 3 str.
           Ether]
 gi|225641613|gb|ACO01527.1| primosomal protein N' [Brucella melitensis ATCC 23457]
 gi|260151081|gb|EEW86176.1| DEAD/DEAH box helicase [Brucella melitensis bv. 1 str. 16M]
 gi|262766952|gb|EEZ12570.1| primosome assembly protein PriA [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002785|gb|EEZ15188.1| primosome assembly protein PriA [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093228|gb|EEZ17325.1| DEAD/DEAH box helicase [Brucella melitensis bv. 2 str. 63/9]
 gi|326409807|gb|ADZ66872.1| primosome assembly protein PriA [Brucella melitensis M28]
 gi|326539525|gb|ADZ87740.1| primosomal protein N' [Brucella melitensis M5-90]
          Length = 744

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/723 (55%), Positives = 494/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +DS KLR I
Sbjct: 24  VSVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDSRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CP +  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFNCPLVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 321

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 322 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 381

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFL
Sbjct: 382 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFL 441

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 442 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 501

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 502 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAK 561

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 562 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 621

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NL PFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 622 VMRAIVSGDADAFYAREIEERERSNLSPFGRLAALIISADNRPDAENHARALRRCAPSSR 681

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 682 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVDIDPQ 741

Query: 729 NFL 731
           +FL
Sbjct: 742 SFL 744


>gi|161619724|ref|YP_001593611.1| primosome assembly protein PriA [Brucella canis ATCC 23365]
 gi|254703570|ref|ZP_05165398.1| primosome assembly protein PriA [Brucella suis bv. 3 str. 686]
 gi|260568875|ref|ZP_05839343.1| DEAD/DEAH box helicase [Brucella suis bv. 4 str. 40]
 gi|261754203|ref|ZP_05997912.1| primosome assembly protein PriA [Brucella suis bv. 3 str. 686]
 gi|161336535|gb|ABX62840.1| primosomal protein N' [Brucella canis ATCC 23365]
 gi|260154259|gb|EEW89341.1| DEAD/DEAH box helicase [Brucella suis bv. 4 str. 40]
 gi|261743956|gb|EEY31882.1| primosome assembly protein PriA [Brucella suis bv. 3 str. 686]
          Length = 744

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/723 (55%), Positives = 494/723 (68%), Gaps = 9/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +DS KLR I
Sbjct: 24  VPVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDSRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CP +  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFNCPLVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 321

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 322 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 381

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LS  + + +  T+ R EQ LLFL
Sbjct: 382 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSLALTEAVGKTVERGEQALLFL 441

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 442 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 501

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 502 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGETDIVIGTQLVAK 561

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 562 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 621

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 622 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCAPSSR 681

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ DIDPQ
Sbjct: 682 EISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVDIDPQ 741

Query: 729 NFL 731
           +FL
Sbjct: 742 SFL 744


>gi|62290669|ref|YP_222462.1| primosome assembly protein PriA [Brucella abortus bv. 1 str. 9-941]
 gi|62196801|gb|AAX75101.1| primosomal protein N [Brucella abortus bv. 1 str. 9-941]
          Length = 748

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/727 (54%), Positives = 495/727 (68%), Gaps = 13/727 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +DS KLR I
Sbjct: 24  VSVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDSRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CP +  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFNCPLVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRF----GVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
           VLILLPEI+LT   L+RF  RF    G KPAEWHS L+   RE++WRQVA G + V+ G 
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGA 321

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALFLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES
Sbjct: 322 RSALFLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIES 381

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
           +VN    RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ 
Sbjct: 382 QVNAEQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQA 441

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+
Sbjct: 442 LLFLNRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGT 501

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
              ++ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQ
Sbjct: 502 LDHLVACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQ 561

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           LVAKGHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQ
Sbjct: 562 LVAKGHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQ 621

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P HPVM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  A
Sbjct: 622 PDHPVMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCA 681

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFD 724
           P S +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K   ++RVQ D
Sbjct: 682 PSSREISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPKEKGSIRVQVD 741

Query: 725 IDPQNFL 731
           IDPQ+FL
Sbjct: 742 IDPQSFL 748


>gi|110635542|ref|YP_675750.1| primosome assembly protein PriA [Mesorhizobium sp. BNC1]
 gi|110286526|gb|ABG64585.1| replication restart DNA helicase PriA [Chelativorans sp. BNC1]
          Length = 726

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/721 (55%), Positives = 509/721 (70%), Gaps = 7/721 (0%)

Query: 15  RVI-ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR 73
           RVI +++    + PY Y+VP  M+VE GSI+RVPL  R V G+ W    E   ++S KLR
Sbjct: 9   RVIPVMVPMPANRPYSYAVPDGMRVEPGSILRVPLGPREVAGVAWDGDGEP--VESRKLR 66

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTGIFP 131
            I  VF+CPPL  QM  F++WVA YT SP GLVARM + A +  + E + E ++ T I P
Sbjct: 67  EIAQVFECPPLQAQMRRFIEWVAAYTLSPPGLVARMALRAPAAFDPEPLVEGLRLTAIRP 126

Query: 132 RINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPN 191
              T AR RVL    DG+ W +  L  A+ VSS V+DGL AQGV +++     P+V  P+
Sbjct: 127 DRMTAARERVLHYAADGQAWTRSGLAHAAGVSSTVVDGLLAQGVFERVELPPQPLVPLPD 186

Query: 192 LYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
             FS P    +Q+   E++        F+V+L+ GVTGSGKTEVY E VAA L  GKQVL
Sbjct: 187 TEFSRPEFMPDQKLAAERLREKAGANAFSVTLLDGVTGSGKTEVYFEAVAAALDRGKQVL 246

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           ILLPEI+LT A L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSALFL
Sbjct: 247 ILLPEIALTQAFLDRFHDRFGAKPAEWHSDLAPRKRERVWRQVAEGQVRVVAGARSALFL 306

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PF+ LGLIV+DEEHD +YKQE+ + YNARDMS+VRG++ +FPVVL SATPS+ESRVN   
Sbjct: 307 PFRDLGLIVVDEEHDPAYKQEDRVFYNARDMSVVRGRLGNFPVVLASATPSLESRVNADQ 366

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            RY  + LS R+ ++A+P L+ IDMR     +G  LSP +I+ I  T+ R EQ LLFLNR
Sbjct: 367 GRYERIVLSARFADAAMPELRAIDMRRSPPERGGFLSPVLIEAIGRTIERREQALLFLNR 426

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPLTLC+VCG+R +C +CS WLVEHR +++L CH CGH+    ++C  CG+   ++ 
Sbjct: 427 RGYAPLTLCRVCGHRFQCPNCSSWLVEHRFRRQLLCHHCGHNEPSPEACPECGTLDHLVP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
           CG G+ERIAEEV  +FP AR  +LSSDL  G  RL+L+L AIA GE DI++GTQLVAKGH
Sbjct: 487 CGPGVERIAEEVDRHFPEARTIVLSSDLM-GVKRLRLELEAIAAGEADIVVGTQLVAKGH 545

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           NFP M+LVGVVD DLGL N D R++ERTFQLLSQVTGRAGR G KS GL+Q YQP HPVM
Sbjct: 546 NFPSMTLVGVVDADLGLANGDPRAAERTFQLLSQVTGRAGRSGKKSTGLLQTYQPEHPVM 605

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
           +AL+SGDA++FYE EI  RE   LPPFGRLA++I+S    QE E YA  L+  AP +++I
Sbjct: 606 RALISGDAETFYEREIAERERAGLPPFGRLASIIVSAATRQEAEGYARALRRAAPAATEI 665

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            +FGPAE+PL +V GR+RFRLL+ G R +++Q +F ++ +   K   ++RVQ DIDPQ+F
Sbjct: 666 DIFGPAEAPLALVAGRHRFRLLVQGTRRADIQTYFKRLLERAEKPRGSVRVQVDIDPQSF 725

Query: 731 L 731
           L
Sbjct: 726 L 726


>gi|222150030|ref|YP_002550987.1| primosome assembly protein PriA [Agrobacterium vitis S4]
 gi|221737012|gb|ACM37975.1| primosomal protein N' [Agrobacterium vitis S4]
          Length = 739

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/719 (53%), Positives = 503/719 (69%), Gaps = 4/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+     GPY Y+VP  M +  G+IV+VPL  R V+G+VW    +  K+D  KLR I
Sbjct: 22  VPVLVPLPAPGPYSYAVPDEMMLTPGAIVQVPLGPRKVVGVVWDGEGDGAKVDPAKLRSI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTGIFPRI 133
           E +FDCPPL   M  F+ WVA YT SP GLVARM + A +  + + M E ++++G  P  
Sbjct: 82  EKLFDCPPLDVGMRRFIDWVAAYTLSPPGLVARMALRAPAAFDPDPMIEGLRYSGHAPEK 141

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR +VL+  +DG  W K  L  A+ VS+ V+DG+   G+ + +F    P+V  P+  
Sbjct: 142 LTPARRKVLELAEDGLSWTKSGLAHAAGVSTSVVDGMAKLGLFETVFLPPPPLVALPDPD 201

Query: 194 FSLPILDKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           ++   L   Q    E +V  +   GF+V+LI GVTGSGKTEVY E +A  L  G+QVLIL
Sbjct: 202 YAAHRLSGPQLGAAEVLVESVRDGGFSVALIDGVTGSGKTEVYFEAIAETLRQGRQVLIL 261

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           LPEI+LT+A LERFQ RFG KP EWHS L+T  REK+WRQ A G I V+ G RSALFLPF
Sbjct: 262 LPEIALTTAFLERFQDRFGAKPGEWHSDLATRTREKVWRQTATGDIRVVAGARSALFLPF 321

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
             LGLI++DEEHD ++KQE+ + YNARDM++VR +I S P VLVSATPS+ES+VN  S R
Sbjct: 322 ADLGLIIVDEEHDPAFKQEDRVFYNARDMAVVRARIASIPAVLVSATPSVESQVNSYSGR 381

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  +HL TR+ ++A+P L ++DMR     +G  LSP M+  I  T+ + +Q LLFLNRRG
Sbjct: 382 YKRIHLPTRFADAAMPDLHLVDMRRHPPERGGFLSPLMLRAIGKTVEKQQQALLFLNRRG 441

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+VCG+R +C  CS WLVEHR + ++ CHQCG++     +C  CG+   ++ACG
Sbjct: 442 YAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQIQCHQCGYAEPTPNACPECGTLDHLVACG 501

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ERIAEEV  +FP AR  +LSSDL GG  RL+L+L AIAKGE DI+IGTQLVAKGHNF
Sbjct: 502 PGVERIAEEVERHFPDARTLVLSSDL-GGVKRLRLELEAIAKGEADIVIGTQLVAKGHNF 560

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P M+LVG+VD D+GL N D R++ERTFQLLSQVTGRAGR GLKS GL+Q YQP HPVMQA
Sbjct: 561 PLMTLVGIVDADIGLANGDPRAAERTFQLLSQVTGRAGRTGLKSHGLLQTYQPQHPVMQA 620

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           +VSGDAD+FYE EI  RE   LPP+GRL ++I+S     + E +A  L++ AP    I +
Sbjct: 621 IVSGDADAFYEREITERERAVLPPYGRLVSIIVSADNRADAETHARQLRQAAPAVGGIAI 680

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL ++RGR+RFRLLIHG++ S++Q F + M  N  K   +++VQ D+DPQ+FL
Sbjct: 681 LGPAEAPLALIRGRHRFRLLIHGRKASDMQAFVAAMLGNGPKERRSIQVQVDVDPQSFL 739


>gi|163761396|ref|ZP_02168470.1| primosome assembly protein PriA [Hoeflea phototrophica DFL-43]
 gi|162281391|gb|EDQ31688.1| primosome assembly protein PriA [Hoeflea phototrophica DFL-43]
          Length = 734

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/738 (52%), Positives = 492/738 (66%), Gaps = 11/738 (1%)

Query: 1   MASSGSSVEGVVCSR--VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW 58
           MA     +E  +  R  V +LL       Y Y++P       G IV+VPL  R V G+VW
Sbjct: 1   MAKDSRQIESGLFPRKVVPVLLPMPAERAYSYALPDGADAVPGQIVQVPLGPRLVAGVVW 60

Query: 59  YNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--E 116
               +    D  KLR I  VFDCPPL+  M  F+ WVA YT S  GLVARM + A +  +
Sbjct: 61  DGEADVVNPD--KLREITQVFDCPPLNAPMRRFIDWVASYTLSSPGLVARMALRAPAAFD 118

Query: 117 TEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVI 176
            E + E +Q T   P   T AR RVL +  DG  W K  L  A+ VS+ VIDGL+ QGV 
Sbjct: 119 PEPLIEALQLTDQQPERITAARERVLAQAADGLAWTKSGLAHAAGVSASVIDGLREQGVF 178

Query: 177 KQIFEVISPVVDSPNLYFSLPILDKNQ---QDVVEQVVPLCTKGFAVSLISGVTGSGKTE 233
             +     PVV +P+  +    L+ +Q     V+ + V     GF V+L+ GVTGSGKTE
Sbjct: 179 APVMLPPQPVVPAPDPDYDPAELEADQLAAAQVLRETV--AAGGFGVTLLDGVTGSGKTE 236

Query: 234 VYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQV 293
           VY E +A  +  GKQVLILLPEI+LT+A L+RF  RFG +PAEWHS L+   REK+WRQV
Sbjct: 237 VYFEAIAETIRQGKQVLILLPEIALTNAFLDRFHNRFGARPAEWHSELAPRTREKVWRQV 296

Query: 294 ARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPV 353
               +SV+ G RSALFLPF  LGLI++DEEHD +YKQE+ + YNARDM++VR ++   PV
Sbjct: 297 TESRVSVVAGARSALFLPFADLGLIIVDEEHDPAYKQEDRVFYNARDMAVVRARLSDIPV 356

Query: 354 VLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDG 413
           VL SATPSIESRVN    RY  + LS RY ++ LP ++++D+R    A+G  LSP +I  
Sbjct: 357 VLASATPSIESRVNAAQGRYSHLVLSGRYADAGLPDIELVDLRRHAPARGGFLSPVLIKA 416

Query: 414 IRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSA 473
           +  TL R EQ+LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CH CGH+ 
Sbjct: 417 MAGTLERGEQSLLFLNRRGYAPLTLCRVCGHRFECPQCSSWLVEHRFRSQLQCHHCGHNE 476

Query: 474 IYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIA 533
              Q+C  CG+   ++ACG GIERIAEE  ++FP AR  +LSSD+ GG  RL+++L AIA
Sbjct: 477 PTPQACPSCGALDHLVACGPGIERIAEEADKHFPDARTIVLSSDMAGGTRRLRIELEAIA 536

Query: 534 KGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFG 593
           KGE DI+IGTQLVAKGHNFP M+LVGVVD DLGL+N D R++ERT+QLLSQVTGRAGR G
Sbjct: 537 KGEADIVIGTQLVAKGHNFPLMTLVGVVDADLGLSNGDPRAAERTYQLLSQVTGRAGRSG 596

Query: 594 LKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEV 653
            KS GLIQ +QP HPVMQA  SGD  +FYE E   R    LPPFGRLA+VIIS     E 
Sbjct: 597 RKSHGLIQTFQPHHPVMQAFASGDPHAFYERETDERRMAVLPPFGRLASVIISAATRPEA 656

Query: 654 ENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTI 713
           E +A  L+  AP S+ I+V GPAE+PL ++RGR+RFRLL+HG R +++QGF   M     
Sbjct: 657 EAHARGLRAAAPSSAGIMVLGPAEAPLALIRGRHRFRLLVHGARGNDMQGFVKDMLAKGP 716

Query: 714 KRSNALRVQFDIDPQNFL 731
           K+  +++VQ DIDPQ+FL
Sbjct: 717 KQRGSVQVQVDIDPQSFL 734


>gi|306841517|ref|ZP_07474216.1| primosomal protein N'' [Brucella sp. BO2]
 gi|306288428|gb|EFM59785.1| primosomal protein N'' [Brucella sp. BO2]
          Length = 691

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/693 (55%), Positives = 478/693 (68%), Gaps = 9/693 (1%)

Query: 46  VPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGL 105
           +PL  R V GIV     E   +DS KLR I  VFDCPP+  +M  F++W ADYT SP G+
Sbjct: 1   MPLGPREVAGIVCEG--ETDAVDSRKLREISEVFDCPPVGPEMLRFMRWAADYTLSPPGM 58

Query: 106 VARMV--VSALSETEKMEEKIQFTGI----FPRINTVARLRVLDKIKDGKIWEKRDLIRA 159
           VARMV  V A  + E     +++        P   T AR RV++  +DG  W +  L  A
Sbjct: 59  VARMVLRVPAAFDPEPAVPGLRYRAAEPERMPERMTAARARVMELARDGLAWTRSGLAHA 118

Query: 160 SQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLC-TKGF 218
           + VS  V+DGLKAQG+ ++I      VV  P+  ++   L ++QQ   E +       GF
Sbjct: 119 AGVSLTVVDGLKAQGIFEEIMLPPPAVVAKPDTDYARATLSQDQQAAAEMLSEAVEAGGF 178

Query: 219 AVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWH 278
           +VSL+ GVTGSGKTEVY E VA  L  G+QVLILLPEI+LT   L+RF  RFG KPAEWH
Sbjct: 179 SVSLLDGVTGSGKTEVYFEAVAKALDAGRQVLILLPEIALTQQFLDRFHDRFGAKPAEWH 238

Query: 279 SSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNA 338
           S L+   RE++WRQVA G + V+ G RSALFLPFK+LGLIV+DEEHD +YKQE+ + YNA
Sbjct: 239 SDLAPRTRERVWRQVAEGTVRVVAGARSALFLPFKELGLIVVDEEHDPAYKQEDRVFYNA 298

Query: 339 RDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQ 398
           RDM++VRG I  FPVVL SATPS+ES+VN    RY  + L  RY  +ALP L+ IDMR  
Sbjct: 299 RDMAVVRGHIGGFPVVLASATPSVESQVNAEQGRYKRIKLYGRYAEAALPDLKTIDMRRS 358

Query: 399 TIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEH 458
               G+ LSP + + +  T+ R EQ LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEH
Sbjct: 359 PPPPGRFLSPALTEAVGKTVERGEQALLFLNRRGYAPLTLCRVCGHRFQCPQCSSWLVEH 418

Query: 459 RSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDL 518
           R + +L CHQCG+     Q+C  CG+   ++ACG G+ERIAEEV   F  ARI +LSSD+
Sbjct: 419 RFRGQLMCHQCGYHEPVPQACPECGTLDHLVACGPGVERIAEEVAATFNDARIIVLSSDM 478

Query: 519 EGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERT 578
            GG  RL+L+L AIAKGE DI+IGTQLVAKGHNFP M+LVGVVD DLGL N D R++ERT
Sbjct: 479 AGGVKRLRLELDAIAKGEADIVIGTQLVAKGHNFPNMTLVGVVDADLGLANGDPRAAERT 538

Query: 579 FQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFG 638
           FQLL+QVTGRAGR G KSLGLIQ YQP HPVM+A+VSGDAD+FY  EI  RE  NLPPFG
Sbjct: 539 FQLLNQVTGRAGRTGRKSLGLIQTYQPDHPVMRAIVSGDADAFYAREIEERERSNLPPFG 598

Query: 639 RLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRN 698
           RLAA+IIS     + EN+A  L+  AP S +I V GPAE+PL +VRGR+RFR+L+HG + 
Sbjct: 599 RLAALIISADNRPDAENHARALRRCAPSSREISVLGPAEAPLALVRGRHRFRILVHGTKR 658

Query: 699 SNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           +++QGF   +     K   ++RVQ DIDPQ+FL
Sbjct: 659 ADIQGFIRVLLAAAPKEKGSIRVQVDIDPQSFL 691


>gi|114706541|ref|ZP_01439442.1| primosome assembly protein PriA [Fulvimarina pelagi HTCC2506]
 gi|114537933|gb|EAU41056.1| primosome assembly protein PriA [Fulvimarina pelagi HTCC2506]
          Length = 742

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/723 (50%), Positives = 482/723 (66%), Gaps = 10/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW----YNSEEKYKIDSLK 71
           V +L+   V  PY Y+VP  M VE GSIV+VPL  R V G+VW     N +E   +DS K
Sbjct: 23  VPVLVPLPVDRPYSYAVPEGMAVEPGSIVQVPLGPRQVAGVVWEATGLNGDE---VDSKK 79

Query: 72  LRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTGI 129
           LRPI  +FDCPP+   M  F+ WVADYT SP GLVARM + A +  + E   E ++ T  
Sbjct: 80  LRPITQLFDCPPIGADMRRFIDWVADYTLSPPGLVARMALRAPAAFDPEPWIEGLEATEA 139

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR R+    ++  +W K  L  A+ V+  V+DGL   G  + +     P V  
Sbjct: 140 RPERMTDARRRIFGAAEEALVWTKSGLAHAAGVTPSVVDGLMKLGAFRAVKFPPPPAVAE 199

Query: 190 PNLYFSLPILDKNQQDVVEQVVPL-CTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  +    L + Q +V  ++    C   F+V+L+ GVTGSGKTEVY E VA+ L  GKQ
Sbjct: 200 PDTSYGRAELSEEQSEVAGELAATGCQNEFSVTLLEGVTGSGKTEVYFEAVASALDAGKQ 259

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT + L+RF +RFG  PAEWHS ++  MREKIWRQV  G + V+ G RSAL
Sbjct: 260 VLILLPEIALTQSFLDRFHERFGAPPAEWHSDIAPRMREKIWRQVTEGRVRVVAGARSAL 319

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGL+V+DEEHD +YKQE+   Y+ARDM++VRG++  FPV+L SATPS+E+RVN 
Sbjct: 320 FLPFKELGLVVVDEEHDPAYKQEDRTFYHARDMAVVRGRVGGFPVILASATPSVETRVNA 379

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  ++LP L ++DMR     +G+ +SP ++  I+ T+AR EQ LLFL
Sbjct: 380 DLGRYRHLRLEARYAEASLPDLSLVDMRHAPPPRGRFVSPLLLTAIKETVARGEQALLFL 439

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLV+HR +  L CH CG      ++C  CG+   +
Sbjct: 440 NRRGYAPLTLCRVCGHRFQCASCSTWLVDHRLRGILQCHHCGFQTARPEACPECGTLDHL 499

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEE+    P AR  +LSSDL GG  RL+ +L AIA GE DI+IGTQLVAK
Sbjct: 500 VACGPGVERIAEEMLTDLPHARTILLSSDLPGGARRLRRELEAIADGEADIVIGTQLVAK 559

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GH+FP M+LVG +D DLGL N D R++ERTFQLL QVTGRAGR G  S GLIQ YQ  HP
Sbjct: 560 GHHFPMMTLVGAIDADLGLANGDPRAAERTFQLLHQVTGRAGRTGKASRGLIQTYQSEHP 619

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VMQA+ SGDA++FY  EI  RE   LPPFGRLAA+++S    +E E+YA  +++ AP   
Sbjct: 620 VMQAIASGDAETFYAREIAERERSQLPPFGRLAAIVVSANSKKEAEDYARQVRQAAPDDP 679

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           D+ + GPAE+PL ++RGR+RFRLL+ G R + LQ +     +       ++++Q DIDPQ
Sbjct: 680 DLEMLGPAEAPLAVLRGRHRFRLLVQGSRRAPLQSYLRATLNRAAAPRGSVQMQIDIDPQ 739

Query: 729 NFL 731
           +FL
Sbjct: 740 SFL 742


>gi|49476191|ref|YP_034232.1| primosome assembly protein PriA [Bartonella henselae str.
           Houston-1]
 gi|49238999|emb|CAF28299.1| Primosomal replication factor y [Bartonella henselae str.
           Houston-1]
          Length = 736

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/729 (52%), Positives = 504/729 (69%), Gaps = 16/729 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYK-------ID 68
           V +L+   V+  Y Y VPS+M+ E+GS VRVP+  R V G V    E+  K       + 
Sbjct: 11  VSVLVPLPVAHAYSYEVPSSMECEVGSFVRVPVMGRQVCGFVVGIGEQTAKDRQSSAPVA 70

Query: 69  SLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS--ALSETEKMEEKIQF 126
             KLR + +VFDCPPL  +M  F+++V+ YT +P GLVAR+V+S  A  E E     +++
Sbjct: 71  HDKLRVLLHVFDCPPLKTEMIAFLRFVSRYTMAPFGLVARLVLSVPAALEPEAQMPGLRY 130

Query: 127 TGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPV 186
            G      T ARLRVL+  +DG++W +  L  A+  S  V++GLK+ GV +++    S +
Sbjct: 131 CGGEVGRLTPARLRVLELARDGEVWTRSGLAHAAGTSVSVVEGLKSLGVFEEVMMPPSAL 190

Query: 187 VDSPNLYFSLPILDKNQQDVV----EQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAV 242
           V  P+  F  P+L+  Q +      E VV   +  F V L+ GVTGSGKTEVY E VA  
Sbjct: 191 VALPDPDFDPPVLEGEQSEAARLLREGVV---SAQFQVFLLDGVTGSGKTEVYFEAVAQA 247

Query: 243 LHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIV 302
           L  GKQVLILLPEI+LT   L+RF  RFGV  AEWHS L+   RE+IWRQVA G + V+ 
Sbjct: 248 LIEGKQVLILLPEIALTQQFLDRFHARFGVAAAEWHSDLAPRRRERIWRQVAEGRVRVVA 307

Query: 303 GVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSI 362
           G RSALFLPF +LGLIV+DEEHD +YKQEE I Y+ARDM++ RG  E FPV+L SATPSI
Sbjct: 308 GARSALFLPFHELGLIVVDEEHDGAYKQEERIFYHARDMAVARGSFEHFPVILSSATPSI 367

Query: 363 ESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNE 422
           ES+ N +  RY  VHL +R++ +ALP L+V+DMR   + +G+ +S  + + ++ TL + E
Sbjct: 368 ESQANVLRGRYQKVHLPSRFKEAALPRLRVVDMRQGGVQKGRFISFALEEALKQTLEKGE 427

Query: 423 QTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVC 482
           Q LLFLNRRGYAPLTLC+VCG+R  C  CS WLVEHR++ +L CH CG+     ++C  C
Sbjct: 428 QALLFLNRRGYAPLTLCRVCGHRFHCSDCSSWLVEHRAQGQLKCHHCGYHQSLPEACPEC 487

Query: 483 GSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIG 542
           G+   ++ACG G+ERIAEE    FP AR  ILS+DL+GG G+L+ +L AIAKG++DI+IG
Sbjct: 488 GTLDHLVACGPGVERIAEETRTLFPQARQLILSTDLKGGIGQLRRELEAIAKGDVDILIG 547

Query: 543 TQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQA 602
           TQLVAKGH+FP +SLVGV+D DLGL N DLR+ ERTFQLLSQVTGRAGR GL+SLGL+Q 
Sbjct: 548 TQLVAKGHHFPGLSLVGVIDADLGLANGDLRAGERTFQLLSQVTGRAGRMGLESLGLLQT 607

Query: 603 YQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE 662
           YQP HPV++AL+S  ++ FY  EI  RE  +LPP+GRLA++I+S  K Q  E+YA  L++
Sbjct: 608 YQPDHPVIKALLSQKSEDFYTYEIAMREHYHLPPYGRLASLIVSSEKRQAAEHYARVLRQ 667

Query: 663 HAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQ 722
            AP   +I + GPAE+PL ++RGRYRFRLL+ G+R+ ++QGF   M  N  K  +++RVQ
Sbjct: 668 VAPGEKNISLMGPAEAPLALIRGRYRFRLLLQGQRSFDIQGFIRAMLANAPKIPSSVRVQ 727

Query: 723 FDIDPQNFL 731
            DIDPQ+FL
Sbjct: 728 IDIDPQSFL 736


>gi|90418841|ref|ZP_01226752.1| primosomal protein N' [Aurantimonas manganoxydans SI85-9A1]
 gi|90336921|gb|EAS50626.1| primosomal protein N' [Aurantimonas manganoxydans SI85-9A1]
          Length = 788

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/709 (50%), Positives = 475/709 (66%), Gaps = 6/709 (0%)

Query: 27  PYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSR 86
           PY Y+VP  M V+ GSIV+VPL  R V G+VW    +   +D  KLR I  VFDCPPL  
Sbjct: 82  PYSYAVPDGMSVQPGSIVQVPLGPRQVAGVVWDGVTDD--VDPRKLRSITKVFDCPPLDH 139

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTGIFPRINTVARLRVLDK 144
            M  F+ WVADYT SP GLVARM + A +  + E   + I  T   P   T AR RVL  
Sbjct: 140 TMRRFIDWVADYTLSPPGLVARMALRAPAAFDPEPWIDGIALTDTTPSRLTEARERVLAT 199

Query: 145 IKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQ 204
             +   W +  L  A+ V+  V+DGL  QGV +++     P V  P+  +    L+++Q+
Sbjct: 200 AAEAPTWARLGLAHAAGVTPSVVDGLIKQGVFERVRLPPPPAVAEPDTSYGRANLNEDQR 259

Query: 205 DVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAIL 263
                +       GF  +L+ GVTGSGKTEVY E VAA L  G+QVLILLPEI+LT + +
Sbjct: 260 AAANALAATVAVDGFTATLLEGVTGSGKTEVYFEAVAAALEKGRQVLILLPEIALTQSFI 319

Query: 264 ERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEE 323
           +RF  RFG  PAEWHS +    REK+WRQ+A G + ++ G RSALFLPF  LGLI++DEE
Sbjct: 320 DRFHARFGSPPAEWHSDVPPRQREKVWRQIAEGRVRIVAGARSALFLPFNDLGLIIVDEE 379

Query: 324 HDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYR 383
           HD +YKQE+   Y+ARDM++VR  I +FP++L SATPS+E+RVN  S RY  V L+ R+ 
Sbjct: 380 HDPAYKQEDRTFYHARDMAVVRASIGAFPIILASATPSVETRVNAASGRYGHVRLTGRFA 439

Query: 384 NSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCG 443
            +A+P L +IDMR    A+G+ +SP +   I  T+A+ EQ LLFLNRRGYAPLTLC+VCG
Sbjct: 440 EAAMPDLSLIDMRSAPPARGRFVSPVLATAIAETVAKGEQALLFLNRRGYAPLTLCRVCG 499

Query: 444 NRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVC 503
           +R +CL CS WLV+HR + +L CH CG +    ++C  CG+   ++ACG G+ERIAEE+ 
Sbjct: 500 HRFQCLDCSTWLVDHRLRGQLQCHHCGFAVPRPEACPECGTLDHLVACGPGVERIAEEML 559

Query: 504 EYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDG 563
             FP AR  +LSSDL GG  RL+ +L AIA GE DI+IGTQLVAKGH+FP M+LVG +D 
Sbjct: 560 TDFPDARTILLSSDLPGGARRLRRELDAIADGEADIVIGTQLVAKGHHFPMMTLVGAIDA 619

Query: 564 DLGLTNADLRSSERTFQLLSQVTGRAGRFGLK-SLGLIQAYQPTHPVMQALVSGDADSFY 622
           DLGL N D R++ERTFQLL QVTGRAGR G + S G+IQ +QP HPVMQA+ SGDA  FY
Sbjct: 620 DLGLANGDPRAAERTFQLLHQVTGRAGRSGGRASRGMIQTWQPEHPVMQAIASGDAKRFY 679

Query: 623 ESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFM 682
           E E+  RE  +LPPFGRLA++I+S    +E E Y   L+  AP+ + I V GPAE+PL +
Sbjct: 680 EREVNERERTSLPPFGRLASIIVSANSRREAEEYGRELRRAAPQDAAIEVLGPAEAPLAL 739

Query: 683 VRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           +RGR+RFRLL+H  R +++QGF   +     +   ++++Q D+DPQ+FL
Sbjct: 740 LRGRHRFRLLVHAPRKAHIQGFLRALIAAAPRPRGSVQMQVDVDPQSFL 788


>gi|225628359|ref|ZP_03786393.1| primosomal protein N'' [Brucella ceti str. Cudo]
 gi|225616205|gb|EEH13253.1| primosomal protein N'' [Brucella ceti str. Cudo]
          Length = 752

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/677 (55%), Positives = 463/677 (68%), Gaps = 9/677 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+      PY Y VP  M V+ GSIVRVPL  R V GIV     E   +DS KLR I
Sbjct: 24  VPVLVPMPAERPYSYMVPPGMNVQPGSIVRVPLGPREVAGIVCEG--ETDAVDSRKLREI 81

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQFTG----I 129
             VF+CP +  +M  F++W ADYT SP G+VARMV  V A  + E     +++       
Sbjct: 82  SEVFNCPLVGPEMLRFMRWAADYTLSPPGMVARMVLRVPAAFDPEPAVPGLRYRAGEPER 141

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR RV++  +DG  W +  L  A+ VS  V+DGLKAQG+ ++I      VV  
Sbjct: 142 MPERMTAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKAQGIFEEIMLPPPAVVAK 201

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEVY E VA  L  G+Q
Sbjct: 202 PDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEVYFEAVAKALDAGRQ 261

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT   L+RF  RFG KPAEWHS L+   RE++WRQVA G + V+ G RSAL
Sbjct: 262 VLILLPEIALTQQFLDRFHDRFGAKPAEWHSDLAPRTRERVWRQVAEGTVRVVAGARSAL 321

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVVL SATPSIES+VN 
Sbjct: 322 FLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVVLASATPSIESQVNA 381

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +  T+ R EQ LLFL
Sbjct: 382 EQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAVGKTVERGEQALLFL 441

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+     Q+C  CG+   +
Sbjct: 442 NRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEPVPQACPECGTLDHL 501

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAKGE DI+IGTQLVAK
Sbjct: 502 VACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAKGEADIVIGTQLVAK 561

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G KSLGLIQ YQP HP
Sbjct: 562 GHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGRKSLGLIQTYQPDHP 621

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + EN+A  L+  AP S 
Sbjct: 622 VMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAENHARALRRCAPSSR 681

Query: 669 DIVVFGPAESPLFMVRG 685
           +I V GPAE+PL +VRG
Sbjct: 682 EISVLGPAEAPLALVRG 698


>gi|163869192|ref|YP_001610444.1| primosome assembly protein PriA [Bartonella tribocorum CIP 105476]
 gi|161018891|emb|CAK02449.1| primosomal replication factor Y [Bartonella tribocorum CIP 105476]
          Length = 735

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/713 (51%), Positives = 489/713 (68%), Gaps = 9/713 (1%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIV------WYNSEEKYKIDSLKLRPIEYVFDC 81
           Y Y VPS+M+VE+GS VRVP+  R + G +        N +    +   KLR + +VFDC
Sbjct: 23  YSYKVPSSMEVEIGSFVRVPVMGRELCGFIVDIEEQTKNGQRTASVAREKLRFVLHVFDC 82

Query: 82  PPLSRQMCEFVKWVADYTFSPMGLVARMVVS--ALSETEKMEEKIQFTGIFPRINTVARL 139
           PPL  +M  F+++V+ YT +P GLVAR+V+S  A  E E     +++ G      T ARL
Sbjct: 83  PPLKAEMITFLRFVSRYTMTPFGLVARLVLSVPAALEPEAQMLGLRYCGGDVERLTPARL 142

Query: 140 RVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPIL 199
           RVL+  ++ KIW +  L  A+  S  V++GLKA G+ +++      +V  P+  F  P L
Sbjct: 143 RVLELARNEKIWTRTGLAHAAGTSVSVVEGLKALGIFEEVKVPAPDLVGMPDPDFCPPQL 202

Query: 200 DKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISL 258
              Q +  + +   + +  F V L+ GVTGSGKTEVY E VA     G QVLILLPEI+L
Sbjct: 203 QGAQNEAAKLLREGVLSSQFQVFLLDGVTGSGKTEVYFEAVAQAFKGGSQVLILLPEIAL 262

Query: 259 TSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLI 318
           T   L+RF  RFG   AEWHS L    RE++WRQVA G + V+ G RSALFLPF  LGLI
Sbjct: 263 TQQFLDRFYARFGAAAAEWHSDLMPRRRERVWRQVAEGRVRVVAGARSALFLPFHALGLI 322

Query: 319 VIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHL 378
           V+DEEHD +YKQEE I Y+ARDM++ RG  E FPV+L SATPSIES+ N +  RY  VHL
Sbjct: 323 VVDEEHDSAYKQEERIFYHARDMAVARGSFEHFPVILASATPSIESQANVLKGRYQKVHL 382

Query: 379 STRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTL 438
            +R++  ALP L+V+DMR   + +G+ +S  +   ++ TL + EQ LLFLNRRGYAPLTL
Sbjct: 383 PSRFKEVALPQLRVVDMRQGGVQKGRFISFALEKALKQTLEKGEQALLFLNRRGYAPLTL 442

Query: 439 CQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERI 498
           C+VCG+R  C  CS WLVEHR++ +L CH CG+     ++C  CG+   ++ACG G+ERI
Sbjct: 443 CRVCGHRFHCTDCSSWLVEHRAQGQLKCHHCGYHQPIPEACPECGTLDHLVACGPGVERI 502

Query: 499 AEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLV 558
           AEE    FP AR  ILS+DL+GG G+L+ +L AIA G++DIIIGTQLVAKGH+FP++SLV
Sbjct: 503 AEETQGLFPQARSLILSTDLKGGIGQLRSELQAIANGDVDIIIGTQLVAKGHHFPKLSLV 562

Query: 559 GVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDA 618
           GV+D DLGL N DLR+SERTFQLLSQVTGRAGR GL+SLGL+Q YQP HPV++AL+S   
Sbjct: 563 GVIDADLGLANGDLRASERTFQLLSQVTGRAGRVGLESLGLLQTYQPDHPVIKALLSCQP 622

Query: 619 DSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAES 678
           + FY  EI AR+  +LPP+GRLA++I+S  + Q  ENYA  L++ APR  +I V GPAE+
Sbjct: 623 EEFYTREIAARQYYHLPPYGRLASLIVSAQQRQAAENYARALRQAAPREKNISVMGPAEA 682

Query: 679 PLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           PL +VRGRYRFRLL+ G+R+ ++QGF   M  N+ K  +++RVQ DIDPQ+F 
Sbjct: 683 PLALVRGRYRFRLLLQGQRSFDIQGFIRAMLSNSPKMPSSVRVQIDIDPQSFF 735


>gi|121601767|ref|YP_988446.1| primosome assembly protein PriA [Bartonella bacilliformis KC583]
 gi|120613944|gb|ABM44545.1| primosomal protein N' [Bartonella bacilliformis KC583]
          Length = 745

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/732 (51%), Positives = 495/732 (67%), Gaps = 18/732 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIV-------WYNSEEKYKID 68
           V +L+   VS  Y Y VPS+M VE+GS VRVP+  RT+ G V         N +E   + 
Sbjct: 16  VSVLVPLPVSHAYHYRVPSSMTVEVGSFVRVPVGGRTLCGFVVSLDEQTCENEQEGCPVS 75

Query: 69  SLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQF 126
             KLR IE VFDCPPL  +M  F+++V+ YT +P GL AR+V  V A  E E+    +++
Sbjct: 76  PDKLRFIECVFDCPPLKAEMIAFLRFVSSYTMTPFGLAARLVLRVPAALEREEPMMGLRY 135

Query: 127 TGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPV 186
            G      T AR RVL+  + G +W +  L  A+  S  V++GLK  GV ++    +SP+
Sbjct: 136 CGGEVHRLTPARSRVLELARKGMVWTRSGLAHAAGTSVSVVEGLKELGVFEEAPIPVSPL 195

Query: 187 VDSPNLYFSLPILDKNQQ---DVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVL 243
           V +PN  + LP+L+  Q+   D+++Q V L    F V L+ GVTGSGKTEVY E VA  L
Sbjct: 196 VATPNPNYCLPVLEDAQKSAADLLQQGVLLAK--FQVFLLDGVTGSGKTEVYFEAVAQAL 253

Query: 244 HLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVG 303
             GKQ+LILLPEI+LT   L+RF  RFG   AEWHS L+   RE++WRQVA G I V+ G
Sbjct: 254 KGGKQILILLPEIALTQQFLDRFYARFGAAAAEWHSDLAPRRRERVWRQVAEGQIRVVAG 313

Query: 304 VRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIE 363
            RSALFLPF  LGLIV+DEEHD +YKQEE I Y+ARDM++ RG  E  PV+L SATPSIE
Sbjct: 314 ARSALFLPFSDLGLIVVDEEHDGAYKQEERIFYHARDMAVARGSFEQCPVILSSATPSIE 373

Query: 364 SRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQ 423
           S+VN +  RY  VHL +R+R +ALP L+V+DMR   + +G+ +S  +   ++ TL + EQ
Sbjct: 374 SQVNVLWGRYQRVHLPSRFRAAALPQLRVVDMRQGGVEKGRFISSALEHALKQTLEKGEQ 433

Query: 424 TLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCG 483
            LLFLNRRGYAPLTLC++CG R  C  CS WLVEHR + +L CH CG+     ++C  CG
Sbjct: 434 ALLFLNRRGYAPLTLCRICGYRFHCTECSSWLVEHRLQGRLKCHHCGYHQPIPEACHECG 493

Query: 484 SSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGT 543
           +   ++ACG G+ERIAEE    FP AR+ ILS+DL+GG  +L+ +L AIA  ++DIIIGT
Sbjct: 494 TLDHLVACGPGVERIAEETQGLFPQARLMILSTDLKGGISQLRSELEAIANRDVDIIIGT 553

Query: 544 QLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAY 603
           QLV+KGH+FP +SLVGVVD DLGL N DLR+ ERTFQLLSQVTGRAGR GL+SLGL+Q Y
Sbjct: 554 QLVSKGHHFPGLSLVGVVDADLGLANGDLRAGERTFQLLSQVTGRAGRMGLESLGLLQTY 613

Query: 604 QPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEH 663
           QP HPV++AL+S   + FY  E+  RE  +LPP+GR A++I+S    Q  ENYA  L++ 
Sbjct: 614 QPDHPVIKALLSQQREDFYTRELAMREQHHLPPYGRFASLIVSSKNRQAAENYARVLRQA 673

Query: 664 APRSSD----IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNAL 719
           AP   D    + + GPAE+PL +VRG YRFRLL+HGKR+ ++QGF   M     K  +++
Sbjct: 674 APAVHDASLGVSLMGPAEAPLALVRGHYRFRLLLHGKRSFDVQGFIRAMLARAAKMPSSV 733

Query: 720 RVQFDIDPQNFL 731
           RVQ DIDPQ+FL
Sbjct: 734 RVQIDIDPQSFL 745


>gi|240851270|ref|YP_002972673.1| primosome assembly protein PriA [Bartonella grahamii as4aup]
 gi|240268393|gb|ACS51981.1| primosome assembly protein PriA [Bartonella grahamii as4aup]
          Length = 735

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/725 (51%), Positives = 493/725 (68%), Gaps = 9/725 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIV------WYNSEEKYKIDS 69
           V +L+   V+  Y Y VPS+M+V +GS VRVP+  R + G V        + +    +  
Sbjct: 11  VSVLVPLPVAHAYSYKVPSSMEVNVGSFVRVPVMGRELCGFVVDVGEKAADGQRAGSVAR 70

Query: 70  LKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS--ALSETEKMEEKIQFT 127
            KLR + +VFDCPPL  +M  F+++V+ YT +P GLVAR+V+S  A  E E     +++ 
Sbjct: 71  EKLRSLLHVFDCPPLKAEMITFLRFVSRYTMAPFGLVARLVLSVPAALEPEAQMLGLRYC 130

Query: 128 GIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVV 187
           G      T AR RVL+ +++ KIW +  L  A+  S  V++GLKA GV + +      +V
Sbjct: 131 GGNVERLTPARSRVLELVRNEKIWTRSGLAHAAGTSVSVVEGLKALGVFEDVIVPAPDLV 190

Query: 188 DSPNLYFSLPILDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
             P+  F  P L   Q +    +   + +  F V L+ GVTGSGKTEVY E VA     G
Sbjct: 191 AMPDPDFCPPQLQGAQNEAATMLREGVLSSQFQVFLLDGVTGSGKTEVYFEAVAQAFRGG 250

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           KQVLILLPEI+LT   L+RF  RFG   AEWHS L+   RE++WRQV+ G + V+ G RS
Sbjct: 251 KQVLILLPEIALTQQFLDRFYARFGAAAAEWHSDLTPRRRERVWRQVSEGRVRVVAGARS 310

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLPF +LGLIV+DEEHD +YKQEE I Y+ARDM++ RG  E FPV+L SATPSIES+ 
Sbjct: 311 ALFLPFHELGLIVVDEEHDSAYKQEERIFYHARDMAVARGSFEHFPVILSSATPSIESQA 370

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N +  RY  VHL +R++  ALP L+V+DMR   + +G+ +S  +   ++ TL + EQ LL
Sbjct: 371 NVLKGRYQKVHLPSRFKEVALPQLRVVDMRQGGVQKGRFISFALERALKQTLDKGEQALL 430

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRGYAPLTLC++CG+R  C  CS WLVEHR++ +L CH CG+     Q+C  CG+  
Sbjct: 431 FLNRRGYAPLTLCRICGHRFHCTDCSSWLVEHRAQGQLKCHHCGYHEPLPQACPECGTLD 490

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
            ++ACG G+ERIAEE    FP AR  ILS+DL+GG G+L+ +L AIA G++DIIIGTQLV
Sbjct: 491 HLVACGPGVERIAEETQMLFPQARSLILSTDLKGGIGQLRSELQAIANGDVDIIIGTQLV 550

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGH+FP++SLVGV+D DLGL N DLR+SERT+QLLSQVTGRAGR GL+SLGL+Q YQP 
Sbjct: 551 AKGHHFPKLSLVGVIDADLGLANGDLRASERTYQLLSQVTGRAGRVGLESLGLLQTYQPD 610

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR 666
           HPV++AL+S   + FY  EI AR+  +LPP+GRLA++I+S  + Q  E YA  L++ APR
Sbjct: 611 HPVIKALLSCQPEDFYTREIAARQHYHLPPYGRLASLIVSAQQRQAAEYYARALRQAAPR 670

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
             +I V GPAE+PL +VRGRYRFRLL+ G+R+ ++QGF   M   T K  +++RVQ DID
Sbjct: 671 EKNISVMGPAEAPLALVRGRYRFRLLLQGQRSFDIQGFIRAMLSGTPKMPSSVRVQIDID 730

Query: 727 PQNFL 731
           PQ+F 
Sbjct: 731 PQSFF 735


>gi|319409373|emb|CBI83017.1| primosomal replication factor Y [Bartonella schoenbuchensis R1]
          Length = 733

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/731 (51%), Positives = 492/731 (67%), Gaps = 19/731 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSL----- 70
           V +L+   V   Y Y VP +M VE+GS VRVP+  R V G V    E+    D       
Sbjct: 7   VSVLVPLPVPHAYSYEVPPSMGVEIGSFVRVPVMGREVCGFVVAVDEQTEDNDGQGAVPI 66

Query: 71  ---KLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEKMEEKIQ 125
              KLR I +VFDCPPL  +M  F+++V+ YT +P G VAR+V  V    E E     ++
Sbjct: 67  AREKLRLITHVFDCPPLKAEMIAFLRFVSHYTMTPFGFVARLVLRVPTALEPEAQTLGLR 126

Query: 126 FTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISP 185
           + G      T ARLRVL+  ++G +W    L RA+  S  V++GLK  GV +++     P
Sbjct: 127 YCGGDIGRLTPARLRVLEVAREGLVWTHSGLARAAGTSVSVVEGLKGLGVFEEVMMPALP 186

Query: 186 VVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-----FAVSLISGVTGSGKTEVYLEIVA 240
           +V  P+  F +P+L++ Q+        L  KG     F V L+ GVTG+GKTEVY E VA
Sbjct: 187 LVAMPDPDFCVPVLEEEQKSAAA----LLRKGVLSSQFQVFLLDGVTGAGKTEVYFEAVA 242

Query: 241 AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV 300
             L  GKQVLILLPEI+LT   L+RF  RFG    EWHS L+   RE++WRQVA G + V
Sbjct: 243 QALTCGKQVLILLPEIALTQQFLDRFHARFGTPAVEWHSDLTPRRRERVWRQVAEGQVRV 302

Query: 301 IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP 360
           + G RSALFLPF+ LGLIV+DEEHD SYKQEE + Y+ARDM++ RG  E  P++L SATP
Sbjct: 303 VAGARSALFLPFQDLGLIVVDEEHDGSYKQEERVFYHARDMAVARGSFEKCPIILSSATP 362

Query: 361 SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR 420
           SIES+VN +  RY  V LS R++ +ALPHLQV+DMR   + +G+ +S  +   +R T+ +
Sbjct: 363 SIESQVNVLWGRYQRVALSLRFQAAALPHLQVVDMRKGGVEKGRFISSVLERALRQTIDK 422

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
            EQ LLFLNRRGYAPLTLC++CG+R  C++CS WLVEHR   +L CH CG+     ++C 
Sbjct: 423 GEQALLFLNRRGYAPLTLCRICGHRFHCINCSSWLVEHRLYGQLKCHHCGYHEPIPEACP 482

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
            CG+   ++ACG G+ERIAEE  E FP AR+ ILS+DL+GG G+L+ +L AI   ++DII
Sbjct: 483 ECGTLDHLVACGPGVERIAEETRELFPQARLLILSTDLKGGIGQLRRELEAITNKDVDII 542

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQLVAKGH+FP +SLVGV+D DLGL N DLR+SERTFQLLSQVTGRAGR GL+SLGL+
Sbjct: 543 IGTQLVAKGHHFPGLSLVGVIDADLGLANGDLRASERTFQLLSQVTGRAGRMGLESLGLL 602

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           Q YQP HPV+QAL+S   ++FY  EI  R+  +LPP+GRLA++I+S  + +  ENYA  L
Sbjct: 603 QTYQPDHPVIQALLSQQRENFYTREIATRQHYHLPPYGRLASLIVSSKERKAAENYARAL 662

Query: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
           +  AP    + + GPAE+ L +VRGRYRFRLL+HG+R+ ++QGF   M  N  KR  +++
Sbjct: 663 RRVAPTVQGVSLMGPAEAQLALVRGRYRFRLLLHGQRSFDMQGFIRAMIANAPKRPGSVQ 722

Query: 721 VQFDIDPQNFL 731
           VQ DIDPQ+FL
Sbjct: 723 VQIDIDPQSFL 733


>gi|49474714|ref|YP_032756.1| primosome assembly protein PriA [Bartonella quintana str. Toulouse]
 gi|49240218|emb|CAF26687.1| Primosomal replication factor y [Bartonella quintana str. Toulouse]
          Length = 740

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/735 (50%), Positives = 503/735 (68%), Gaps = 11/735 (1%)

Query: 8   VEGVVCSRVI-ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYK 66
            +GV   +++ +L+   V   Y Y VPS+M+ ++GS VRV +  R V G V    E+  K
Sbjct: 6   TQGVTKRKIVSVLVPLPVPHAYSYEVPSSMESKVGSFVRVLVMGREVCGFVVDVGEQPEK 65

Query: 67  IDS-------LKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS--ALSET 117
           +          KL  + +VFDCPPL  +M  F+++V+ YT +P GLVAR+V+S  A  E 
Sbjct: 66  VGQSAAPVAPKKLHSLLHVFDCPPLKAEMITFLRFVSQYTMAPFGLVARLVLSVPAALEP 125

Query: 118 EKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIK 177
           E     +++ G      T AR RVL   +DG++W +  L  A+  S  V++GLK+ GV +
Sbjct: 126 EAQMLGLRYCGGVVERLTPARSRVLGLARDGEVWTRAGLAHAAGTSVSVVEGLKSLGVFE 185

Query: 178 QIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYL 236
           ++   +  +V  P+  F  P+L+  Q +  + +   + +  F V L+ GVTGSGKTEVY 
Sbjct: 186 EVMVSVPTLVAMPDPNFCPPVLEGAQSEAAQLLREGVLSSQFQVFLLDGVTGSGKTEVYF 245

Query: 237 EIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARG 296
           E VA  L  GKQVLILLPEI+LT   L+RF +RFG   AEWHS L    RE++WRQ+A G
Sbjct: 246 EAVAQALIGGKQVLILLPEIALTQQFLDRFHERFGASAAEWHSDLPPRRRERVWRQIAEG 305

Query: 297 AISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLV 356
            + V+ G RSALFLPF++LGLIV+DEEHD +YKQEE I Y+ARDM++ RG  E FPV+L 
Sbjct: 306 RVRVVAGARSALFLPFQELGLIVVDEEHDGAYKQEERIFYHARDMAVARGSFEHFPVILS 365

Query: 357 SATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRH 416
           SATPSIES+ N +  RY  VHL +R++ +ALP L+V+DMR   + +G+ +S  +   +  
Sbjct: 366 SATPSIESQANVLRGRYQRVHLPSRFKEAALPQLRVVDMRQGGVQKGRFISSALEHALTQ 425

Query: 417 TLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYS 476
           TL + EQ LLFLNRRGYAPLTLC+VCG+R  C +CS WLVEHR++ +L CH CG+   + 
Sbjct: 426 TLEKGEQALLFLNRRGYAPLTLCRVCGHRFHCTNCSSWLVEHRAQGQLKCHHCGYHQPFP 485

Query: 477 QSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGE 536
           + C  CG+   ++ACG G+ERIAEE    FP AR+ ILS+DL+GG  +L+ +L AIAKG+
Sbjct: 486 EVCPECGTLDHLVACGPGVERIAEETQMLFPQARLLILSTDLKGGIRQLRSELEAIAKGD 545

Query: 537 IDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKS 596
           +DIIIGTQLVAKGH+FP +SLVGV+D DLGL N DLR+SERTFQLLSQVTGRAGR GL+S
Sbjct: 546 VDIIIGTQLVAKGHHFPGLSLVGVIDADLGLANGDLRASERTFQLLSQVTGRAGRIGLES 605

Query: 597 LGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENY 656
           LGL+Q YQP HPV+QAL+S  ++ FY  E+  R+  +LPP+GRLA++I+S  K Q  E+Y
Sbjct: 606 LGLLQTYQPNHPVIQALLSRQSEDFYTHELAVRQHYHLPPYGRLASLIVSSEKRQAAEHY 665

Query: 657 AYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRS 716
           A  L++ APR  ++ + GPAE+ L +VRGRYRFRLL+ G+R+ ++QGF   M  +  K  
Sbjct: 666 ARALRQVAPREKNVSLMGPAEAQLALVRGRYRFRLLLQGQRSFDMQGFIRAMLASAPKMP 725

Query: 717 NALRVQFDIDPQNFL 731
           +++RVQ DIDPQ+F 
Sbjct: 726 SSVRVQIDIDPQSFF 740


>gi|319407771|emb|CBI81418.1| primosomal replication factor Y [Bartonella sp. 1-1C]
          Length = 739

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/722 (51%), Positives = 487/722 (67%), Gaps = 19/722 (2%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSE---EKYKIDSLK-----------LR 73
           Y Y V   ++V++GS VRVP+  R + G V    E   E+ K D LK           LR
Sbjct: 19  YSYGVEPHIEVKVGSFVRVPVAGREICGFVVALGESIFEEEKKDHLKKITAVSVARDKLR 78

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV---SALSETEKMEEKIQFTGIF 130
            + +VFDCPPL  +M  F+++V+ YT +P GL+A +V+   +AL   EKM       G  
Sbjct: 79  FVTHVFDCPPLKAEMIAFLRFVSQYTMTPFGLIAGLVLRVPTALDPEEKMVGLRYCGGNV 138

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
            R+ T AR RVLD  +DG IW + DL  A++ +  V+D LK+ GV +++      VV  P
Sbjct: 139 ARL-TPARSRVLDLARDGMIWNRSDLAHAAKTALSVVDLLKSLGVFEEVMVPAQAVVALP 197

Query: 191 NLYFSLPILDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
           +  F  P+L+  Q+     +   + +  F V L+ GVTGSGKTEVY E VA  L   +QV
Sbjct: 198 DPDFCPPVLEGAQKAAANVLREGIVSSQFQVFLLDGVTGSGKTEVYFEAVAQALRDNRQV 257

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           LILLPEI+LT   L+RF  RFG   AEWHS L+   RE++WRQV  G + V+ G RSALF
Sbjct: 258 LILLPEIALTQQFLDRFHARFGASAAEWHSDLTPRRRERVWRQVLEGKVRVVAGARSALF 317

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPF  LGLIV+DEEHD +YKQEE I Y+ARDM++ RG  E  PV+L SATPSIES+VN +
Sbjct: 318 LPFLDLGLIVVDEEHDGAYKQEERIFYHARDMAVARGSFERCPVILSSATPSIESQVNVL 377

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
             RY  VHL +R++ +ALPHLQVIDMR   + +G+ +S  +   +R TL R EQ LLFLN
Sbjct: 378 WGRYQRVHLPSRFQAAALPHLQVIDMRKGGVEKGRFISSVLERALRKTLERGEQALLFLN 437

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC++CG+R  C  CS WLVEHR + +L CH CG+     ++C  CG+   ++
Sbjct: 438 RRGYAPLTLCRMCGHRFHCTDCSSWLVEHRLRGQLKCHHCGYYEPLPEACPECGTLDHLV 497

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
           ACG G+ERIAEE    FP AR+ ILS+DL+G   +L+ +L AIAKG++DIIIGTQLVAKG
Sbjct: 498 ACGPGVERIAEETQRLFPQARLLILSTDLKGRISQLRRELEAIAKGDVDIIIGTQLVAKG 557

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           H+FP +SLVGV+D DLGL N DLR+SERTFQLLSQVTGRAGR GL+SLGL+Q YQP HPV
Sbjct: 558 HHFPGLSLVGVIDADLGLANGDLRASERTFQLLSQVTGRAGRMGLESLGLLQTYQPDHPV 617

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           ++AL+S   + FY+ EI  R+   LPP+GRLAA+IIS  K Q  ENYA  L++ AP    
Sbjct: 618 IKALLSQQREDFYKREIAMRQHDVLPPYGRLAALIISSEKRQVAENYARALRQVAPSMKG 677

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           + V GPAE+ L +VRGRYRFRLL HG+R+ +LQGF   +     K+ +++RVQ DIDPQ+
Sbjct: 678 VSVMGPAEAQLALVRGRYRFRLLFHGQRSFDLQGFIRVVLSRAPKKPSSVRVQIDIDPQS 737

Query: 730 FL 731
           FL
Sbjct: 738 FL 739


>gi|319404811|emb|CBI78412.1| primosomal replication factor Y [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 739

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/724 (51%), Positives = 492/724 (67%), Gaps = 23/724 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIV------WYNSEEKYKIDSL--------KLR 73
           Y Y V   ++V++GS VRVP+  R + G V       +  E+K  + ++        KLR
Sbjct: 19  YSYGVEPHIEVKVGSFVRVPVAGREICGFVVAVGESIFEEEQKDHLKNITAVSVTRDKLR 78

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV---SALSETEKMEEKIQFTGIF 130
            + +VFDCPPL  +M  F+++V+ YT +P GL+A +V+   +AL   EKM       G  
Sbjct: 79  FVTHVFDCPPLKAEMIAFLRFVSQYTMTPFGLIAGLVLRVPTALDPEEKMVGLRYCGGNV 138

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
            R+ T AR RVLD  +DG IW + DL  A++ +  V+D LK+ GV +++      VV  P
Sbjct: 139 ARL-TPARSRVLDLARDGMIWNRSDLAHAAKTALSVVDLLKSLGVFEEVMVPAQAVVALP 197

Query: 191 NLYFSLPILDKNQQ---DVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
           +  F  P+L+  Q+   +V+ + V   +  F V L+ GVTGSGKTEVY E VA  L   K
Sbjct: 198 DPDFCPPVLEGAQKAAANVLREGV--LSSQFQVFLLDGVTGSGKTEVYFEAVAQALRDNK 255

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           QVLILLPEI+LT   L+RF+ RFG   AEWHS L+   RE++WRQ+  G + V+ G RSA
Sbjct: 256 QVLILLPEIALTQQFLDRFRARFGASAAEWHSDLTPRRRERVWRQILEGKVRVVAGARSA 315

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LFLPF  LGLIV+DEEHD +YKQEE I Y+ARDM++ RG  E  PV+L SATPSIES+VN
Sbjct: 316 LFLPFLDLGLIVVDEEHDGAYKQEERIFYHARDMAVARGSFERCPVILSSATPSIESQVN 375

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
            + +RY  VHL +R++ +ALP LQVIDMR   + +G+ +S  +   +R TL + EQ LLF
Sbjct: 376 VLWKRYQRVHLPSRFQAAALPDLQVIDMRKGGVEKGRFISSVLERALRKTLEKGEQALLF 435

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRGYAPLTLC++CG+R  C  CS WLVEHR + +L CH CG+     ++C  CG+   
Sbjct: 436 LNRRGYAPLTLCRMCGHRFHCTDCSSWLVEHRLRGQLKCHHCGYYEPLPEACPECGTLDH 495

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           ++ACG G+ERIAEE    FP AR+ ILS+DL+G   +L+ +L AIAKG++DIIIGTQLVA
Sbjct: 496 LVACGPGVERIAEETQRLFPQARLLILSTDLKGRISQLRRELEAIAKGDVDIIIGTQLVA 555

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGH+FP +SLVGV+D DLGL N DLR+SERTFQLLSQVTGRAGR GL+SLGL+Q YQP H
Sbjct: 556 KGHHFPGLSLVGVIDADLGLANGDLRASERTFQLLSQVTGRAGRMGLESLGLLQTYQPDH 615

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS 667
           PV++AL+S   + FY+ EI  R+   LPP+GRLAA+IIS  K Q  ENYA  L++ AP  
Sbjct: 616 PVIKALLSQQREDFYKREIAIRQHDVLPPYGRLAALIISSEKRQVAENYARALRQVAPSM 675

Query: 668 SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDP 727
             + V GPAE+ L +VRGRYRFRLL HG+R+ +LQGF   +     K+ +++RVQ DIDP
Sbjct: 676 KGVSVMGPAEAQLALVRGRYRFRLLFHGQRSFDLQGFIRVVLSRAPKKPSSVRVQIDIDP 735

Query: 728 QNFL 731
           Q+FL
Sbjct: 736 QSFL 739


>gi|304392616|ref|ZP_07374556.1| primosomal protein N' [Ahrensia sp. R2A130]
 gi|303295246|gb|EFL89606.1| primosomal protein N' [Ahrensia sp. R2A130]
          Length = 753

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/732 (49%), Positives = 481/732 (65%), Gaps = 5/732 (0%)

Query: 5   GSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEK 64
           G  +E        +LL      PY Y+VP+ M V+ G  V+VPL  R V  +VW      
Sbjct: 22  GDPLEAAPLRTAYVLLPIPADRPYSYAVPAGMDVQPGDYVQVPLGPRKVASVVWDAPVGD 81

Query: 65  YKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV--SALSETEKMEE 122
             +D  KLR IE  FDCPP+   M  FV W+A YT +P G+V + ++   A  + E+   
Sbjct: 82  NGVDPKKLRAIETKFDCPPVPEDMRRFVDWIAHYTIAPPGMVLKSLLRTPAALDPEQPMP 141

Query: 123 KIQFTGIFPRINTVARLRV--LDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIF 180
            I FTG +P   + AR RV  L +    ++W K  L  A+  SS V+DGL   G      
Sbjct: 142 GIAFTGDWPDRMSDARGRVRGLIEADTKQLWTKSGLANAAGTSSSVVDGLVKAGTFAPRD 201

Query: 181 EVISPVVDSPNLYFSLPILDKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIV 239
               P+V  P    +   L+++QQ+  + +V  +    ++  LI G+TGSGKTEVY E +
Sbjct: 202 IPPQPIVPPPMPKQAGKPLNEDQQEAADALVEAVKADEYSTHLIDGITGSGKTEVYFEAI 261

Query: 240 AAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAIS 299
           AA L+ GKQVL+LLPEI+LT+  L+RF+ RFG  PA WHS ++   REKIWRQVA G + 
Sbjct: 262 AAALNAGKQVLVLLPEIALTATFLDRFEARFGAPPAPWHSGITPRQREKIWRQVAEGTVR 321

Query: 300 VIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSAT 359
           V+VG RSALFLPF +LGL+V+DEEHD +YKQE+ + Y+ARDM++VR ++  F  VL SAT
Sbjct: 322 VVVGARSALFLPFAELGLVVVDEEHDQAYKQEDRVFYSARDMAVVRARLGGFACVLASAT 381

Query: 360 PSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLA 419
           PS+E+RVN  + RY  + L  R+  + LP L  IDMR     +G+ +SP + + +R + A
Sbjct: 382 PSVETRVNADTGRYIRLRLDRRHGAAVLPKLSTIDMRENPPPRGRFVSPVLEEEMRQSTA 441

Query: 420 RNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSC 479
           R EQ+LLFLNRRGYAPLTLC+VCG R +C +CS WLVEHR + +L CH CGHS    ++C
Sbjct: 442 RGEQSLLFLNRRGYAPLTLCRVCGFRFECRNCSAWLVEHRFRGQLQCHHCGHSEPTPEAC 501

Query: 480 VVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDI 539
             CG+   ++ACG G+ER+AEEV   FP ARI +LSSD+ GG  RL+L+L AIA G+ DI
Sbjct: 502 TNCGTLDHLVACGPGVERLAEEVDAIFPEARIIVLSSDMLGGVSRLRLELEAIADGQADI 561

Query: 540 IIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGL 599
           +IGTQLVAKGHNFP+M++VGVVD DLGL N D R++ERTFQLLSQVTGRAGR G +S GL
Sbjct: 562 VIGTQLVAKGHNFPKMTVVGVVDADLGLANGDPRAAERTFQLLSQVTGRAGRAGGESKGL 621

Query: 600 IQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYN 659
           +Q Y P HPV++A+VSGD ++FYE EI  R+S  LPPF RL ++IISGT  +E E +A +
Sbjct: 622 LQTYAPDHPVIKAIVSGDREAFYEREIALRKSAGLPPFARLVSLIISGTDKRETERHAMD 681

Query: 660 LKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNAL 719
           LK  AP   D+ + GPAE+P+  VRGR+R+RLL+H  R  ++Q +         K    +
Sbjct: 682 LKLAAPFMEDVFLLGPAEAPIAQVRGRWRWRLLVHAPRALDVQTYIRDWLAKGPKERGNI 741

Query: 720 RVQFDIDPQNFL 731
           RVQ D+DPQ+FL
Sbjct: 742 RVQVDVDPQSFL 753


>gi|294851042|ref|ZP_06791718.1| primosomal protein N' [Brucella sp. NVSL 07-0026]
 gi|294821685|gb|EFG38681.1| primosomal protein N' [Brucella sp. NVSL 07-0026]
          Length = 633

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/617 (56%), Positives = 434/617 (70%), Gaps = 11/617 (1%)

Query: 116 ETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGV 175
           E E+M E++          T AR RV++  +DG  W +  L  A+ VS  V+DGLK QG+
Sbjct: 27  EPERMPERM----------TAARARVMELARDGLAWTRSGLAHAAGVSLTVVDGLKEQGI 76

Query: 176 IKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEV 234
            ++I      VV  P+  ++   L ++QQ   E +       GF+VSL+ GVTGSGKTEV
Sbjct: 77  FEEIMLPPPAVVAKPDTDYARATLSQDQQAAAEMLSEAVEAGGFSVSLLDGVTGSGKTEV 136

Query: 235 YLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVA 294
           Y E VA  L  G+QVLILLPEI+LT   L+RF  RFG KPA+WHS L+   RE++WRQVA
Sbjct: 137 YFEAVAKALDAGRQVLILLPEIALTQQFLDRFHDRFGAKPAKWHSDLAPRTRERVWRQVA 196

Query: 295 RGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVV 354
            G + V+ G RS LFLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVV
Sbjct: 197 EGTVRVVAGARSVLFLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVV 256

Query: 355 LVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGI 414
           L SATPSIES+VN    RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +
Sbjct: 257 LASATPSIESQVNAEQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAV 316

Query: 415 RHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAI 474
             T+ R EQ LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+   
Sbjct: 317 GKTVERGEQALLFLNRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEP 376

Query: 475 YSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAK 534
             Q+C  CG+   ++ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAK
Sbjct: 377 VPQACPECGTLDHLVACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAK 436

Query: 535 GEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGL 594
           GE DI+IGTQLVAKGHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G 
Sbjct: 437 GEADIVIGTQLVAKGHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGR 496

Query: 595 KSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVE 654
           KSLGLIQ YQP HPVM+A+VSGDAD+FY  EI  RE  NLPPFGRLAA+IIS     + E
Sbjct: 497 KSLGLIQTYQPDHPVMRAIVSGDADAFYAREIEERERSNLPPFGRLAALIISADNRPDAE 556

Query: 655 NYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIK 714
           N+A  L+  AP S +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K
Sbjct: 557 NHARALRHCAPSSREISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPK 616

Query: 715 RSNALRVQFDIDPQNFL 731
              ++RVQ DIDPQ+FL
Sbjct: 617 EKGSIRVQVDIDPQSFL 633


>gi|319406296|emb|CBI79933.1| primosomal replication factor Y [Bartonella sp. AR 15-3]
          Length = 739

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/722 (51%), Positives = 487/722 (67%), Gaps = 19/722 (2%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSE---EKYKIDSLK-----------LR 73
           Y Y V   +++++GS VRVP+  R + G V    E   E+ + +SLK           LR
Sbjct: 19  YSYGVEPHIEIKVGSFVRVPVAGREICGFVVAIGEPIFEEEQRESLKRVTAVPVARDKLR 78

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV---SALSETEKMEEKIQFTGIF 130
            + +VFDCPPL  +M  F+++ + YT +P GLVA +V+   +AL   EKM       G  
Sbjct: 79  FVTHVFDCPPLKAEMIAFLRFFSQYTMTPFGLVAGLVLRVPTALDPEEKMVGLRYCGGNV 138

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
            R+ T AR RVLD  +DG I  + DL  A++ S  V+D LK+ GV +++   +  VV  P
Sbjct: 139 ERL-TPARSRVLDLARDGIIRTRSDLAHAARTSPSVVDLLKSLGVFEEVVVPVQAVVALP 197

Query: 191 NLYFSLPILDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
           +  F  P+L+  Q+     +   + +  F V L+ GVTGSGKTEVY E VA  L   KQV
Sbjct: 198 DPDFCPPVLEGAQKSAANLLREGVLSSQFQVFLLDGVTGSGKTEVYFEAVAQALKGNKQV 257

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           LILLPEI+LT   L+RF  RFGV  AEWHS L+   RE++WRQV  G + V+ G RSALF
Sbjct: 258 LILLPEIALTQQFLDRFHARFGVSAAEWHSDLTPRRRERVWRQVVEGKVRVVAGARSALF 317

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPF  LGLIV+DEEHD +YKQEE I Y+ARDM++ RG  E  PV+L SATPSIES+VN +
Sbjct: 318 LPFLDLGLIVVDEEHDGAYKQEERIFYHARDMAVARGSFERCPVILSSATPSIESQVNVL 377

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
             RY  VHL +R++  ALPHL+VIDMR   + +G+ +S  +   +R TL + EQ LLFLN
Sbjct: 378 WGRYQRVHLPSRFQAVALPHLRVIDMRKGGVEKGRFISCVLEHALRKTLEKGEQALLFLN 437

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC+VCG+R  C  CS WLVEHR + +L CH CG+     ++C  CG+   ++
Sbjct: 438 RRGYAPLTLCRVCGHRFHCTDCSSWLVEHRLRGQLKCHHCGYYEPLPEACPECGTLDHLV 497

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
           ACG G+ERIAEE    FP AR+ ILS+DL+G   +L+ +L AIA+G++DI+IGTQLVAKG
Sbjct: 498 ACGPGVERIAEETQMLFPQARLLILSTDLKGRISQLRRELEAIARGDVDIVIGTQLVAKG 557

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           H+FPR+SLVGV+D DLGL N DLR+SERTFQLLSQVTGRAGR GL+SLGL+Q YQP HPV
Sbjct: 558 HHFPRLSLVGVIDADLGLANGDLRASERTFQLLSQVTGRAGRMGLESLGLLQTYQPDHPV 617

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           ++AL+S   + FYE EI  R+   LPP+GR AA+I+S  K Q  ENYA  L++ AP    
Sbjct: 618 IKALLSQQREDFYEREIAMRQHDVLPPYGRFAALIVSSEKRQVAENYARALRQVAPSVKG 677

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           + V GPAE+ L +VRGRYRFRLL HG+R+ +LQGF   +     K+ +++RVQ DIDPQ+
Sbjct: 678 VSVMGPAEAQLALVRGRYRFRLLFHGQRSFDLQGFIRVILSRAPKKPSSVRVQIDIDPQS 737

Query: 730 FL 731
           FL
Sbjct: 738 FL 739


>gi|328545833|ref|YP_004305942.1| priA family helicase (Primosomal protein N', replication factor Y)
           [polymorphum gilvum SL003B-26A1]
 gi|326415573|gb|ADZ72636.1| Putative priA family helicase (Primosomal protein N', replication
           factor Y) [Polymorphum gilvum SL003B-26A1]
          Length = 731

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/717 (51%), Positives = 470/717 (65%), Gaps = 4/717 (0%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +L+  AV GPY Y VP  + V  G+IVRVPL  R V+G VW    E   ID  KL+ I +
Sbjct: 16  VLVPVAVPGPYTYKVPPGLAVCPGTIVRVPLGPREVVGAVWDGMPEP-GIDPRKLKAISH 74

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV---SALSETEKMEEKIQFTGIFPRIN 134
           V+   PL   M  FV WVA++T SP G+V RMV+    AL     +    +  G  P   
Sbjct: 75  VYPAGPLDADMRRFVDWVANWTLSPPGMVLRMVLRSEEALEPEPPVAGVARVEGAAPDRL 134

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           T AR RVLD ++DG  W K  L  A+ VS  VIDGL  QGV++ +    SP   +P+  +
Sbjct: 135 TPARRRVLDTMQDGFAWTKSGLAGAAGVSVSVIDGLVHQGVLEIVSMSASPAPPAPDPAY 194

Query: 195 SLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLP 254
           + P L   Q  V   +V    +G+AVSLI GVTGSGKTEVY E VA  +  G+Q ++L+P
Sbjct: 195 NAPALSPAQAAVATGLVAAFDRGYAVSLIDGVTGSGKTEVYFEAVAEAVRRGRQAVVLVP 254

Query: 255 EISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKK 314
           EISLT+  L+RF++RFGV PAEWHS ++   R ++WR VA G + V+VG RSALFLPF +
Sbjct: 255 EISLTAQFLKRFEQRFGVLPAEWHSEVAPRRRARVWRGVASGDVRVVVGARSALFLPFHE 314

Query: 315 LGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYH 374
           LGLIV+DEEHD ++KQ++ + YNARDM++VRG +  FPV+L SATPSIESRVN    RY 
Sbjct: 315 LGLIVVDEEHDTAFKQDDRVPYNARDMAVVRGHLAQFPVILASATPSIESRVNADLGRYT 374

Query: 375 SVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYA 434
              L  R    ALP L  IDMR     +G+ L+P ++  +R TLA N Q+LLFLNRRGYA
Sbjct: 375 RFVLPERASGGALPELHAIDMRRDGPERGRWLAPALVAAMRETLADNAQSLLFLNRRGYA 434

Query: 435 PLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFG 494
           PLTLC+ CG+R +C HCS WLVEHR + +L CH CGHS    Q+C  CG+   ++ACG G
Sbjct: 435 PLTLCRSCGHRFQCSHCSAWLVEHRFRGRLVCHHCGHSEPVPQACPSCGTVDALVACGPG 494

Query: 495 IERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPR 554
           +ERIAEEV   FP AR  ILSSDL GG  RL+ ++  + +G  DI+IGTQLVAKGHNFP 
Sbjct: 495 VERIAEEVEALFPQARTLILSSDLPGGPERLRREMKIVEEGGADIVIGTQLVAKGHNFPL 554

Query: 555 MSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALV 614
           M LVGVVD DLGL + D R++ERTFQLL+QVTGRAGRF     G +Q Y P HPV++AL+
Sbjct: 555 MRLVGVVDADLGLAHGDPRAAERTFQLLAQVTGRAGRFSGGGKGYLQTYSPDHPVIRALL 614

Query: 615 SGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFG 674
           S D+++FY +EI AR    LPPFGRLAA+++SG      E YA  +   AP  + + V G
Sbjct: 615 SSDSEAFYAAEIEARRVAGLPPFGRLAALVVSGPDKPATEGYARAVARAAPPDAAVTVLG 674

Query: 675 PAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           PAE+ L MVRGR+RFRLL+   R  ++QG+         + +  LR+Q DIDPQ FL
Sbjct: 675 PAEAALAMVRGRHRFRLLVLAPRQFDMQGYLRGWLSRVPRAAGGLRLQVDIDPQQFL 731


>gi|307942819|ref|ZP_07658164.1| primosomal protein N' [Roseibium sp. TrichSKD4]
 gi|307773615|gb|EFO32831.1| primosomal protein N' [Roseibium sp. TrichSKD4]
          Length = 732

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/718 (48%), Positives = 471/718 (65%), Gaps = 5/718 (0%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +L+  AV   Y Y VP    V  G+IV+VPL  R V+G VW +      I+  KL+ I  
Sbjct: 16  VLVPVAVPTAYTYRVPKGAHVCPGTIVKVPLGPREVIGAVW-DVTPDAGINPKKLKEISR 74

Query: 78  VFD-CPPLSRQMCEFVKWVADYTFSPMGLVARMVV---SALSETEKMEEKIQFTGIFPRI 133
           +F+   PL  ++ +F+ WVA++T +P G+V RMV+    AL     +    +  G+ P  
Sbjct: 75  IFEETRPLDAELRQFIDWVANWTLAPPGMVLRMVLRSEEALEPETPIAGVRRLAGMEPDR 134

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR RVL+ ++DG  W K  L  A+ VS  VIDGL  QGV++ +    +P +  P++ 
Sbjct: 135 KTPARARVLETMEDGFAWTKSGLSHAAGVSVSVIDGLLKQGVLEVVEMPAAPPLPKPDID 194

Query: 194 FSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           ++   L + Q+   + +     KG +VSLI GVTGSGKTEVY E +A  L  GKQ LIL+
Sbjct: 195 YARVDLTETQKKAADGIRAAFEKGASVSLIDGVTGSGKTEVYFEAIAEALKRGKQALILV 254

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI+LT   L RF++RFGV PAEWHS ++   R ++WR VA G + V++G RSALFLPF 
Sbjct: 255 PEIALTEQFLRRFEQRFGVYPAEWHSEITPKKRARVWRGVASGDVRVVIGARSALFLPFL 314

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
           +LGLIV+DEEHD ++KQ++ + Y+ARDM++VRG I  FPVVL SATPS+ESRVN    RY
Sbjct: 315 ELGLIVVDEEHDTAFKQDDRVPYSARDMAVVRGHISKFPVVLASATPSVESRVNAEQGRY 374

Query: 374 HSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGY 433
           +   L  R   +ALP LQ +DMR +   +G+ ++P +++ IR   A   Q+LLFLNRRGY
Sbjct: 375 NRFILPDRASGAALPDLQAVDMRAEGPERGRWIAPPLLNAIRSAFADGAQSLLFLNRRGY 434

Query: 434 APLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGF 493
           APLTLC+ CG+R +C HCS WLVEHR +K+L CH CGHS    ++C  C S+  ++ACG 
Sbjct: 435 APLTLCRKCGHRFQCPHCSAWLVEHRFQKRLNCHHCGHSESVPEACPSCSSTDSLVACGP 494

Query: 494 GIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFP 553
           G+ERIAEEV   FP AR  +LSSD++GG  RL+ ++  + +G  DI+IGTQLVAKGHNFP
Sbjct: 495 GVERIAEEVSGLFPEARTLVLSSDIQGGPDRLRREMKVVEEGGADIVIGTQLVAKGHNFP 554

Query: 554 RMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQAL 613
           +M LVGV+D DLGL + D R++E+TFQLL+QVTGRAGR      G +Q Y P HPV++AL
Sbjct: 555 KMRLVGVIDADLGLAHGDPRAAEKTFQLLAQVTGRAGRVTGDGAGFLQTYAPDHPVIKAL 614

Query: 614 VSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVF 673
           +S D D+FY +EI AR++  LPPFGRLAA++ISG      E Y+  +   AP    I + 
Sbjct: 615 LSSDRDAFYNAEIEARQATGLPPFGRLAALVISGPDKAFTEGYSRAILRTAPMHEAITIL 674

Query: 674 GPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           GPAE+ L MVRGR+R+RLL    R  +LQG+         K    LRVQ DIDPQ+F+
Sbjct: 675 GPAEAALAMVRGRHRYRLLALAPRQIDLQGYIRAWLSEAPKPVKGLRVQIDIDPQHFM 732


>gi|254470828|ref|ZP_05084231.1| primosomal protein N` (replication factor Y) [Pseudovibrio sp.
           JE062]
 gi|211959970|gb|EEA95167.1| primosomal protein N` (replication factor Y) [Pseudovibrio sp.
           JE062]
          Length = 737

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/709 (49%), Positives = 468/709 (66%), Gaps = 4/709 (0%)

Query: 26  GPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLS 85
           G Y Y VP+ M V  GSIVRVPL  R V+G VW + E   K++  KL+ I +V+D PP++
Sbjct: 30  GAYSYKVPADMDVRPGSIVRVPLGPREVIGAVW-DGEPDTKVNPKKLKSILHVYDTPPIA 88

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQF-TGIFPRINTVARLRVL 142
             + +++ WVA +T    G+V RMV+ +    E E +   +++  G+ P   T AR +V+
Sbjct: 89  EDLRKYIDWVAAWTLGAPGMVLRMVLRSEEALEPEPLLSGVRYIDGMQPDRMTPARSKVM 148

Query: 143 DKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKN 202
           + +++G  W +  L  A+ VSS VIDGLK QGV+++     +P +  P+       L   
Sbjct: 149 ELVENGMAWTRPGLAGAAGVSSSVIDGLKKQGVLEEAMLPATPPLPDPDPTLPGRKLTDL 208

Query: 203 QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAI 262
           QQ    Q+     KGF   LI GVTGSGKTEVY E VA  L   +Q LIL+PEI+LT+  
Sbjct: 209 QQGAANQLCKAIGKGFKAFLIDGVTGSGKTEVYFEAVAETLKNNEQALILIPEIALTTQF 268

Query: 263 LERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDE 322
           L RF+ RFGV+PAEWHS +    R + WR VA G + V+VG RSALFLPF +LGL+V+DE
Sbjct: 269 LNRFEDRFGVRPAEWHSQVPPKRRARTWRGVANGEVKVVVGARSALFLPFHRLGLLVVDE 328

Query: 323 EHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRY 382
           EHD +YKQ++ + YNARDM++VRG I  FPVVL SATPS+ES+VN    RY  + L  R 
Sbjct: 329 EHDTAYKQDDRVPYNARDMAVVRGHISGFPVVLASATPSVESQVNAKLGRYTKIVLPERA 388

Query: 383 RNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVC 442
             + +P ++ IDMR     +GK L+P +++ I+ TL    Q LLFLNRRGYAPLTLC+ C
Sbjct: 389 SGAEMPTIKGIDMRCDGPERGKWLAPALVNEIQQTLTNGNQVLLFLNRRGYAPLTLCRTC 448

Query: 443 GNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEV 502
           G+R  C +CS WLVEHR K KL CH CG+S      C  C +S  ++ACG G+ERIAE+V
Sbjct: 449 GHRFHCENCSAWLVEHRFKGKLVCHHCGYSQPIPDKCPECSNSDSLVACGPGVERIAEDV 508

Query: 503 CEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVD 562
              FP AR+ +LSSDL GG  R+  ++  + +GE+DI+IGTQLVAKGHNFP M+LVGVVD
Sbjct: 509 SALFPEARVLVLSSDLPGGTERINREMKLVEEGEVDIVIGTQLVAKGHNFPLMTLVGVVD 568

Query: 563 GDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFY 622
            DLGL N D R++ERTFQLL+QVTGRAGR   K  GL+Q Y P  PV++AL+SG+ + FY
Sbjct: 569 ADLGLANGDPRAAERTFQLLAQVTGRAGRIHGKGRGLLQTYNPDQPVIKALLSGNPEEFY 628

Query: 623 ESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFM 682
            +EI +RE+  LPPFGRLAA+IISG      E ++ +L  ++P S  + + GPAE+ + +
Sbjct: 629 AAEIESRENAGLPPFGRLAALIISGPDRSLTEKFSKSLAVNSPSSEGVQILGPAEAAMAL 688

Query: 683 VRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           VRGRYRFRLL    R+ +LQGF         K +  +RVQ D+DPQ+F+
Sbjct: 689 VRGRYRFRLLAIAPRSVDLQGFLRNWLSVAPKPTGGIRVQVDVDPQSFM 737


>gi|319899416|ref|YP_004159513.1| primosomal replication factor Y [Bartonella clarridgeiae 73]
 gi|319403384|emb|CBI76948.1| primosomal replication factor Y [Bartonella clarridgeiae 73]
          Length = 739

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/722 (50%), Positives = 483/722 (66%), Gaps = 19/722 (2%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSE---EKYKIDSLK-----------LR 73
           Y Y V   M+V++GS VRVP+  R + G V    E   E+ + + LK           LR
Sbjct: 19  YSYGVELHMEVKVGSFVRVPVAGREICGFVVAVGESISEEEQRNGLKRVTAVPVVRDKLR 78

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV---SALSETEKMEEKIQFTGIF 130
            + +VFDCPPL  +M  F+++ + YT +P GLVA +V+   +AL   EKM       G  
Sbjct: 79  FVTHVFDCPPLKAEMIAFLRFFSQYTMTPFGLVAGLVLRVPTALDPEEKMVGLRYLGGDV 138

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
            R+ T AR RVL   +DG IW +  L  A+  S  V+D LK+ G+ +++      VV  P
Sbjct: 139 GRL-TPARSRVLKLARDGMIWTRSGLAHAAGTSPSVVDLLKSLGIFEEVILPAQAVVAMP 197

Query: 191 NLYFSLPILDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
           +  F  P+L+  Q+     +   + +  F V L+ GVTGSGKTEVY E VA  L   KQV
Sbjct: 198 DPDFCPPVLEGAQKSAANLLREGVLSSQFQVFLLDGVTGSGKTEVYFEAVAQALKGNKQV 257

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           LILLPEI+LT   L+RF  RFG   AEWHS L+   RE++WRQVA G + V+ G RSALF
Sbjct: 258 LILLPEIALTQQFLDRFHARFGASAAEWHSDLTPRRRERVWRQVAEGKVRVVAGARSALF 317

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPF  LGLIV+DEEHD +YKQEE I Y+ARDM++ RG  E  PV+L SATPSIES+VN +
Sbjct: 318 LPFLDLGLIVVDEEHDGAYKQEERIFYHARDMAVARGSFERCPVILSSATPSIESQVNVL 377

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
             RY  VHL +R++ +ALPHLQVIDMR   + +G+ +S  +   +  TL + EQ LLFLN
Sbjct: 378 WGRYQQVHLPSRFQAAALPHLQVIDMRKGGVEKGRFISSVLEQALGKTLKKGEQALLFLN 437

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC++CG+R  C+ CS WLVEHR + +L CH CG+     ++C  CG+   ++
Sbjct: 438 RRGYAPLTLCRMCGHRFHCMDCSSWLVEHRLRGQLKCHHCGYYQPIPEACPECGTLDHLV 497

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
           ACG G+ERIAEE    FP A++ ILS+DL+GG  +L+ +L AIAKG++DIIIGTQLVAKG
Sbjct: 498 ACGPGVERIAEETRTLFPQAQLLILSTDLKGGISQLRRELEAIAKGDVDIIIGTQLVAKG 557

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           H+FP +SLVGV+D DLGL N DLR+ ERTFQLLSQVTGRAGR GL+SLGL+Q YQP HPV
Sbjct: 558 HHFPGLSLVGVIDADLGLANGDLRAGERTFQLLSQVTGRAGRMGLESLGLLQTYQPDHPV 617

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           ++AL+S   + FYE EI  R+  +LPP+GR AA+I+S  K Q  ENYA  L++ AP    
Sbjct: 618 IKALLSQQREDFYEREIAMRQHDSLPPYGRFAALIVSSEKRQAAENYARALRQVAPSMKG 677

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           + V GPAE+ L +VR RYRFRLL HG+R+ ++QGF   +     K+ +++RVQ DIDPQ+
Sbjct: 678 VSVMGPAEAQLALVRRRYRFRLLFHGRRSFDMQGFIRVVLSRAPKKPSSVRVQIDIDPQS 737

Query: 730 FL 731
           FL
Sbjct: 738 FL 739


>gi|118590573|ref|ZP_01547975.1| primosome assembly protein PriA [Stappia aggregata IAM 12614]
 gi|118437036|gb|EAV43675.1| primosome assembly protein PriA [Stappia aggregata IAM 12614]
          Length = 731

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/718 (49%), Positives = 459/718 (63%), Gaps = 5/718 (0%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +L+  AV+G Y Y VP    V  G+IV+VPL  R V+G VW + E    I+  KL+ I +
Sbjct: 15  VLVPVAVAGAYTYKVPPGKSVVPGTIVKVPLGPREVIGAVW-DIEPDAAINPKKLKTISH 73

Query: 78  VFDC-PPLSRQMCEFVKWVADYTFSPMGLVARMVV---SALSETEKMEEKIQFTGIFPRI 133
           V+D  PPL   +  FV WVA++T    G+V RMV+    AL     +    +  G  P  
Sbjct: 74  VYDTTPPLDADLRRFVDWVANWTLGAPGMVLRMVLRSEEALEPEPPVPGVRRIEGAEPDR 133

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR RVL  ++DG  W K  L  A+ VS+ VIDGL  Q V++ +    +P    P L 
Sbjct: 134 MTPARGRVLATMEDGFAWTKSGLAHAAGVSASVIDGLLQQNVLETVMMPAAPPPPKPQLD 193

Query: 194 FSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           +    L   QQ   + ++    KG  V+LI GVTGSGKTEVY E +A  L  GKQ L+LL
Sbjct: 194 YGQKPLTPAQQAAADGLMDCFGKGGTVALIDGVTGSGKTEVYFEAIAEALRRGKQTLVLL 253

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI+LT   L RF++RFGV PAEWHS ++   R ++WR VA G + V++G RSALFLPF+
Sbjct: 254 PEIALTEQFLRRFEQRFGVYPAEWHSQITVKNRSRVWRGVASGDVRVVIGARSALFLPFR 313

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
           +LGLI++DEEHD ++KQ++ + Y+ARDM++VRG +  FPVVL SATPS+ES VN    RY
Sbjct: 314 ELGLIIVDEEHDAAFKQDDRVPYSARDMAVVRGHLSGFPVVLASATPSVESIVNAEVGRY 373

Query: 374 HSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGY 433
               L  R   +ALP L  IDMR     +G+ L+P ++ GI  T A   Q+LLFLNRRGY
Sbjct: 374 KLFELPERASGAALPDLTAIDMRQDGPERGRWLAPALVHGIADTFAEGGQSLLFLNRRGY 433

Query: 434 APLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGF 493
           APLTLC+ CG+R +C HCS WLVEHR +KKL CH CGH     ++C  C S   ++ACG 
Sbjct: 434 APLTLCRTCGHRFQCAHCSAWLVEHRFQKKLVCHHCGHQEPVPKACPSCQSVDSLVACGP 493

Query: 494 GIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFP 553
           G+ERIAEEV E FP AR+ +LSSD+ GG  RL+ ++  + +G  DI+IGTQLVAKGHNFP
Sbjct: 494 GVERIAEEVSERFPQARVLVLSSDIAGGPDRLKREMKIVEEGGADIVIGTQLVAKGHNFP 553

Query: 554 RMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQAL 613
            M LVGVVD DLGL + D R++E+TFQLL+QVTGRAGR      G +Q Y   HPV++AL
Sbjct: 554 LMKLVGVVDADLGLAHGDPRAAEKTFQLLAQVTGRAGRVTGGGKGFLQTYNADHPVIRAL 613

Query: 614 VSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVF 673
           +S D  +FY++EI AR +  LPPFGRLAAVI+SG      E ++  L   AP    + + 
Sbjct: 614 LSSDKKAFYQAEIEARRAAGLPPFGRLAAVIVSGPDRAFAEGFSRALARAAPPDQAVTLL 673

Query: 674 GPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           GPAE+ L MVRGRYRFRLL    R  +LQ +         K +  LR+Q DIDPQ+FL
Sbjct: 674 GPAEAALAMVRGRYRFRLLAMAPRQYDLQAYLRHWLSTGPKPTKGLRLQVDIDPQHFL 731


>gi|254502715|ref|ZP_05114866.1| primosomal protein N', putative [Labrenzia alexandrii DFL-11]
 gi|222438786|gb|EEE45465.1| primosomal protein N', putative [Labrenzia alexandrii DFL-11]
          Length = 731

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/708 (50%), Positives = 461/708 (65%), Gaps = 5/708 (0%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVF-DCPPLSR 86
           Y Y VP+   V  G+IVRVPL +R V+G VW + E    ID  KL+ I +V+   PPL +
Sbjct: 25  YTYKVPAGQSVVPGTIVRVPLGTREVIGAVW-DGEPDAAIDPNKLKSISHVYGTTPPLDK 83

Query: 87  QMCEFVKWVADYTFSPMGLVARMVV---SALSETEKMEEKIQFTGIFPRINTVARLRVLD 143
            +  FV WVA +T    G+V RMV+    AL     +    +  G+ P   T AR RVL+
Sbjct: 84  DLRRFVDWVAGWTLGAPGMVVRMVLRSEEALEPEAPVPGVRRIEGVEPERMTPARRRVLE 143

Query: 144 KIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQ 203
            ++DG  W K  L  A+ VS+ VIDGL  Q V++ +    +P    P + ++   L   Q
Sbjct: 144 TMEDGFAWTKSGLAHAAGVSASVIDGLVQQEVLEIVSMPAAPPPPRPQIDYAQKDLTPAQ 203

Query: 204 QDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAIL 263
           Q   E++     KG AV+LI GVTGSGKTEVY E +A  L   KQ L+LLPEI+LT   L
Sbjct: 204 QAAAEKLSESFDKGAAVTLIDGVTGSGKTEVYFEAIAETLRRDKQALVLLPEIALTEQFL 263

Query: 264 ERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEE 323
            RF++RFGV PAEWHS ++   R ++WR VA G + V++G RS+LFLPFK+LGLI++DEE
Sbjct: 264 RRFEQRFGVYPAEWHSEITPKNRARVWRGVASGDVRVVIGARSSLFLPFKELGLIIVDEE 323

Query: 324 HDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYR 383
           HD ++KQ++ + Y+ARDM++VRG I  FPVVL SATPSIESRVN    RY  V L  R  
Sbjct: 324 HDAAFKQDDRVPYSARDMAVVRGHISRFPVVLASATPSIESRVNAEQGRYGLVELPDRAS 383

Query: 384 NSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCG 443
            +ALP L  IDMR     QG+ L+P ++  I+ T A  +Q LLFLNRRGYAPLTLC+ CG
Sbjct: 384 GAALPDLSAIDMRLDGPEQGRWLAPGLVGAIKETYANGDQALLFLNRRGYAPLTLCRTCG 443

Query: 444 NRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVC 503
           +R +C HCS WLVEHR +KKL CH CGH+    +SC  C S+  ++ACG G+ERIAEEV 
Sbjct: 444 HRFQCPHCSTWLVEHRFQKKLVCHHCGHNERVPESCPSCQSTNTLVACGPGVERIAEEVS 503

Query: 504 EYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDG 563
           + FP AR  +LSSDL GG  RL+ ++  + +G  DIIIGTQLVAKGHNFP++ LVGVVD 
Sbjct: 504 DLFPQARTLVLSSDLPGGPERLKREMKVVEEGGADIIIGTQLVAKGHNFPKLKLVGVVDA 563

Query: 564 DLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYE 623
           DLGL + D R++E+TFQLL+QVTGRAGR      G +Q Y   HPV++AL+S D  +FY+
Sbjct: 564 DLGLAHGDPRAAEKTFQLLAQVTGRAGRVAGGGKGFLQTYSADHPVIKALLSNDKHAFYQ 623

Query: 624 SEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMV 683
           +EI AR +  LPPFGRLAAV+ISG      E +A  L   AP    + + GPAE+ L MV
Sbjct: 624 AEIEARRAAGLPPFGRLAAVVISGPDRNFAEGFARQLARVAPPDQAVTLLGPAEAALAMV 683

Query: 684 RGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           RGRYRFRLL    +  +LQ +      +  K +  LRVQ DIDPQ+FL
Sbjct: 684 RGRYRFRLLAMAPKQYDLQSYIRGWLSSGPKPTKGLRVQIDIDPQHFL 731


>gi|298293262|ref|YP_003695201.1| primosomal protein N' [Starkeya novella DSM 506]
 gi|296929773|gb|ADH90582.1| primosomal protein N' [Starkeya novella DSM 506]
          Length = 729

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/721 (46%), Positives = 465/721 (64%), Gaps = 3/721 (0%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR 73
           S V +LL  AV   Y Y VP  M+V  G IV VPL  R +LG VW  +E    +D  KL+
Sbjct: 9   SVVDVLLPVAVGSAYSYRVPEGMEVAPGDIVVVPLGPRMMLGCVWPPAENPKPVDPAKLK 68

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEK--IQFTGIFP 131
           PI   +D   LS  M  F++W+ADYT +P G+V R+ +          E+  ++ T   P
Sbjct: 69  PIHRKYDVASLSPAMLAFIRWIADYTVTPPGMVLRLALRHDESAGISRERTGVRLTDQRP 128

Query: 132 RINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPN 191
           +  T AR RV++ + DG +  K D  R + VS  V+DGL   GV++ +     P  + P+
Sbjct: 129 QRRTAARERVIEALADGFVRSKTDAAREAGVSPSVVDGLVDDGVLETVVLPPEPAAERPD 188

Query: 192 LYFSLPILDKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
              S P L   Q+D  +++V  +  + F   LI GVTGSGKTE Y E VA  +  G+QVL
Sbjct: 189 PDHSAPELLPAQRDAADRLVEAVKARAFRPYLIDGVTGSGKTETYFEAVAETIRQGRQVL 248

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           IL+PEI+LT A L+RF +RFGVKPAEWHS++ T  R ++++ V+ G +SV+ G RSALFL
Sbjct: 249 ILMPEIALTQAFLDRFARRFGVKPAEWHSAVGTKRRGRVFKGVSSGEVSVVAGARSALFL 308

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PF+ LGL+++DEEHD +YKQE+G+ Y+ARDM++VR ++E  PVVLVSATPSIE+ VN   
Sbjct: 309 PFRDLGLVIVDEEHDSAYKQEDGVHYHARDMAVVRARLEEAPVVLVSATPSIETEVNARR 368

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            RY  +HL  R+  + +P L+ ID+R +   +G+ ++P +   +  T+    Q LLFLNR
Sbjct: 369 GRYSRLHLPERFAGTKVPRLEPIDLRKEGPPRGQWIAPRLAAEMERTIEAGGQALLFLNR 428

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPLTLC+ CG+R++C  CS WLVEHR +++L CHQCG++      C  C     +I 
Sbjct: 429 RGYAPLTLCRACGHRIRCPSCSSWLVEHRFRRRLECHQCGYATPVPNECPNCHEPNSLIP 488

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
           CG G+ER+ EEV +  P AR+ +LSSDL GG  RL+ +L AI  G +D+I+GTQLVAKGH
Sbjct: 489 CGPGVERLHEEVAKLMPNARLQVLSSDLAGGVERLRAELKAIEDGAVDVIVGTQLVAKGH 548

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           NFP ++LVGV+D D+GL + D R++ERTFQLL QV GRAGR   +    +Q Y P HPVM
Sbjct: 549 NFPGLALVGVIDADVGLGHGDPRAAERTFQLLHQVAGRAGRHEKEGRAFLQTYMPEHPVM 608

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
           QALV+GD D+FY+ EI  RE  +LPPF R  A+I+SGT     + +A  L   +P S+++
Sbjct: 609 QALVAGDRDAFYDREIGVREEAHLPPFARFCALIVSGTDAHAAQAHARALAACSPLSNEV 668

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            V GPAE+PL +VRGR+R+RLL    R  +L  +         + +  LRV+ DIDPQ+F
Sbjct: 669 RVLGPAEAPLALVRGRHRYRLLARSDRGFDLSNYVRAWMAGAPRATGNLRVEIDIDPQSF 728

Query: 731 L 731
           L
Sbjct: 729 L 729


>gi|170747273|ref|YP_001753533.1| primosome assembly protein PriA [Methylobacterium radiotolerans JCM
           2831]
 gi|170653795|gb|ACB22850.1| primosomal protein N' [Methylobacterium radiotolerans JCM 2831]
          Length = 729

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/728 (47%), Positives = 458/728 (62%), Gaps = 19/728 (2%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           IL+  A+  PY Y  P+ + +  G +V+VPL  R ++G+VW  +E         LRP+  
Sbjct: 7   ILIPLALDTPYSYVAPAGLDLAAGDVVQVPLGPREIVGVVWGVAETP---GGSNLRPVTG 63

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV-----SALSETEKMEEKIQFTGIFPR 132
               PPLS  +   V W+A YT +P G    MV+     +A  ET ++   ++ T   P 
Sbjct: 64  RLPYPPLSDPLRSLVDWIARYTLAPKGSALAMVLRLPDEAAAGETARV--AVRLTDKPPS 121

Query: 133 INTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNL 192
             T AR +VL    DG +  K  L + + VS  V+DGL   GV++ +     PV   P+ 
Sbjct: 122 RPTPARTKVLAAAADGALRGKSALAKEAGVSLSVVDGLIDDGVLETVAVEPEPVAPRPDP 181

Query: 193 YFSLPILDKNQQDVVEQVV---------PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVL 243
            F    L   Q + V  +V         P         L+ GVTGSGKTEVY E VAA +
Sbjct: 182 DFPRAPLSPAQAEAVSALVAPFPWDRPQPQEADDLRPVLLEGVTGSGKTEVYFEAVAACI 241

Query: 244 HLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVG 303
             G+Q LIL+PEI+LT+  L+RF  RFGV+PA WHS +    RE++   VA G   V+VG
Sbjct: 242 RAGRQALILMPEIALTAQFLDRFAARFGVRPAAWHSGIGGRRRERLRAAVAEGEALVVVG 301

Query: 304 VRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIE 363
            RSALFLPF +LGLIV+DEEH+ +YKQE+G+ Y+ARDM++VRG++E  PVVL SATP+IE
Sbjct: 302 ARSALFLPFARLGLIVVDEEHETAYKQEDGVHYHARDMAVVRGRLEGCPVVLTSATPAIE 361

Query: 364 SRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQ 423
           +RVN    RY  V L  R+    LP +  IDMR     +G+ LSP +++ ++ TL R EQ
Sbjct: 362 TRVNAARGRYRHVLLPERFGGRRLPDIAAIDMRLDQPERGRFLSPPLVNAVKSTLERGEQ 421

Query: 424 TLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCG 483
            LLFLNRRGYAPLTLC+ CG+R +C +CS WLVEHR ++ L CHQCG++    ++C  CG
Sbjct: 422 ALLFLNRRGYAPLTLCRACGHRYQCKNCSTWLVEHRFRRALVCHQCGYAERRPEACTECG 481

Query: 484 SSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGT 543
           +   + ACG G+ERIAEE  E FP  RI +LSSD  GG  RL+ +L A+A GE D++IGT
Sbjct: 482 TFDNLTACGPGVERIAEEAAEMFPDRRIVVLSSDFPGGAERLRQELDAVAAGECDVVIGT 541

Query: 544 QLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAY 603
           QLVAKGHNFP ++LVGV+D D+GLT+ D R++ERTFQLL QVTGRAGR       L+Q Y
Sbjct: 542 QLVAKGHNFPFLTLVGVLDADIGLTSGDPRAAERTFQLLQQVTGRAGRGEKPGRALVQTY 601

Query: 604 QPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEH 663
           QP HPV+ AL+SGDA+ FY  EI+ARE+  LPPFGRLAA+I+S ++ +  E +   L   
Sbjct: 602 QPDHPVIAALLSGDAERFYAEEIQAREAAGLPPFGRLAALIVSASEREVAEAHGQALARA 661

Query: 664 APRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQF 723
           A     ++V GPAE+PL +VRGRYRFRLL+  +RN +LQ +         K    +RV  
Sbjct: 662 AEPPEGVMVLGPAEAPLALVRGRYRFRLLVKTERNVDLQAYLRAWIARGPKVRGNVRVAI 721

Query: 724 DIDPQNFL 731
           D+DPQ+FL
Sbjct: 722 DVDPQSFL 729


>gi|188580582|ref|YP_001924027.1| primosome assembly protein PriA [Methylobacterium populi BJ001]
 gi|179344080|gb|ACB79492.1| primosomal protein N' [Methylobacterium populi BJ001]
          Length = 725

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/722 (47%), Positives = 460/722 (63%), Gaps = 11/722 (1%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           IL+  A+   Y Y+VP+ + +  G IV+VPL  R  +G+VW   E   +     LRP+  
Sbjct: 7   ILIPLALDTAYSYAVPAGLDLAAGDIVQVPLGPRETIGVVWGLDE---RASGGNLRPVTG 63

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEK---IQFTGIFPRIN 134
             + PPLS  + + V W+A YT +P G    M +    ET + E     ++ +G  P   
Sbjct: 64  RVEAPPLSESLRKLVDWLARYTLAPKGSALAMALRLPDETARNEAPRIGVRPSGKPPARQ 123

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNL-Y 193
           TVAR +V+    DG +  K  L + + VS  V+DGL   G ++ +  +  PV   P+  +
Sbjct: 124 TVARGKVMAVAADGAVRGKSVLAKEAGVSLSVVDGLIDDGALETVALMPEPVALPPDPDH 183

Query: 194 FSLPILDKNQQDVVEQVVPLCTKGFAVS----LISGVTGSGKTEVYLEIVAAVLHLGKQV 249
             +P+ +   +     +         V+    L+ GVTGSGKTEVY E VA  +  G+Q 
Sbjct: 184 PRVPLSEAQAEAAHALIANAAAPAETVTGETVLLEGVTGSGKTEVYFEAVAECVRQGRQA 243

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           L+L+PEI+LT+  L+RF  RFGV+PA WHS +    RE++   VA G +SV+VG RSALF
Sbjct: 244 LVLMPEIALTAQFLDRFAGRFGVRPATWHSGIGGKRRERLRAGVAAGEVSVVVGARSALF 303

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPF+ LGLIV+DEEH+ +YKQE+G+ Y+ARDM++VRGKIE  PVVL SATPSIESRVN  
Sbjct: 304 LPFRNLGLIVVDEEHETAYKQEDGVHYHARDMAVVRGKIEGCPVVLASATPSIESRVNAQ 363

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
           S RY  V L  R+    LP +  IDMR     +G+ LSP M++ ++ TLA  +Q LLFLN
Sbjct: 364 SGRYRHVVLPGRFGGRPLPDIAAIDMRLDKPERGRFLSPPMVNAVKSTLASGDQALLFLN 423

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC+ CG+R +C +CS WLVEHR ++ L CHQCG++    ++C  CG+   + 
Sbjct: 424 RRGYAPLTLCRACGHRYQCRNCSTWLVEHRFRRALVCHQCGYAERKPEACTECGAFDHLT 483

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
            CG G+ERIAEEV E FP  RI +LSSD  GG  RL+ +L  +A GE DI+IGTQLVAKG
Sbjct: 484 PCGPGVERIAEEVTELFPEQRIVVLSSDFPGGAERLRQELETVAAGECDIVIGTQLVAKG 543

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           HNFP ++LVGV+D D+GLT+ D R++ERTFQLL QVTGRAGR       L+Q YQP HPV
Sbjct: 544 HNFPHLTLVGVLDADIGLTSGDPRAAERTFQLLQQVTGRAGRGERPGRALVQTYQPEHPV 603

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           + AL+SGDAD FYE EI ARE+  LPPFGRLAA+I+S  + ++ E +   L   A   + 
Sbjct: 604 IAALLSGDADRFYEEEIWAREAAGLPPFGRLAALIVSAEEREKAEAHGQGLARVADPPAG 663

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           + V GPAE+PL +VRGR+RFRLL+  +R  ++Q +         K    L+V  D+DPQ+
Sbjct: 664 VTVLGPAEAPLALVRGRWRFRLLVKTERGIDVQSYLRDWLARGPKPRGNLKVAIDVDPQS 723

Query: 730 FL 731
           FL
Sbjct: 724 FL 725


>gi|163850443|ref|YP_001638486.1| primosome assembly protein PriA [Methylobacterium extorquens PA1]
 gi|163662048|gb|ABY29415.1| primosomal protein N' [Methylobacterium extorquens PA1]
          Length = 725

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/722 (46%), Positives = 458/722 (63%), Gaps = 11/722 (1%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           IL+  A+   Y Y+VP+ + +  G IV+VPL  R  +G+VW   E   +     LRP+  
Sbjct: 7   ILIPLALDTAYSYAVPAGLTLAEGDIVQVPLGPRETIGVVWGLDE---RASGGNLRPVTG 63

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEK---IQFTGIFPRIN 134
             + PPLS  + + V W+A YT +P G    M +    E  + E     ++  G  P   
Sbjct: 64  KVEAPPLSESLRKLVDWLARYTLAPKGSALAMALRLPDEAARNEAPRVGVRAAGKPPTRQ 123

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNL-Y 193
           TVAR +V+    D  +  K  L + + VS  V+DGL   G ++ +  +  PV   P+  +
Sbjct: 124 TVARGKVMAVAADNAVRGKSALAKEAGVSLSVVDGLIDDGALETVALMPEPVALPPDPDH 183

Query: 194 FSLPILDKNQQD----VVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
             +P+ D   +     + +   P  T      L+ GVTGSGKTEVY E VA  +  G+Q 
Sbjct: 184 PRVPLSDAQAEAAHALIADAPSPADTATGETILLEGVTGSGKTEVYFEAVAECVRQGRQA 243

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           L+L+PEI+LT+  L+RF  RFGV+PA WHS +    RE++   VA G +SV+VG RSALF
Sbjct: 244 LVLMPEIALTAQFLDRFAGRFGVRPATWHSGIGGKRRERLRAGVAAGEVSVVVGARSALF 303

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPF+ LGLIV+DEEH+ +YKQE+G+ Y+ARDM++VRGKIE  PVVL SATPSIESRVN  
Sbjct: 304 LPFRNLGLIVVDEEHESAYKQEDGVHYHARDMAVVRGKIEGCPVVLASATPSIESRVNAQ 363

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
           S RY  V L  R+    +P +  IDMR     +G+ LSP M++ ++ TLA  +Q LLFLN
Sbjct: 364 SGRYRHVVLPGRFGGRPMPDIAAIDMRLDKPERGRFLSPPMVNAVKSTLAAGDQALLFLN 423

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC+ CG+R +C +CS WLVEHR ++ L CHQCG++    ++C  CG+   + 
Sbjct: 424 RRGYAPLTLCRACGHRYQCRNCSTWLVEHRFRRALVCHQCGYAERKPEACTECGAFDHLT 483

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
            CG G+ERIAEEV E FP  RI +LSSD  GG  RL+ +L  +A G+ DI++GTQLVAKG
Sbjct: 484 PCGPGVERIAEEVTELFPEQRIVVLSSDFPGGAERLRQELETVAAGDCDIVVGTQLVAKG 543

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           HNFP ++LVGV+D D+GLT+ D R++ERTFQLL QVTGRAGR       L+Q YQP HPV
Sbjct: 544 HNFPHLTLVGVLDADIGLTSGDPRAAERTFQLLQQVTGRAGRGERPGRALVQTYQPEHPV 603

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           + AL+SGDAD FYE EI ARE+  LPPFGRLAA+I+SG + ++ E +   L   A     
Sbjct: 604 IAALLSGDADRFYEEEIWAREAAGLPPFGRLAALIVSGEEREKAEAHGQALARVAEPPPG 663

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           + V GPAE+PL ++RGR+RFRLL+  +R  ++Q +         K    L+V  D+DPQ+
Sbjct: 664 VSVLGPAEAPLALIRGRWRFRLLVKTERGIDVQSYLRDWLARGPKPRGNLKVAIDVDPQS 723

Query: 730 FL 731
           FL
Sbjct: 724 FL 725


>gi|154245996|ref|YP_001416954.1| primosome assembly protein PriA [Xanthobacter autotrophicus Py2]
 gi|154160081|gb|ABS67297.1| primosomal protein N' [Xanthobacter autotrophicus Py2]
          Length = 727

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/722 (45%), Positives = 457/722 (63%), Gaps = 6/722 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW---YNSEEKYKIDSLKL 72
           V +LL   +  PY Y VP  M +  G +V VPL +R ++G VW           +D  KL
Sbjct: 6   VDVLLPLGLDTPYSYLVPEGMTLSPGDLVHVPLGARGMIGCVWPRPAGGGSGKPVDVAKL 65

Query: 73  RPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKI--QFTGIF 130
           + ++   D  PL   + + V W+ADYT +P G+V RM +          E++  + +G  
Sbjct: 66  KAVKAKLDYVPLPPDLLKLVDWMADYTLAPRGMVLRMALRHGESPGAGRERVGVRVSGPA 125

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
           P   T AR R+LD + DG +  K +  R + VS  V+DGL  +G ++ +     P    P
Sbjct: 126 PARMTAARARLLDLLADGFVRGKSEAAREAGVSPSVVDGLVDEGALETVVLPPEPAAYPP 185

Query: 191 NLYFSLPILDKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
           +  F+ P L + Q      +   +  +GF V L+ GVTGSGKTEVY E VA  +  G+Q 
Sbjct: 186 DPTFATPTLSEPQAQAAHALSGAVDARGFGVFLLDGVTGSGKTEVYFEAVAQAIRDGRQA 245

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           LILLPEI+LT A L+RF  RFGVKPAEWHS +ST  R +I  +VA G + V+ G RSALF
Sbjct: 246 LILLPEIALTQAFLDRFTTRFGVKPAEWHSGVSTRRRGRILNEVASGQVKVVAGARSALF 305

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPF+ LGLI++DEEHD +YKQE+G+ Y+ARDM++VR ++ S P+VL SATPSIE+ VN  
Sbjct: 306 LPFRDLGLIIVDEEHDPAYKQEDGVAYHARDMAVVRARLASAPIVLASATPSIETEVNAR 365

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
             RYH + L  R+  + +P L  ID+R +   +G+ ++P +   I  TL    Q LLFLN
Sbjct: 366 RGRYHRLALPVRFGGAKVPGLLPIDLRKEGPPKGRWIAPRLEAEITDTLEAGGQALLFLN 425

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC  CG+R++C  C+ WLVEHR +++L CH CG+ A   ++C  CG+   +I
Sbjct: 426 RRGYAPLTLCHSCGHRMRCPSCTAWLVEHRFRRRLTCHHCGYQAPVPEACPACGAKDSLI 485

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
             G G+ER+ EEV   FP AR  +LSSDL GG  R++ +L A+AKGE+D+++GTQLVAKG
Sbjct: 486 PVGPGVERLQEEVQALFPAARSLVLSSDLAGGVERMRAELDAVAKGEVDVVVGTQLVAKG 545

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           HNFP ++LVGVVD D+GL   D R++ERTFQL+ QV GRAGR   +  G IQ + P HPV
Sbjct: 546 HNFPGLALVGVVDADVGLGQGDPRAAERTFQLVHQVAGRAGRGKTEGRGFIQTHMPEHPV 605

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           M+ALV+GD D+FY++EI ARE   LPPFGR+A++I+S ++    E +A  L   AP  + 
Sbjct: 606 MRALVTGDRDAFYDTEIAAREEAQLPPFGRMASLIVSASEGHVAEGHARRLAASAPLVAG 665

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           + + GPAE+PL ++RGR+R+RLL+   R  +L  +         K +  +RV  D+DPQ+
Sbjct: 666 VRILGPAEAPLAILRGRHRWRLLVRAPRAFDLSRYLRDWRATAPKVTGNIRVAIDVDPQS 725

Query: 730 FL 731
           F 
Sbjct: 726 FF 727


>gi|254559976|ref|YP_003067071.1| primosome factor N' [Methylobacterium extorquens DM4]
 gi|254267254|emb|CAX23086.1| Primosome factor N' (replication factor Y) [Methylobacterium
           extorquens DM4]
          Length = 725

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/722 (46%), Positives = 454/722 (62%), Gaps = 11/722 (1%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           IL+  A+   Y Y+VP+ + +  G IV+VPL  R  +G+VW   E   +     LRP+  
Sbjct: 7   ILIPLALDTAYSYAVPAGLTLAEGDIVQVPLGPRETIGVVWGLDE---RASGGNLRPVTG 63

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEK---IQFTGIFPRIN 134
             + PPLS  + + V W+A YT +P G    M +    E  + E     ++  G  P   
Sbjct: 64  KIEAPPLSESLRKLVDWLARYTLAPKGSALAMALRLPDEAARNEAPRVGVRAAGKPPTRQ 123

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           TVAR +V+    D  +  K  L + + VS  V+DGL   G ++ +  +  PV   P+   
Sbjct: 124 TVARGKVMAVAADNAVRGKSALAKEAGVSLSVVDGLIDDGALETVALMPEPVALPPDPDH 183

Query: 195 SLPILDKNQQDVVEQVV-----PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
               L   Q +    ++     P         L+ GVTGSGKTEVY E VA  +  G+Q 
Sbjct: 184 PRVPLSDAQAEAAHALIANAPSPTDAATGETILLEGVTGSGKTEVYFEAVAECVRQGRQA 243

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           L+L+PEI+LT+  L+RF  RFGV+PA WHS +    RE++   VA G +SV+VG RSALF
Sbjct: 244 LVLMPEIALTAQFLDRFAGRFGVRPATWHSGIGGKRRERLRAGVAAGEVSVVVGARSALF 303

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPF+ LGLIV+DEEH+ +YKQE+G+ Y+ARDM++VRGKIE  PVVL SATPSIESRVN  
Sbjct: 304 LPFRNLGLIVVDEEHESAYKQEDGVHYHARDMAVVRGKIEGCPVVLASATPSIESRVNAQ 363

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
           S RY  V L  R+    +P +  IDMR     +G+ LSP M++ ++ TLA  +Q LLFLN
Sbjct: 364 SGRYRHVVLPGRFGGRPMPDIAAIDMRLDKPERGRFLSPPMVNAVKSTLAAGDQALLFLN 423

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC+ CG+R +C +CS WLVEHR ++ L CHQCG++    ++C  CG+   + 
Sbjct: 424 RRGYAPLTLCRACGHRYQCRNCSTWLVEHRFRRALVCHQCGYAERKPEACTECGAFDHLT 483

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
            CG G+ERIAEEV E FP  RI +LSSD  GG  RL+ +L  +A G+ DI++GTQLVAKG
Sbjct: 484 PCGPGVERIAEEVTELFPEQRIVVLSSDFPGGAERLRQELETVAAGDCDIVVGTQLVAKG 543

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           HNFP ++LVGV+D D+GLT+ D R++ERTFQLL QVTGRAGR       L+Q YQP HPV
Sbjct: 544 HNFPHLTLVGVLDADIGLTSGDPRAAERTFQLLQQVTGRAGRGERPGRALVQTYQPEHPV 603

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           + AL+SGDAD FYE EI ARE+  LPPFGRLAA+I+SG + ++ E +   L   A     
Sbjct: 604 IAALLSGDADRFYEEEIWAREAAGLPPFGRLAALIVSGEEREKAEAHGQALARVAEPPPG 663

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           + V GPAE+PL ++RGR+RFRLL+  +R  ++Q +         K    L+V  D+DPQ+
Sbjct: 664 VSVLGPAEAPLALIRGRWRFRLLVKTERGIDVQSYLRDWLARGPKPRGNLKVAIDVDPQS 723

Query: 730 FL 731
           FL
Sbjct: 724 FL 725


>gi|240137852|ref|YP_002962324.1| Primosome factor N' (replication factor Y) [Methylobacterium
           extorquens AM1]
 gi|240007821|gb|ACS39047.1| Primosome factor N' (replication factor Y) [Methylobacterium
           extorquens AM1]
          Length = 725

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/722 (46%), Positives = 454/722 (62%), Gaps = 11/722 (1%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           IL+  A+   Y Y+VP+ + +  G IV+VPL  R  +G+VW   E   +     LRP+  
Sbjct: 7   ILIPLALDTAYSYAVPAGLTLAEGDIVQVPLGPRETIGVVWGLDE---RASGGNLRPVTG 63

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEK---IQFTGIFPRIN 134
             + PPLS  + + V W+A YT +P G    M +    E  + E     ++  G  P   
Sbjct: 64  KVEAPPLSESLRKLVDWLARYTLAPKGSALAMALRLPDEAARNEAPRVGVRAAGKPPTRQ 123

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           TVAR +V+    D  +  K  L + + VS  V+DGL   G ++ +  +  PV   P+   
Sbjct: 124 TVARGKVMAVAADNAVRGKSALAKEAGVSLSVVDGLIDDGALETVALMPEPVALPPDPDH 183

Query: 195 SLPILDKNQQDVVEQVVPLCTKGFAVS-----LISGVTGSGKTEVYLEIVAAVLHLGKQV 249
               L   Q +    ++         +     L+ GVTGSGKTEVY E VA  +  G+Q 
Sbjct: 184 PRVPLSDAQAEAAHALIADAPSPADAATGETILLEGVTGSGKTEVYFEAVAECVRQGRQA 243

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           L+L+PEI+LT+  L+RF  RFGV+PA WHS +    RE++   VA G +SV+VG RSALF
Sbjct: 244 LVLMPEIALTAQFLDRFAGRFGVRPATWHSGIGGKRRERLRAGVAAGEVSVVVGARSALF 303

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPF+ LGLIV+DEEH+ +YKQE+G+ Y+ARDM++VRGKIE  PVVL SATPSIESRVN  
Sbjct: 304 LPFRNLGLIVVDEEHESAYKQEDGVHYHARDMAVVRGKIEGCPVVLASATPSIESRVNAQ 363

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
           S RY  V L  R+    +P +  IDMR     +G+ LSP M++ ++ TLA  +Q LLFLN
Sbjct: 364 SGRYRHVVLPGRFGGRPMPDIAAIDMRLDKPERGRFLSPPMVNAVKSTLAAGDQALLFLN 423

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC+ CG+R +C +CS WLVEHR ++ L CHQCG++    ++C  CG+   + 
Sbjct: 424 RRGYAPLTLCRACGHRYQCRNCSTWLVEHRFRRALVCHQCGYAERKPEACTECGAFDHLT 483

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
            CG G+ERIAEEV E FP  RI +LSSD  GG  RL+ +L  +A G+ DI++GTQLVAKG
Sbjct: 484 PCGPGVERIAEEVTELFPEQRIVVLSSDFPGGAERLRQELETVAAGDCDIVVGTQLVAKG 543

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           HNFP ++LVGV+D D+GLT+ D R++ERTFQLL QVTGRAGR       L+Q YQP HPV
Sbjct: 544 HNFPHLTLVGVLDADIGLTSGDPRAAERTFQLLQQVTGRAGRGERPGRALVQTYQPEHPV 603

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           + AL+SGDAD FYE EI ARE+  LPPFGRLAA+I+SG + ++ E +   L   A     
Sbjct: 604 IAALLSGDADRFYEEEIWAREAAGLPPFGRLAALIVSGEEREKAEAHGQALARVAEPPPG 663

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           + V GPAE+PL ++RGR+RFRLL+  +R  ++Q +         K    L+V  D+DPQ+
Sbjct: 664 VSVLGPAEAPLALIRGRWRFRLLVKTERGIDVQSYLRDWLARGPKPRGNLKVAIDVDPQS 723

Query: 730 FL 731
           FL
Sbjct: 724 FL 725


>gi|218528789|ref|YP_002419605.1| primosome assembly protein PriA [Methylobacterium chloromethanicum
           CM4]
 gi|218521092|gb|ACK81677.1| primosomal protein N' [Methylobacterium chloromethanicum CM4]
          Length = 725

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/722 (46%), Positives = 453/722 (62%), Gaps = 11/722 (1%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           IL+  A+   Y Y+VP+ + +  G IV+VPL  R  +G+VW   E   +     LRP+  
Sbjct: 7   ILIPLALDTAYSYAVPAGLTLAEGDIVQVPLGPRETIGVVWGLDE---RASGGNLRPVTG 63

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEK---IQFTGIFPRIN 134
             + PPLS  + + V W+A YT +P G    M +    E  + E     ++  G  P   
Sbjct: 64  KVETPPLSASLRKLVDWLARYTLAPKGSALAMALRLPDEAARNEAPRVGVRAAGKPPTRQ 123

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           TVAR +V+    D  +  K  L + + VS  V+DGL   G ++ +  +  PV   P+   
Sbjct: 124 TVARGKVMAVAADNAVRGKSALAKEAGVSLSVVDGLIDDGALETVALMPEPVALPPDPDH 183

Query: 195 SLPILDKNQQDVVEQVVPLCTKGFAVS-----LISGVTGSGKTEVYLEIVAAVLHLGKQV 249
               L   Q +    ++         +     L+ GVTGSGKTEVY E VA  +  G+Q 
Sbjct: 184 PRVPLSDAQAEAAHALIADAPSPADAATGETILLEGVTGSGKTEVYFEAVAECVRQGRQA 243

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           L+L+PEI+LT+  L+RF  RFGV+PA WHS +    RE++   VA G +SV+VG RSALF
Sbjct: 244 LVLMPEIALTAQFLDRFAGRFGVRPATWHSGIGGKRRERLRAGVAAGEVSVVVGARSALF 303

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPF+ LGLIV+DEEH+ +YKQE+G+ Y+ARDM++VRGKIE  PVVL SATPSIESRVN  
Sbjct: 304 LPFRNLGLIVVDEEHESAYKQEDGVHYHARDMAVVRGKIEGCPVVLASATPSIESRVNAQ 363

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
           S RY  V L  R+    +P +  IDMR     +G+ LSP M++ ++ TLA  +Q LLFLN
Sbjct: 364 SGRYRHVVLPGRFGGRPMPDIAAIDMRLDKPERGRFLSPPMVNAVKSTLAAGDQALLFLN 423

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC+ CG+R +C +CS WLVEHR ++ L CHQCG++    ++C  CG+   + 
Sbjct: 424 RRGYAPLTLCRACGHRYQCRNCSTWLVEHRFRRALVCHQCGYAERKPEACTECGAFDHLT 483

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
            CG G+ERIAEEV E FP  RI +LSSD  GG  RL+ +L  +A G+ DI++GTQLVAKG
Sbjct: 484 PCGPGVERIAEEVTELFPEQRIVVLSSDFPGGAERLRQELETVAAGDCDIVVGTQLVAKG 543

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           HNFP ++LVGV+D D+GLT+ D R++ERTFQLL QVTGRAGR       L+Q YQP HPV
Sbjct: 544 HNFPHLTLVGVLDADIGLTSGDPRAAERTFQLLQQVTGRAGRGERPGRALVQTYQPEHPV 603

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           + AL+SGDAD FYE EI ARE   LPPFGRLAA+I+SG + ++ E +   L   A     
Sbjct: 604 IAALLSGDADRFYEEEIWAREVAGLPPFGRLAALIVSGEEREKAEAHGQALARVAEPPPG 663

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           + V GPAE+PL ++RGR+RFRLL+  +R  ++Q +         K    L+V  D+DPQ+
Sbjct: 664 VSVLGPAEAPLALIRGRWRFRLLVKTERGIDVQSYLRDWLARGPKPRGNLKVAIDVDPQS 723

Query: 730 FL 731
           FL
Sbjct: 724 FL 725


>gi|300024724|ref|YP_003757335.1| primosomal protein N' [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526545|gb|ADJ25014.1| primosomal protein N' [Hyphomicrobium denitrificans ATCC 51888]
          Length = 744

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/726 (48%), Positives = 462/726 (63%), Gaps = 14/726 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYK-IDSLKLRP 74
           V +L+  A+   Y Y VP  ++V  GS V VP   +T +GIVW       K +D  KL+ 
Sbjct: 23  VPVLMPVALDQTYDYLVPDGVEVPPGSFVLVPFGPQTRIGIVWDGQRGDGKAVDPKKLKS 82

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEK-----IQFTGI 129
           +  + D P L      F +WVA YT +P+G+VARM++SA +  E  + +     ++   +
Sbjct: 83  LTSLIDAPRLPEISMRFAEWVARYTLAPLGMVARMMMSADAAFEPPKHRFGVRLVEGAPL 142

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISP--VV 187
            P++ T AR RVL+   DG I  K DL   +  S+ VIDGL A G    + EV  P  V 
Sbjct: 143 PPKM-TQARTRVLEIAADGLIRVKSDLANLAACSTGVIDGLAASG---NLVEVAIPERVF 198

Query: 188 DSPN-LYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
             P   + +    DK  Q V   V  +  K F+V+L+ GVTGSGKTEVY E VA  L +G
Sbjct: 199 PRPQPAHATTDFTDKQAQAVATLVAAVDAKNFSVTLLDGVTGSGKTEVYFEAVARALEVG 258

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
            Q LI+LPEI+LTS  L+RF +RFG  P EWHS+LS + R +IW+ VARG +  +VG RS
Sbjct: 259 DQALIMLPEIALTSQFLDRFAQRFGAPPVEWHSALSPAERGRIWKGVARGDVRCVVGARS 318

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLPF +LGLIVIDEEHD  +KQE+ + Y ARDM++VRG +  FPVVL SATPSIES V
Sbjct: 319 ALFLPFVQLGLIVIDEEHDQGFKQEDRVHYQARDMAVVRGNLGKFPVVLASATPSIESHV 378

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N +  RY    L  R+   A+P + +ID++ + +  GK L+  ++  I  TL +++QTLL
Sbjct: 379 NALVGRYRHAVLPGRFSGVAMPDVSLIDLKAEKLEPGKWLAQRLVGAITETLEKDQQTLL 438

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRGYAPLTLC+ CG+RL+C  C+ WLVEHR KKKL CH CG S    + C  CG  G
Sbjct: 439 FLNRRGYAPLTLCRACGHRLECPQCTAWLVEHRFKKKLTCHHCGFSLSLPEKCPKCGEPG 498

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
            ++ACG G+ER+ EEV E FP AR+++LSSDL  G   ++  +  I   E DIIIGTQ+V
Sbjct: 499 TLVACGPGVERVQEEVKERFPDARVALLSSDLIPGLAEMREIIRGIEAREFDIIIGTQIV 558

Query: 547 AKGHNFPRMSLVGVVDGDLGLTN-ADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQP 605
           AKGHNFP ++LVGVVDGDLGL + AD RS+ERTFQLL QVTGRAGR      G +Q Y  
Sbjct: 559 AKGHNFPGLALVGVVDGDLGLAHGADPRSAERTFQLLHQVTGRAGRTSFVGRGFVQTYST 618

Query: 606 THPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAP 665
            HPVMQA+V+GD D+F   E++ R+S  LPP+GRLAA++IS       E  A ++   AP
Sbjct: 619 DHPVMQAIVAGDRDAFLNYEVKTRQSGLLPPYGRLAAIVISARDKALTEVTARDIARRAP 678

Query: 666 RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDI 725
           +S  I V GP E+P+ +VRGR+R+RLL+   R+ +LQ +         K  + +R+  DI
Sbjct: 679 QSEVISVLGPVEAPIAVVRGRHRWRLLVKAPRDVDLQAYLRAWAGTIPKLKSDVRITVDI 738

Query: 726 DPQNFL 731
           DP NFL
Sbjct: 739 DPYNFL 744


>gi|146337559|ref|YP_001202607.1| primosome assembly protein PriA [Bradyrhizobium sp. ORS278]
 gi|146190365|emb|CAL74361.1| Primosomal protein N' (replication factor Y) [Bradyrhizobium sp.
           ORS278]
          Length = 736

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/721 (46%), Positives = 456/721 (63%), Gaps = 7/721 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+  A+   Y Y VP  M ++ G +V VPL  R VL +VW  +         +L+ +
Sbjct: 18  VDVLVPVALDHTYSYRVPRGMALKPGDVVGVPLGPREVLAVVWAENANPDPRLHNRLKDV 77

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFTGIFPRI 133
               D PPL  ++   V WVA+YT SP G+V RM +        E++   ++  G  P+ 
Sbjct: 78  SEKLDVPPLKPELRSLVDWVANYTLSPRGMVLRMALRMGEHLGPERVRLGVRLVGEPPKR 137

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGV--IKQIFEVISPVVDSPN 191
            T AR RV++ + DG +  K DL+R   VS+ VIDGL  +G   ++ +  V+ P   +P+
Sbjct: 138 LTPARRRVIEAVSDGLLHGKSDLVREIGVSASVIDGLVDEGTLTVEAMPRVLPP--PTPD 195

Query: 192 LYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
             F+ P     Q   VE +  L   G F V+L+ GVTGSGKTEVY E VA  +  G+Q L
Sbjct: 196 PSFAQPEFFDAQLAGVEAMRALAACGTFNVALLDGVTGSGKTEVYFEAVAETVRRGRQSL 255

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           IL+PEI+LT   LERF +RFGV+P EWHS L+   R++ W  +A G   V+VG RSALFL
Sbjct: 256 ILMPEIALTGQFLERFSRRFGVRPLEWHSELTPRTRQRNWAAIAAGEAPVVVGARSALFL 315

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           P+  LGLIV+DEEHD +YKQ+EG  Y+ARDM++VRG I  FPVVL SATPS+E+ VN   
Sbjct: 316 PYADLGLIVVDEEHDQAYKQDEGAHYHARDMAVVRGHIAKFPVVLASATPSVETEVNARK 375

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            RY  V L +R+    +PH++ ID+R +   +G+ +SP +   IR  + R EQ LLFLNR
Sbjct: 376 GRYQRVALPSRFGGQHMPHIEAIDLRREPPPRGRYVSPRLAGHIRTAIERGEQALLFLNR 435

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPLTLC+ CG+R  C  C  WLV+HR +++L CH CG S     +C  C +   ++A
Sbjct: 436 RGYAPLTLCRACGHRFACTICDAWLVDHRFRQRLVCHHCGFSMARPPTCPHCAAEESLVA 495

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G+ER+ EE    FP AR  +LSSDL      ++ +L+AIA+G +D+IIGTQLVAKGH
Sbjct: 496 VGPGVERLQEEAAALFPDARSMVLSSDLITSIETMRAELTAIAEGRVDLIIGTQLVAKGH 555

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           NFPR++LVGVVD DLGL N D R++ERT+QLL+QV GRAGR   +  G +Q +QP HPVM
Sbjct: 556 NFPRLNLVGVVDADLGLGNGDPRAAERTWQLLNQVIGRAGREQGRGRGYLQTHQPEHPVM 615

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
           +ALV+ D ++FY SEI ARE    PPFGRLA++IIS       E +A  L   APR   +
Sbjct: 616 KALVACDREAFYTSEIEARERTGYPPFGRLASLIISAGDRPTAEGFARRLVASAPREEGV 675

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           ++ GPAE+PL +++GRYRFRLL+   RN +L  +      +  K    L+++ D+DPQ+F
Sbjct: 676 LLLGPAEAPLAVIKGRYRFRLLLKSARNFDLSDYLRHWLAHAEKPKGNLKLEVDVDPQSF 735

Query: 731 L 731
           L
Sbjct: 736 L 736


>gi|182677533|ref|YP_001831679.1| primosome assembly protein PriA [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633416|gb|ACB94190.1| primosomal protein N' [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 736

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/735 (47%), Positives = 451/735 (61%), Gaps = 27/735 (3%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +L+  AV   Y Y+VP  + V  G  V VPL  R   GIVW     +   D+LKL  I+ 
Sbjct: 8   VLIPVAVDIAYSYAVPEHLGVAPGDFVVVPLGRRQAEGIVW--DLRRGAADNLKL--IQA 63

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRINT 135
             D PPL+  +  F+ WVA +T SP G+V RM +     +  E     +   G+ P   T
Sbjct: 64  RLDLPPLAEDLRRFIDWVARWTLSPRGMVLRMAIRTPLQAPPEPPRLGVMRAGVLPARMT 123

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
            AR RVL+ + DG +  +++L + +  S +VIDGL  +G +     V  P  DS     S
Sbjct: 124 PARHRVLEALGDGLVLARKELAKKAACSPNVIDGLIDEGTLATTVLVDEP--DSVREGIS 181

Query: 196 L-PILDKNQQDV-VEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
             P L+ +Q    VE    +  + F V+L+ GVTGSGKTEVY E VA+ L  G   LILL
Sbjct: 182 HGPTLEPDQAAAAVELTNQVRRQTFTVTLLEGVTGSGKTEVYFEAVASALETGGHALILL 241

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI+LT+  L+RF  RFG +P EWHS++    R + WR VA G I V+VG RSALFLPF+
Sbjct: 242 PEIALTAQFLDRFTTRFGERPGEWHSAVGPRRRARTWRAVAEGRIKVVVGARSALFLPFR 301

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            L LIV+DEEHD +YKQE+G+ Y+ARDM++VRG++    V+L SATPSIE+RVN    RY
Sbjct: 302 DLRLIVVDEEHDSAYKQEDGVPYHARDMAVVRGQLSKSAVILASATPSIETRVNAEQGRY 361

Query: 374 HSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGY 433
             + L  R+    LP L  ID+R    + GK +SP +   +  TLAR EQ+LLFLNRRGY
Sbjct: 362 GHLRLHARHGGRVLPALSAIDLRKAGPSPGKWISPRLAQAMTETLARGEQSLLFLNRRGY 421

Query: 434 APLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGF 493
           APLTLC++CG+R +C HC+ WLVEHR +K L CH CGH     ++C  CG    + ACG 
Sbjct: 422 APLTLCRLCGHRFQCPHCTAWLVEHRFRKALVCHHCGHIEPVPEACPACGGLHHLTACGP 481

Query: 494 GIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFP 553
           GIER+AEE  E FP AR  +LSSDL GG  R++ +L A+A+G  DI+IGTQLVAKGHNFP
Sbjct: 482 GIERVAEEAAELFPNARTLVLSSDLPGGTARMRDELEAVAQGACDIVIGTQLVAKGHNFP 541

Query: 554 RMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQAL 613
            +SLVGVVD D+ L N D R+SERTFQ+L QVTGRAGRF  +   LIQ +QP HPV+ AL
Sbjct: 542 LLSLVGVVDADISLANGDPRASERTFQILRQVTGRAGRFETQGQALIQTWQPEHPVIAAL 601

Query: 614 VSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA--------- 664
           +SGDA+ FY  E   R    LPPF RLAA+IIS  +    E +A  L + A         
Sbjct: 602 LSGDAERFYAEETEQRRRGGLPPFRRLAALIISAKEAAVAERHARALVQAAHAMPPNPAY 661

Query: 665 --------PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRS 716
                   P +  IV+ GPA +P+ ++R R+RFRLLI   R ++LQGF   +        
Sbjct: 662 LLARGAPGPDADGIVLLGPAPAPITVIRARHRFRLLIKAPRGADLQGFIRAVLAAAPPPR 721

Query: 717 NALRVQFDIDPQNFL 731
             LRV  DIDPQ+FL
Sbjct: 722 GDLRVSVDIDPQSFL 736


>gi|299135446|ref|ZP_07028636.1| primosomal protein N' [Afipia sp. 1NLS2]
 gi|298589854|gb|EFI50059.1| primosomal protein N' [Afipia sp. 1NLS2]
          Length = 724

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/719 (45%), Positives = 453/719 (63%), Gaps = 3/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+  A++  Y Y VP   ++  G +V VPL +R V+G+VW  ++        +L+ +
Sbjct: 6   VDVLVPVALNQAYSYGVPDGEELAPGDVVSVPLGAREVIGVVWAENQNPAPRLHNRLKDV 65

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFTGIFPRI 133
               D PPL  ++  FV WV++YT +  G+V RM +        E++   ++  G  P+ 
Sbjct: 66  SEKLDVPPLREELRRFVDWVSNYTLASRGMVMRMTLRMGEHLGPERVRLGVRLVGEPPQR 125

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR RVLD + DG +  K +  + + VS  VIDGL  +G +          +  P+  
Sbjct: 126 MTAARARVLDLLSDGLLRAKSEAAQEAGVSGSVIDGLVDEGTLAVETMPREKPMQPPDAA 185

Query: 194 FSLPILDKNQQDVVEQVVPLCTK-GFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           F+ P     Q +   ++  L  + GFAV+LI GVTGSGKTEVY E VA ++  G+Q LIL
Sbjct: 186 FAEPDFSPEQSEAAAKMRELAAQDGFAVALIDGVTGSGKTEVYFEAVAEIIRKGRQALIL 245

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI+LT   LERF +RFGV+P EWHS L+   R + W  VA G   V+VG RSALFLP+
Sbjct: 246 MPEIALTGQFLERFAQRFGVRPIEWHSELTPRTRARNWLAVANGEAQVVVGARSALFLPY 305

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
             LGLIV+DEEHD +YKQ +G  Y+ARDM++VRG I   PVVL SATPS+E+ VN  + R
Sbjct: 306 ADLGLIVVDEEHDQAYKQSDGAHYHARDMAVVRGHIAKVPVVLSSATPSVETEVNARTGR 365

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  + L +R+    +PH++ ID+R +   +G+ +SP + + ++  + R EQ LLFLNRRG
Sbjct: 366 YRRIALPSRFGGQHMPHIEAIDLRREGPQRGRFISPPLAEAVKFAVERREQALLFLNRRG 425

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+ CG+R  C  C  WLV+HR +++L CH CG S      C  C +   + A G
Sbjct: 426 YAPLTLCRACGHRFSCNICDAWLVDHRFRQRLVCHHCGFSMPRPHVCPQCAAEESLAAIG 485

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ER+ EE    FP AR  +LSSDL      ++ +L+ IA+G +DIIIGTQLVAKGHNF
Sbjct: 486 PGVERLQEEAATLFPEARTMVLSSDLITDIETMRSELNEIAEGRVDIIIGTQLVAKGHNF 545

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           PR++LVGVVD DLGL N D R++ERTFQLL+QV GRAGR   + +G +Q +QP HPVM+A
Sbjct: 546 PRLNLVGVVDADLGLGNGDPRAAERTFQLLNQVIGRAGREQGRGVGYLQTHQPEHPVMKA 605

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           LV+ + ++FY+SEI ARE    PPFGRLAA+I+S     + E +A  L   APR   +VV
Sbjct: 606 LVASNREAFYDSEIEARERAAYPPFGRLAALIVSAANRPDAEGFARRLANLAPRDEHVVV 665

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL +++GRYRFRLL+   R  +L G+         K   +L ++ D+DPQ+FL
Sbjct: 666 LGPAEAPLAVIKGRYRFRLLVKSSRAFDLSGYLRAWLAAAPKTKGSLTLEVDVDPQSFL 724


>gi|158425768|ref|YP_001527060.1| primosome assembly protein PriA [Azorhizobium caulinodans ORS 571]
 gi|158332657|dbj|BAF90142.1| primosomal protein [Azorhizobium caulinodans ORS 571]
          Length = 724

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/725 (44%), Positives = 456/725 (62%), Gaps = 5/725 (0%)

Query: 11  VVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW-YNSEEKYKIDS 69
           +  + V +LL   +  PY Y VP  +++  G +V VPL SR V+G VW   +E    +D+
Sbjct: 1   MTAATVDVLLPLGLDVPYSYLVPDGLELAPGDLVAVPLGSRLVVGCVWPRGAEAPAPVDT 60

Query: 70  LKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKI--QFT 127
            KL+ +    D  PL   + + + W+ADYT +P G+V RM +          E++  + T
Sbjct: 61  SKLKAVRKKLDHRPLPPDLLQLIDWMADYTLAPRGMVLRMALRHEENPSPARERVGVRAT 120

Query: 128 GIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVV 187
           G  P   T AR R+++ + DG +  K D  R + VS  V+DGL  +G ++ +    +P  
Sbjct: 121 GHVPERLTAARKRLIEVMADGFVRAKTDAAREAGVSPSVVDGLVDEGALETLVLPPAPAA 180

Query: 188 DSPNLYFSLPIL-DKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
           ++P+   + P L +   Q     +  +  K F+V L+ GVTGSGKTEVY E VA  +  G
Sbjct: 181 ETPDPDHAAPTLSEPQAQAANAIIAAVQAKAFSVHLLDGVTGSGKTEVYFEAVAEAVREG 240

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           +Q LILLPEI+LT A ++RF +RFGV PAEWHS +ST  R +I R VA G + V+ G RS
Sbjct: 241 RQALILLPEIALTQAFIDRFTRRFGVAPAEWHSGVSTRRRGRILRGVADGDVQVVAGARS 300

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLPF+ L L ++DEEHD +YKQE+G+ Y+ARDM++VR +    P+VL SATPSIE+ V
Sbjct: 301 ALFLPFQDLALTIVDEEHDPAYKQEDGVTYHARDMAVVRSRFCRSPIVLTSATPSIETEV 360

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N    RY+ + L  R+  + +P L  ID+R     +G+ ++P +   I  TL    Q LL
Sbjct: 361 NARRGRYNRLSLPLRFGGAKVPGLSPIDLRKDMPPRGRWIAPRLQSEIAQTLEDGGQALL 420

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRGYAPLTLC+ CG+R++C  CS WLVEHR +++L CH CG+ A   + C  CG+  
Sbjct: 421 FLNRRGYAPLTLCRSCGHRMRCPSCSAWLVEHRFRRRLSCHHCGYQAPVPECCPACGAKD 480

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
            MI CG G+ER+ EEV   FP AR  +LSSD+ GG  R++ +L A+A GE+D+++GTQLV
Sbjct: 481 AMIPCGPGVERLQEEVQALFPEARSLVLSSDI-GGIERMRAELEAVANGEVDVVVGTQLV 539

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGHNFP ++LVGVVD D+GL + D R++ERTFQL+ QV GRAGR   +  G IQ + P 
Sbjct: 540 AKGHNFPGLALVGVVDADVGLGHGDPRAAERTFQLVHQVAGRAGRGATEGRGFIQTHMPD 599

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR 666
           HPVMQALV GD  +FYE+EI ARE  +LPPFGR+A++I+S  +    E +A  L   APR
Sbjct: 600 HPVMQALVKGDRAAFYETEIAAREEAHLPPFGRMASLIVSANEGPAAEAHARRLAASAPR 659

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
              + V GPAE+PL ++RGR+R+RLL+   R  +L  +         + +   +V  D+D
Sbjct: 660 VEGVRVLGPAEAPLAVLRGRHRWRLLVRAPRAFDLSAYLRGWRSVAPRPTGNTKVSIDVD 719

Query: 727 PQNFL 731
           P  FL
Sbjct: 720 PMTFL 724


>gi|220921606|ref|YP_002496907.1| primosome assembly protein PriA [Methylobacterium nodulans ORS
           2060]
 gi|219946212|gb|ACL56604.1| primosomal protein N' [Methylobacterium nodulans ORS 2060]
          Length = 754

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/729 (46%), Positives = 457/729 (62%), Gaps = 21/729 (2%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +L+  A+   Y Y+VP+ + +  G +V++PL  R  +G+VW +  E     +L+ R    
Sbjct: 32  VLIPLALDTAYSYAVPAGLDLAEGDVVQIPLGPRETVGVVW-SLREGASGGNLR-RVTAK 89

Query: 78  VFD---CPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEK---IQFTGIFP 131
           + D    PPL R     V W+A YT +P G    M +    E  + E     ++ TG+ P
Sbjct: 90  IADEGMPPPLRR----LVDWIARYTLAPKGSALAMALRLPEEGSRTEVARIGVRATGMPP 145

Query: 132 RINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIF---EVIS--PV 186
              T AR +VL    DG +  KR L   + VS+ V+DGL   GV++ +    E ++  P 
Sbjct: 146 SRMTPARAKVLAVAADGAVRGKRALGLEAGVSASVVDGLIDDGVLETVALAPERVAEPPD 205

Query: 187 VDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFA----VSLISGVTGSGKTEVYLEIVAAV 242
            D P+   S P  D  +  V    VP    G A    V+L+ GVTGSGKTEVY E VA  
Sbjct: 206 PDHPHATLSEPQADAARALVATLTVPPRDGGPAGDGGVTLLEGVTGSGKTEVYFEAVAEA 265

Query: 243 LHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIV 302
           +  G Q L+L+PEI+LT+  L+RF  RFG +PA WHS +    RE+I   VA G I V+V
Sbjct: 266 VRRGVQSLVLMPEIALTAQFLDRFAARFGARPAAWHSGIGGRRRERIRAGVAAGEIPVVV 325

Query: 303 GVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSI 362
           G RSALFLPF++LGLIV+DEEH+ +YKQE+G+ Y+ARDM++VR K+E+   VL SATPSI
Sbjct: 326 GARSALFLPFRRLGLIVVDEEHEAAYKQEDGVCYHARDMAVVRAKLENAAAVLASATPSI 385

Query: 363 ESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNE 422
           E+RVN    RY  V L  R+    LP +Q IDMR + I +G+ LSP +   I  T AR E
Sbjct: 386 ETRVNAARGRYRRVVLPERFGGRRLPEIQPIDMRREAIPRGRYLSPTLSAAIAETNARGE 445

Query: 423 QTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVC 482
           Q LLFLNRRGYAPLTLC+ CG+R +C +CS WLVEHR ++ L CH CGH+    ++C  C
Sbjct: 446 QALLFLNRRGYAPLTLCRACGHRYQCPNCSTWLVEHRFRRALVCHHCGHAERRPEACAAC 505

Query: 483 GSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIG 542
           G+   + ACG G+ERIAEEV   FP  R+ +LSSD  GG  RL+ +L  +A+G  DI++G
Sbjct: 506 GTFDNLTACGPGVERIAEEVAATFPDRRVIVLSSDFPGGAERLRAELQTVAEGGCDIVVG 565

Query: 543 TQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQA 602
           TQLVAKGHNFP ++LVGV+D D+GL + D R++ERTFQLL QVTGRAGR       L+Q 
Sbjct: 566 TQLVAKGHNFPHLTLVGVLDADIGLASGDPRAAERTFQLLQQVTGRAGRGEKPGRALVQT 625

Query: 603 YQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE 662
           YQP HPV+ AL+SGDA+ FYE EI ARE   LPPFGRLAA+I+S  + +  E +   L +
Sbjct: 626 YQPEHPVIAALISGDAERFYEEEIAARELAGLPPFGRLAALIVSAAEREAAETHGRALAQ 685

Query: 663 HAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQ 722
            A     ++V GPAE+PL +VRGR+RFRLL+  +R  ++Q +         K   ++RV 
Sbjct: 686 VANPPPGVMVLGPAEAPLALVRGRHRFRLLVKAEREVDVQSYLRDWLARGPKPRGSVRVG 745

Query: 723 FDIDPQNFL 731
            D+DPQ+FL
Sbjct: 746 IDVDPQSFL 754


>gi|148252010|ref|YP_001236595.1| primosome assembly protein PriA [Bradyrhizobium sp. BTAi1]
 gi|146404183|gb|ABQ32689.1| replication restart DNA helicase PriA [Bradyrhizobium sp. BTAi1]
          Length = 736

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/719 (45%), Positives = 449/719 (62%), Gaps = 3/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+  A+   Y Y VP  M ++ G +V VPL +R VL +VW  +         +L+ +
Sbjct: 18  VDVLVPVALDHTYSYRVPRGMALKPGDVVGVPLGAREVLAVVWAENANPDPRLHNRLKDV 77

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFTGIFPRI 133
               D PPL  ++   V WVA+YT SP G+V RM +        E++   ++  G  P+ 
Sbjct: 78  SEKLDVPPLKPELRSLVDWVANYTLSPRGMVLRMCLRMGEHLGPERVRLGVRLVGDAPKR 137

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR RV++ + DG +  K DL+R   VS  VIDGL  +G +       +    +P+  
Sbjct: 138 LTPARRRVIEAVSDGLLHGKSDLVREIGVSGSVIDGLVDEGTLTVEAMPRTLPPPAPDPD 197

Query: 194 FSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           F+ P     Q   V  +  L   G F V+L+ GVTGSGKTEVY E VA  +  G+Q LIL
Sbjct: 198 FARPEFFDAQLAGVAAMRTLAANGTFQVALLDGVTGSGKTEVYFEAVAETIRRGRQSLIL 257

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI+LT   LERF +RFGV+P EWHS L+   R++ W  +A G   V+VG RSALFLP+
Sbjct: 258 MPEIALTGQFLERFSRRFGVRPLEWHSELTPRTRQRNWASIAAGEAPVVVGARSALFLPY 317

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
             LGLIV+DEEHD +YKQ+EG  Y+ARDM++VRG I  FPVVL SATPS+E+ VN    R
Sbjct: 318 ADLGLIVVDEEHDQAYKQDEGAHYHARDMAVVRGHIAKFPVVLASATPSVETEVNARKGR 377

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  V L +R+    +PH++ ID+R +   +G+ +SP +   IR  + R EQ LLFLNRRG
Sbjct: 378 YQRVALPSRFGGQHMPHIEAIDLRREPPPRGRYISPRLAGEIRTAIERGEQALLFLNRRG 437

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+ CG+R  C  C  WLV+HR +++L CH CG S     +C  C +   ++A G
Sbjct: 438 YAPLTLCRACGHRFACTICDAWLVDHRFRQRLVCHHCGFSMPRPPTCPHCAAEESLVAVG 497

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ER+ EE    FP AR  +LSSDL      ++ +L+ IA+G +D+IIGTQLVAKGHNF
Sbjct: 498 PGVERLQEEAAALFPDARSMVLSSDLITSIETMRAELTEIAEGRVDLIIGTQLVAKGHNF 557

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           PR++LVGVVD DLGL N D R++ERT+QLL+QV GRAGR   +  G +Q +QP HPVM+A
Sbjct: 558 PRLNLVGVVDADLGLGNGDPRAAERTWQLLNQVIGRAGREQGRGRGYLQTHQPEHPVMKA 617

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           LV+ D ++FY SEI ARE    PPFGRL ++IIS       E +A  L   APR   +++
Sbjct: 618 LVACDREAFYTSEIEARERTGYPPFGRLGSLIISAGDRPTAEGFARRLVASAPREEGVLL 677

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL +++GRYRFRLL+   RN +L  +      +  K    L+++ D+DPQ+FL
Sbjct: 678 LGPAEAPLAVIKGRYRFRLLLKSARNFDLSDYLRHWLAHAEKPKGNLKLEVDVDPQSFL 736


>gi|154251913|ref|YP_001412737.1| primosome assembly protein PriA [Parvibaculum lavamentivorans DS-1]
 gi|154155863|gb|ABS63080.1| primosomal protein N' [Parvibaculum lavamentivorans DS-1]
          Length = 731

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/734 (45%), Positives = 453/734 (61%), Gaps = 6/734 (0%)

Query: 1   MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYN 60
           MAS  S+      + V +L+  A+  PY Y VP+ M V  G  V VPL  + +LG+VW  
Sbjct: 1   MASEISTGTAPGWTSVSVLIPLALPKPYDYKVPAGMTVRPGDYVIVPLGPQELLGVVW-- 58

Query: 61  SEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALS--ETE 118
            E   ++   +L+ I  V D PP+      FV WVA YT SP G V R+ + A    E +
Sbjct: 59  GEGTGEVGHNRLKSIIEVLDAPPMPEVSRRFVDWVAGYTLSPAGSVLRLTIRAPGALEPQ 118

Query: 119 KMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQ 178
           +M    +     P   T ARLRV++   DG     R+L   + VS  V+ GL   G ++ 
Sbjct: 119 RMRTAYRLCDRRPPRMTPARLRVVETASDGFARSVRELAEEAGVSDGVVRGLVDAGTLQP 178

Query: 179 IFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLE 237
           +        D+P    S   L   Q +    +   +  + FA  L+ G+TGSGKTEVY E
Sbjct: 179 VDLPTELPFDAPQPNASGIDLSPQQAEAAALLTAHVEAERFAAVLLDGITGSGKTEVYFE 238

Query: 238 IVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGA 297
            VAA L  GKQVLILLPEI+LTS  LERF++RFG +PAEWHS + +  R ++WR VA G+
Sbjct: 239 AVAAALRRGKQVLILLPEIALTSQFLERFERRFGCRPAEWHSDVPSRERRRVWRAVAEGS 298

Query: 298 ISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVS 357
           +SV+VG RSALFLPF  LGLIV+DEEHD ++KQE+G+ Y+ARDM++VR  +  FPV+L S
Sbjct: 299 VSVVVGARSALFLPFPDLGLIVVDEEHDAAFKQEDGVAYHARDMAVVRASLGQFPVILSS 358

Query: 358 ATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHT 417
           ATPS+E+ VN    RY SV L  R+  + LP +  IDMR     +G  LSP ++  I   
Sbjct: 359 ATPSLETAVNVEQGRYASVRLDARFGAAELPDVSAIDMRLHPPERGAWLSPLLVTEIARA 418

Query: 418 LARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQ 477
           L   EQ +LFLNRRGYAPLTLC+ CG+R++C  CS WLVEHR +++L CH CG+SA   +
Sbjct: 419 LEAGEQAMLFLNRRGYAPLTLCRTCGHRIECPQCSAWLVEHRFRRELACHHCGYSAPVPK 478

Query: 478 SCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEI 537
           +C  CG+   ++ACG G+ERIAEEV   FP AR++++SSD   G    +   +AI   E+
Sbjct: 479 ACPSCGAEDTLVACGPGVERIAEEVATLFPEARVAVVSSDNLRGPAAHEAVFAAIENREV 538

Query: 538 DIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSL 597
           DI+IGTQ+VAKGH+FP +++VGVVD DLGL N DLR+ ERTFQLL QV GRAGR      
Sbjct: 539 DIVIGTQIVAKGHHFPWLTVVGVVDADLGLENGDLRAGERTFQLLQQVAGRAGRAERPGR 598

Query: 598 GLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYA 657
             +Q++ P H VM+ALVSG  D F   E  ARE V+LPP+GRL  V+IS    +     A
Sbjct: 599 VFLQSWMPEHNVMRALVSGRRDEFLVREAAARERVSLPPYGRLVGVVISSPDAELARKVA 658

Query: 658 YNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSN 717
             +   AP++ ++ V GPA +P+ ++RGR R R L+   RN N+Q +  Q +   +K  N
Sbjct: 659 REMSRRAPQADNVSVLGPAPAPMALLRGRTRLRFLVKAGRNVNVQSYM-QAWLADMKIPN 717

Query: 718 ALRVQFDIDPQNFL 731
           A+RV  DIDP +F+
Sbjct: 718 AVRVSVDIDPYSFM 731


>gi|86747396|ref|YP_483892.1| primosome assembly protein PriA [Rhodopseudomonas palustris HaA2]
 gi|86570424|gb|ABD04981.1| replication restart DNA helicase PriA [Rhodopseudomonas palustris
           HaA2]
          Length = 735

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/713 (44%), Positives = 442/713 (61%), Gaps = 5/713 (0%)

Query: 23  AVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCP 82
           A+   Y Y VP  ++++ G +V VPL SR V+G+VW  +E        +L+ +    D P
Sbjct: 24  AIDQAYSYRVPRGLELKPGDVVAVPLGSREVMGVVWAENENPDPRLHNRLKDVAEKLDVP 83

Query: 83  PLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFTGIFPRINTVARLR 140
           PL  ++   V WVA+YT SP G V RM +  + E   E++   ++  G  P+  T AR R
Sbjct: 84  PLREELRRLVDWVANYTLSPRGQVLRMTLR-MGELGPERVRTGVRLIGPPPQRMTPARRR 142

Query: 141 VLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILD 200
           +++ + DG +  K D  + +  S+ VIDGL  +G +        P   +P+  F+     
Sbjct: 143 LIEILSDGLLHGKSDAAKEAGCSAGVIDGLVDEGTLSVEPMPREPAAPTPDPDFAPADFS 202

Query: 201 KNQQDVVEQVVPLCTKG--FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISL 258
             Q    E +  L   G  F  +L+ GVTGSGKTEVY E VA ++  G+Q LIL+PEI+L
Sbjct: 203 PEQAAAAETMRELVKSGGGFQAALLDGVTGSGKTEVYFEAVAEIIRQGRQTLILMPEIAL 262

Query: 259 TSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLI 318
           T   L+RF  RFGV+P EWHS L+   R + W  +A G   V+VG RSALFLP+  LGLI
Sbjct: 263 TGQFLDRFALRFGVRPLEWHSELTPRTRARNWAAIAAGEAQVVVGARSALFLPYADLGLI 322

Query: 319 VIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHL 378
           ++DEEHD +YKQE+G  Y+ARDM++VR  I   P+VL SATPS+E+ VN    RY  + L
Sbjct: 323 IVDEEHDQAYKQEDGAHYHARDMAVVRASIAKIPIVLASATPSVETEVNARKGRYRRIPL 382

Query: 379 STRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTL 438
            +R+    +P ++ ID+R     +G+ +SP + + I H + R EQ LLFLNRRGYAPLTL
Sbjct: 383 PSRFGGQHMPQIEAIDLRRAPPMRGRFISPPLAEQIGHAIERGEQALLFLNRRGYAPLTL 442

Query: 439 CQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERI 498
           C+ CG+R  C  C  WLV+HR +++L CH CG S      C  CG+   ++A G G+ER+
Sbjct: 443 CRACGHRFACTICDAWLVDHRFRQRLVCHHCGFSMPRPHQCPHCGAEESLVAVGPGVERL 502

Query: 499 AEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLV 558
            EE    FP AR  +LSSDL      ++ +L+ IA+G +DIIIGTQLVAKGHNFPR++LV
Sbjct: 503 QEEAASLFPQARTMVLSSDLITSIEAMRSELNDIAEGRVDIIIGTQLVAKGHNFPRLNLV 562

Query: 559 GVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDA 618
           GVVD DLGL+N D R++ERTFQLL+QV GRAGR   + +G +Q +QP HPVM+ALV+ D 
Sbjct: 563 GVVDADLGLSNGDPRAAERTFQLLNQVIGRAGRDQGRGVGFLQTHQPEHPVMKALVACDR 622

Query: 619 DSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAES 678
           ++FY SEI ARE    PPFGRLA++I+S       E +A  L   AP    + V GPAE+
Sbjct: 623 EAFYASEIDARERTLYPPFGRLASLIVSAGDRPSAEGFARKLASCAPVDERVQVLGPAEA 682

Query: 679 PLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           PL +++GRYRFRLL+   R+ +L  +         K    L+++ D+DPQ+FL
Sbjct: 683 PLAVIKGRYRFRLLVKSVRSFDLSNYLRSWLAQGPKTKGNLKLEVDVDPQSFL 735


>gi|312115789|ref|YP_004013385.1| primosomal protein N' [Rhodomicrobium vannielii ATCC 17100]
 gi|311220918|gb|ADP72286.1| primosomal protein N' [Rhodomicrobium vannielii ATCC 17100]
          Length = 745

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/723 (45%), Positives = 450/723 (62%), Gaps = 11/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +LL  A+  PY Y VP+   +  G  V VPL     +G+VW  +  +  +D  KL+P+
Sbjct: 27  VPVLLPLALDEPYTYEVPAGETLAPGDFVVVPLGPVKRIGVVWREASTR-PVDPRKLKPV 85

Query: 76  EYVFD-CPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF---TGIFP 131
               D  PPL      F  WVA YT +P G+V +M++SA    E  E +  F   +G+  
Sbjct: 86  LARLDEVPPLPPLNLAFADWVAQYTLAPKGMVLQMMMSARLVFEAEEPRFGFRNGSGVPS 145

Query: 132 RINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGL-KAQGVIKQIFEVISPVVDSP 190
           R+ T AR RVL  + DG +W K+ L+ A+ VS+ VIDGL +A  +I+            P
Sbjct: 146 RM-TDARQRVLAAVADGAVWSKKRLMDAAGVSAAVIDGLAQAGALIRAELPRTRAFAPRP 204

Query: 191 NLYF-SLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLG-KQ 248
           +  F SL          ++Q +     GF+ +L+ GVTGSGKTEVY E VA  L  G +Q
Sbjct: 205 DFAFASLSDAQLTAAGALQQTI--AEGGFSATLLDGVTGSGKTEVYFEAVAEALRHGERQ 262

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VLILLPEI+LT+  LERF++RFG +P EWHS++S   R ++WR VA G + V+ G RSAL
Sbjct: 263 VLILLPEIALTNQFLERFERRFGCRPGEWHSAVSPKERARVWRGVALGEVRVVCGARSAL 322

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPF  LGLIV+DEEHD S+KQ++ + Y ARDM++VR  +   P+VL SATPS+ES VN 
Sbjct: 323 FLPFTDLGLIVVDEEHDPSFKQDDRVTYQARDMAVVRASLGKIPIVLASATPSVESIVNV 382

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
              RY    L  R+  +ALP ++ +D+R     +G  +S  ++  +   LA+ EQ LLFL
Sbjct: 383 QRGRYRHAVLPGRFSGNALPDVEAVDLRAVPPERGMWISEPLVGAVNEALAKGEQALLFL 442

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+ CG+R  C  C+ +LVEHR + +L CH CG S  + ++C  C   G +
Sbjct: 443 NRRGYAPLTLCRACGHRFTCPQCTAYLVEHRLRGRLICHHCGFSLPFPKACPSCHGEGTL 502

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
            A G GIER+ EE    +P AR+++LSSDL      L+  L+ I +G++DI++GTQLV+K
Sbjct: 503 AASGPGIERVTEEAQNRWPEARLAVLSSDLVPSTAALREILTRITEGDVDIVVGTQLVSK 562

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP++S VGVVDGDL L  AD R+ ERTFQLL QVTGRAGRFG    GLIQ + P HP
Sbjct: 563 GHNFPKLSFVGVVDGDLSLATADPRAGERTFQLLHQVTGRAGRFGAPGRGLIQTHFPDHP 622

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           VM+ALV+G+ ++FYE+EI  RE    PPFGRLAA+I+SG    + E YA  L   AP +S
Sbjct: 623 VMRALVTGNREAFYEAEIGLREEAGYPPFGRLAALIVSGKTRYDAEGYARALALAAPEAS 682

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
            I V GP E+PL ++RG +R RLL+   R ++LQ +      +       + +  D+DP 
Sbjct: 683 RIQVLGPVEAPLAIIRGLHRQRLLVKAAREADLQAYLRAWLASVDAPRGGVTLHIDVDPH 742

Query: 729 NFL 731
           +FL
Sbjct: 743 SFL 745


>gi|91975034|ref|YP_567693.1| primosome assembly protein PriA [Rhodopseudomonas palustris BisB5]
 gi|91681490|gb|ABE37792.1| replication restart DNA helicase PriA [Rhodopseudomonas palustris
           BisB5]
          Length = 735

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/708 (45%), Positives = 438/708 (61%), Gaps = 5/708 (0%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQ 87
           Y Y VP  + ++ G +V VPL  R VLG+VW  +         +L+ +    D PPL  +
Sbjct: 29  YSYRVPRGLDLKPGDVVAVPLGPREVLGVVWAENPNPDPRLHNRLKDVAEKLDVPPLREE 88

Query: 88  MCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFTGIFPRINTVARLRVLDKI 145
           +   V WVA+YT SP G V RM +  + E   E+    ++  G  P+  T AR R+++ +
Sbjct: 89  LRRLVDWVANYTLSPRGQVLRMTLR-MGELGPERQRMGVRLVGPPPQRMTPARRRLIEIL 147

Query: 146 KDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQD 205
            DG +  K D+ + + VS  VIDGL  +G +        P   +P+  F+       Q  
Sbjct: 148 SDGLLHGKSDVAKEAGVSPGVIDGLVDEGTLHVEAMPREPAAPTPDPDFAPADFSPEQAR 207

Query: 206 VVEQVVPLCTKG--FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAIL 263
             E +  L   G  F  +L+ GVTGSGKTEVY E VA V+  G+Q LIL+PEI+LT   L
Sbjct: 208 AAETMRELVKPGGGFQAALLDGVTGSGKTEVYFEAVAEVVRQGRQCLILMPEIALTGQFL 267

Query: 264 ERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEE 323
           +RF  RFGV+P EWHS L+   R + W  +A G   V+VG RSALFLP+  LGLI++DEE
Sbjct: 268 DRFALRFGVRPLEWHSELTPRTRARNWAAIAAGEAQVVVGARSALFLPYADLGLIIVDEE 327

Query: 324 HDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYR 383
           HD +YKQE+G  Y+ARDM++VR  I   P+VL SATPS+E+ VN    RY  + L +R+ 
Sbjct: 328 HDQAYKQEDGAHYHARDMAVVRASIARIPIVLASATPSVETEVNARKGRYRRIPLPSRFG 387

Query: 384 NSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCG 443
              +P ++ ID+R +   +G+ +SP + + + H + R EQ LLFLNRRGYAPLTLC+ CG
Sbjct: 388 GQHMPQIEAIDLRREPPMRGRFISPRLAEQVGHAIERREQALLFLNRRGYAPLTLCRACG 447

Query: 444 NRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVC 503
           +R  C  C  WLV+HR +++L CH CG S      C  C +   ++A G G+ER+ EE  
Sbjct: 448 HRFACTICDAWLVDHRFRQRLVCHHCGFSMPRPLQCPHCAAEQSLVAVGPGVERLQEEAS 507

Query: 504 EYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDG 563
             FP AR  +LSSDL      ++ +L+ IA+G +DIIIGTQLVAKGHNFPR++LVGVVD 
Sbjct: 508 SLFPDARTMVLSSDLITSIEAMRSELNDIAEGRVDIIIGTQLVAKGHNFPRLNLVGVVDA 567

Query: 564 DLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYE 623
           DLGL+N D R++ERTFQLL+QV GRAGR   + +G +Q +QP HPVM+ALV+ D ++FY 
Sbjct: 568 DLGLSNGDPRAAERTFQLLNQVIGRAGRDQGRGVGFLQTHQPEHPVMKALVACDREAFYA 627

Query: 624 SEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMV 683
           SEI ARE    PPFGRLA++IIS       E +A  L   AP    + V GPAE+PL ++
Sbjct: 628 SEIEARERTLYPPFGRLASLIISAGDRPTAEGFARQLASSAPVDERVQVLGPAEAPLAVI 687

Query: 684 RGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           +GRYRFRLL+   R+ +L  +  Q      K    L+++ D+DPQ+FL
Sbjct: 688 KGRYRFRLLVKSVRSFDLSNYLRQWLAQGPKTKGNLKLEVDVDPQSFL 735


>gi|217978721|ref|YP_002362868.1| primosome assembly protein PriA [Methylocella silvestris BL2]
 gi|217504097|gb|ACK51506.1| primosomal protein N' [Methylocella silvestris BL2]
          Length = 744

 Score =  637 bits (1643), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 328/742 (44%), Positives = 459/742 (61%), Gaps = 26/742 (3%)

Query: 12  VCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLK 71
           V S V +L   AV   Y Y  P+AM +  G+ V  PL  R  +G+V+  ++      +  
Sbjct: 7   VQSVVDVLFPVAVDTAYSYVAPAAMGLVPGAFVEAPLGPRRAIGVVF--AQRPAPPGASN 64

Query: 72  LRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSAL--SETEKMEEKIQFTGI 129
           LR +    D  PL  ++ +F+ WVA +  SP G+V RM + A   +  E     ++ TG 
Sbjct: 65  LRAVAARLDISPLGDRLRDFIDWVARWGMSPRGMVLRMAIRAPFHAAPEPKRVGLRLTGA 124

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T AR R L   + G +  K  L +A+ VS+ VIDGL  QGV     E ++P   +
Sbjct: 125 APARLTPARERTLAAAQAGGLMTKAALAKAAGVSASVIDGLIRQGVF--TLETLAPEPAA 182

Query: 190 P--NLYFSLPILDKNQQDVVEQVVPLCT-KGFAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
           P  +  F  P+L ++Q     ++      + F+V+L+ GVTGSGKTE Y E +AA L  G
Sbjct: 183 PVGDPDFRQPLLSQDQAAAAAELAKAVLAQSFSVTLLEGVTGSGKTETYFEAIAAALRAG 242

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           +Q L+LLPEI+LTS  ++RF  RFG  P EWHS +  + R +IW  VA G   +I+G RS
Sbjct: 243 RQTLVLLPEIALTSQFVDRFGARFGAAPVEWHSGIGAARRARIWSAVASGEAKIIIGARS 302

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLPF+ LGL+++DEEHD +YKQE+G++Y+ARDM++VRG+IE   V+L SATPSIE+RV
Sbjct: 303 ALFLPFQSLGLVIVDEEHDGAYKQEDGVVYHARDMAVVRGRIEQCAVILASATPSIETRV 362

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N    RY  + L  R+   A+P ++ +DMR +   +GK +SP +I  +   L + +Q+LL
Sbjct: 363 NADQGRYRRLVLKDRFGGRAMPKIEAVDMRLKPPPRGKWISPALIAALADNLGKGQQSLL 422

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRGYAPLTLC+ CG+R +C +C+ WLV+HR +K L CH CGH     + C  C +  
Sbjct: 423 FLNRRGYAPLTLCRSCGHRFQCPNCAAWLVDHRFRKALICHHCGHMERRPELCPNCEAVE 482

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
            ++ACG G+ER+ EE  E FP AR+ ILSSDL GG  RL+ +  A+A+G  DI+IGTQLV
Sbjct: 483 SLMACGPGVERLEEEAAELFPDARLMILSSDLAGGAERLRAEFEAVARGACDIVIGTQLV 542

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGHNFP ++LVGV+D D+GLT+ D R++ERTFQLL QVTGRAGRF      L+Q++QP 
Sbjct: 543 AKGHNFPGLTLVGVIDADIGLTSGDPRAAERTFQLLQQVTGRAGRFETPGRALVQSFQPE 602

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEV------------- 653
           HPVM+A++SGD++ FY  EI  R    LPPFGRLAA+I+SG                   
Sbjct: 603 HPVMRAILSGDSEKFYAEEIEQRRRAGLPPFGRLAALIVSGNDAASAEAFARALARAAHD 662

Query: 654 ----ENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMY 709
               + +        P   ++ + GPAE+P+ ++RGR+RFRLLI   R+S+LQGF + + 
Sbjct: 663 LPRSDGWTLAAAGGLPTEGELSLLGPAEAPIAILRGRHRFRLLIRAPRSSDLQGFLNALL 722

Query: 710 DNTIKRSNALRVQFDIDPQNFL 731
                +   +    DIDPQ+FL
Sbjct: 723 AAGPPQRGGVNAAIDIDPQSFL 744


>gi|75674625|ref|YP_317046.1| primosome assembly protein PriA [Nitrobacter winogradskyi Nb-255]
 gi|74419495|gb|ABA03694.1| replication restart DNA helicase PriA [Nitrobacter winogradskyi
           Nb-255]
          Length = 738

 Score =  637 bits (1642), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 325/719 (45%), Positives = 450/719 (62%), Gaps = 3/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+  A+   Y Y VP  M+V  G +V VPL  R V+ +VW  +         +L+ I
Sbjct: 20  VDVLVPVAIDHAYSYRVPRGMEVRPGEVVTVPLGPREVVAVVWAGNPAPDPRLHNRLKDI 79

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFTGIFPRI 133
               D PPL  ++   + WVA+YT SP G+V RM +        E++   ++ +G  PR 
Sbjct: 80  SGKLDVPPLRDELRTLIDWVANYTLSPRGMVMRMSLRMGEHLGPERVRPGVRLSGEPPRR 139

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR R+L  + DG +  K D  R + VS+ V+DGL  +G +       SP    P+  
Sbjct: 140 MTPARRRLLAVLSDGLLRAKSDAAREAGVSAGVVDGLVDEGTLTTEPMPRSPPPPPPDPD 199

Query: 194 FSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           F++P   ++Q+  V+ +  L + G F V+L+ GVTGSGKTEVY E VA  +  G+QVLIL
Sbjct: 200 FAVPDFSRSQRAAVDAMRALASNGTFHVALLDGVTGSGKTEVYFEAVAETVRRGRQVLIL 259

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI+LT    +RF  RFG +P EWHS L+   R + W  +A G   V+VG RSALFLP+
Sbjct: 260 MPEIALTGQFRDRFAARFGERPLEWHSELTPRNRARNWAAIAAGEAQVVVGARSALFLPY 319

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
             LGLI+IDEEHD +YKQ+EG+ Y+ARDM++VR  +   P++L SATPS+ES VN    R
Sbjct: 320 ADLGLIIIDEEHDQAYKQDEGVRYHARDMAVVRAHVAKIPIILASATPSVESEVNARKGR 379

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  + L++R+    LP +++ID+R +  ++G+ +SP +   I   + R EQ LLFLNRRG
Sbjct: 380 YQRIALTSRFGGQHLPRIELIDLRREGPSRGRFISPRLAGEIVTAIERREQALLFLNRRG 439

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+ CG+R  C  C  WLV+HR + +L CH CG S      C  C +   ++A G
Sbjct: 440 YAPLTLCRGCGHRFACTICDAWLVDHRFRDRLVCHHCGFSMPRPHQCPHCAAEQSLVAVG 499

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ER+ EE    FP AR  +LSSDL      ++ +L+ IA+G +DIIIGTQLVAKGH+F
Sbjct: 500 PGVERLQEEAAALFPDARTMVLSSDLITSIETMRSELNDIAEGRVDIIIGTQLVAKGHHF 559

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           PR++LVGVVD DLGL N D R++ERTFQLL+QV GR GR   + +G +Q +QP HPVM+A
Sbjct: 560 PRLNLVGVVDADLGLGNGDPRAAERTFQLLNQVIGRTGREQGRGVGYLQTHQPEHPVMKA 619

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           LV+GD ++FY SEI ARE    PPFGRLA++IIS       E++A  L   AP    I V
Sbjct: 620 LVAGDREAFYASEIAARERTGYPPFGRLASLIISAGDRPSAESFARQLAAVAPVDERIQV 679

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL +++GRYRFRLL+   R  +L G+      +  K    L+++ D+DPQ+FL
Sbjct: 680 LGPAEAPLALIKGRYRFRLLVKSARGVDLSGYLRDWLASAPKTRGNLKLEVDVDPQSFL 738


>gi|316931850|ref|YP_004106832.1| primosomal protein N' [Rhodopseudomonas palustris DX-1]
 gi|315599564|gb|ADU42099.1| primosomal protein N' [Rhodopseudomonas palustris DX-1]
          Length = 736

 Score =  636 bits (1641), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 322/722 (44%), Positives = 442/722 (61%), Gaps = 3/722 (0%)

Query: 13  CSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKL 72
            S V +L+  A+   Y Y VP  + ++ G +V VPL +R VLG+VW  +         +L
Sbjct: 15  ASVVDVLVPVAIDQAYSYRVPRGLSLKPGDVVAVPLGAREVLGVVWAENPSPDPRLHNRL 74

Query: 73  RPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFTGIF 130
           + +    D PPL  ++   V WVA YT S  G+V RM +        E+    ++  G  
Sbjct: 75  KDVAEKLDVPPLRDELRRMVDWVATYTLSARGMVLRMCLRMGEHLGPERQRMGVRLVGPP 134

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
           P+  T AR R+L+ + DG +  K D+ + + VS  VIDGL  +G +             P
Sbjct: 135 PQRMTPARRRLLEILSDGLLHGKSDVAKEAGVSPGVIDGLVDEGTLSVEPMPRENPAPEP 194

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
           +  F+       Q    E +  L T G F  +LI GVTGSGKTEVY E VA V+  G+Q 
Sbjct: 195 DPDFAPAAFSPEQARAAETIRGLVTAGGFQAALIDGVTGSGKTEVYFEAVAEVIRQGRQS 254

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           LIL+PEI+LT   L+RF +RFGV+P EWHS L+   R + W  +A G   V+VG RSALF
Sbjct: 255 LILMPEIALTGQFLDRFAQRFGVRPLEWHSELTPRTRARNWAAIAAGEARVVVGARSALF 314

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LP+  LGLI++DEEHD +YKQE+G  Y+ARDM++VR  I   P+VL SATPS+E+ VN  
Sbjct: 315 LPYADLGLIIVDEEHDQAYKQEDGAHYHARDMAVVRASIAKIPIVLASATPSVETEVNAR 374

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
             RY  + L +R+    +P ++ ID+R +   +G+ +SP + + I   + R EQ LLFLN
Sbjct: 375 KGRYQRIPLPSRFGGQHMPQIEAIDLRREPPMRGRFISPRLAEQIGFAIERREQALLFLN 434

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC+ CG+R  C  C  WLV+HR +++L CH CG S     +C  CG+ G ++
Sbjct: 435 RRGYAPLTLCRACGHRFACTICDAWLVDHRFRQRLVCHHCGFSMPRPPACPHCGAEGSLV 494

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
           A G G+ER+ EE    FP AR  +LSSDL      ++ +L+ IA+G +DIIIGTQLVAKG
Sbjct: 495 AVGPGVERLQEEAASLFPNARTMVLSSDLITSIETMRSELNEIAEGRVDIIIGTQLVAKG 554

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           HNFPR++LVGVVD DLGL+N D R++ERTFQLL+QV GRAGR   + +G +Q +QP HPV
Sbjct: 555 HNFPRLNLVGVVDADLGLSNGDPRAAERTFQLLNQVIGRAGREQGRGVGFLQTHQPEHPV 614

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           M+ALV+ D ++FY SEI  RE    PPFGRLA++IIS       E++   L   AP    
Sbjct: 615 MKALVACDREAFYASEIEIRERTLYPPFGRLASLIISAGDRPTAESFGRQLAGAAPFDER 674

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           + V GPAE+PL +++GRYRFRLL+   R  +L  +         K    L+++ D+DPQ+
Sbjct: 675 VQVLGPAEAPLAVIKGRYRFRLLVKSVRGFDLSNYLRSWLARGPKTKGNLKLEVDVDPQS 734

Query: 730 FL 731
           FL
Sbjct: 735 FL 736


>gi|296444838|ref|ZP_06886801.1| primosomal protein N' [Methylosinus trichosporium OB3b]
 gi|296257786|gb|EFH04850.1| primosomal protein N' [Methylosinus trichosporium OB3b]
          Length = 810

 Score =  634 bits (1635), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 324/736 (44%), Positives = 440/736 (59%), Gaps = 26/736 (3%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +LL  AV   Y Y  P+A+++  G  V VPL +R   G+VW  +E         L+ +
Sbjct: 79  VEVLLPVAVDIAYSYRAPAALRLAPGDCVEVPLSTRKAFGVVWRFAEPARA----GLKTV 134

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF--TGIFPRI 133
               D PPL +++ +FV WVA +T +P G+  R+   A+ E      ++ +   G  P  
Sbjct: 135 TQRLDRPPLRQELRDFVDWVARWTLAPRGMALRLATRAVEEAAPETPRVGYRLKGPPPER 194

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVD--SPN 191
            T AR RV+   + G ++ K +L RA+  SS V+D L  +G ++       PV     P+
Sbjct: 195 MTPARARVIAAAEGGLVFAKGELARAAACSSGVVDALVDEGTLEASALPPEPVAAPLDPD 254

Query: 192 LYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
            Y    +    +         +   G+   L+ GVTGSGKTEVY E VAA L  G Q L+
Sbjct: 255 -YAPFALESAQRAAADALAAAVTAGGYRPFLLEGVTGSGKTEVYFEAVAAALRAGGQALV 313

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           L+PEI+LT+  LERF  RFG KPAEWHS +S   R ++WR VA G   V+ G RSALFLP
Sbjct: 314 LMPEIALTAQFLERFAARFGAKPAEWHSGISERKRARLWRGVALGEALVVAGARSALFLP 373

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           F  L LIV+DEEH+ +YKQE+G+ Y+ARDM++VR ++E   + L SATPSIE+RVN  S 
Sbjct: 374 FVDLRLIVVDEEHEAAYKQEDGVSYHARDMAVVRARLEGATIALASATPSIETRVNAASG 433

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           RY  + L+ R     +P ++ IDMR +   +G+ ++P +      T+AR EQ L FLNRR
Sbjct: 434 RYEHLRLAARAGARPMPRIEAIDMRNEGPERGRWIAPRLAAEAAETIARGEQVLFFLNRR 493

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIAC 491
           GYAPLTLC+ CG+R +C +C  WLVEHR ++ L CH CGH      +C  C +   + AC
Sbjct: 494 GYAPLTLCRSCGHRFRCPNCDAWLVEHRFRRALVCHHCGHVERRPSNCPECEAEDSLAAC 553

Query: 492 GFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHN 551
           G G+ER+AEE    FP AR+ +LSSD  GG  RL+ +L+ IA G  DI+IGTQLVAKGHN
Sbjct: 554 GPGVERLAEEAAILFPDARVLVLSSDFPGGQERLRRELAEIAAGAFDIVIGTQLVAKGHN 613

Query: 552 FPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQ 611
           FP ++LVGV+D D GL ++D R++ERTFQLL+QVTGRAGR       LIQ++Q  HPV++
Sbjct: 614 FPLLTLVGVIDADSGLGSSDPRAAERTFQLLAQVTGRAGRGDRPGRALIQSWQADHPVIR 673

Query: 612 ALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVEN---------------- 655
           AL+SG+A+ FYE E   RE   LPPFGRLAA+I+S       E                 
Sbjct: 674 ALLSGEAERFYEEETALRERAGLPPFGRLAALIVSAKDAGAAETHARALARAAHSLPASE 733

Query: 656 -YAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIK 714
            Y        P   +IVV GPAE+P+ ++RGRYRFRLLI   R+++LQ F   +     K
Sbjct: 734 RYRVAPAGGLPEEGEIVVLGPAEAPIALIRGRYRFRLLIKAPRSADLQAFLRALLVAAPK 793

Query: 715 RSNALRVQFDIDPQNF 730
               +RV  D+DPQ+F
Sbjct: 794 ERGGVRVAVDVDPQSF 809


>gi|192288609|ref|YP_001989214.1| primosome assembly protein PriA [Rhodopseudomonas palustris TIE-1]
 gi|192282358|gb|ACE98738.1| primosomal protein N' [Rhodopseudomonas palustris TIE-1]
          Length = 736

 Score =  634 bits (1635), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 322/731 (44%), Positives = 443/731 (60%), Gaps = 3/731 (0%)

Query: 4   SGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE 63
           + S       S V +L+  A+   Y Y VP  + ++ G +V VPL +R VLG+VW  +  
Sbjct: 6   TSSPASHAPASVVDVLVPVAIDQAYSYRVPRGLSLKPGDVVAVPLGAREVLGVVWAENPN 65

Query: 64  KYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKME 121
                  +L+ +    D PPL  ++   V WV+ YT S  G+V RM +        E+  
Sbjct: 66  PDPRLHNRLKDVAEKLDVPPLRDELRRMVDWVSTYTLSARGMVLRMCLRMGEHLGPERQR 125

Query: 122 EKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFE 181
             ++  G  P+  T AR R+L  + DG +  K D+ + + VS  VIDGL  +G ++    
Sbjct: 126 MGVRLVGSPPQRMTPARRRLLQILSDGLLHGKSDVAKEAGVSPGVIDGLVDEGTLQVEQM 185

Query: 182 VISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVA 240
                   P+  F+       Q    E +  L T G F  +LI GVTGSGKTEVY E VA
Sbjct: 186 PRENPAPEPDPDFAPADFSPEQARAAETMRGLVTAGGFQAALIDGVTGSGKTEVYFEAVA 245

Query: 241 AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV 300
            V+  G+Q LIL+PEI+LT   L+RF +RFGV+P EWHS L+   R + W  +A G   V
Sbjct: 246 EVIRQGRQSLILMPEIALTGQFLDRFAQRFGVRPLEWHSELTPRTRARNWASIAAGEARV 305

Query: 301 IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP 360
           +VG RSALFLP+  LGLI++DEEHD +YKQE+G  Y+ARDM++VR  I   P+VL SATP
Sbjct: 306 VVGARSALFLPYADLGLIIVDEEHDQAYKQEDGAHYHARDMAVVRASIAKIPIVLASATP 365

Query: 361 SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR 420
           S+E+ VN    RY  + L +R+    +P ++ ID+R +   +G+ +SP + + I   + R
Sbjct: 366 SVETEVNARKGRYTRIPLPSRFGGQHMPQIEAIDLRREPPMRGRFISPRLAEQIGFAIER 425

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
            EQ LLFLNRRGYAPLTLC+ CG+R  C  C  WLV+HR +++L CH CG S     +C 
Sbjct: 426 REQALLFLNRRGYAPLTLCRACGHRFACTICDAWLVDHRFRQRLVCHHCGFSMPRPPACP 485

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
            CG+ G ++A G G+ER+ EE    FP AR  +LSSDL      ++ +L+ IA+G +DII
Sbjct: 486 HCGAEGSLVAVGPGVERLQEEAANLFPNARTMVLSSDLITSIETMRAELNEIAEGRVDII 545

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQLVAKGHNFPR++LVGVVD DLGL+N D R++ERTFQLL+QV GRAGR   + +G +
Sbjct: 546 IGTQLVAKGHNFPRLNLVGVVDADLGLSNGDPRAAERTFQLLNQVIGRAGRDQGRGVGFL 605

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           Q +QP HPVM+ALV+ D ++FY SEI  RE    PPFGRLA++IIS       E +   L
Sbjct: 606 QTHQPEHPVMKALVACDREAFYASEIDIRERTLYPPFGRLASLIISAGDRPTAEGFGRQL 665

Query: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
              AP    + V GPAE+PL +++GRYRFRLL+   R  +L  +         K    L+
Sbjct: 666 ASAAPFDERVQVLGPAEAPLAVIKGRYRFRLLVKSVRGFDLSNYLRSWLAKGPKTKGNLK 725

Query: 721 VQFDIDPQNFL 731
           ++ D+DPQ+FL
Sbjct: 726 LEVDVDPQSFL 736


>gi|170738828|ref|YP_001767483.1| primosome assembly protein PriA [Methylobacterium sp. 4-46]
 gi|168193102|gb|ACA15049.1| primosomal protein N' [Methylobacterium sp. 4-46]
          Length = 730

 Score =  634 bits (1634), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 327/726 (45%), Positives = 445/726 (61%), Gaps = 15/726 (2%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +L+  A+   Y Y+VP  + +  G +V++PL  R  +G+VW   E         LR +  
Sbjct: 8   VLIPLALDTAYSYAVPDGLTLAEGDVVQIPLGPRETVGVVWSLRESA---SGGNLRRVTG 64

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEK---IQFTGIFPRIN 134
                 +   +   V W+A YT +P G    M +    E  + E     ++ TG+ P   
Sbjct: 65  KIADDGMRTPLRRLVDWIARYTLAPKGSALAMALRLPEEGPRGETARIGVRATGMPPSRV 124

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           T AR +VL    DG +  KR L   + VS+ V+DGL   GV++ +      V + P+   
Sbjct: 125 TPARTKVLAVAADGAVRGKRALSLEAGVSASVVDGLIDDGVLETVALAPERVAEPPDPDH 184

Query: 195 SLPILDKNQQDVVEQVV-----PLCTKGFA----VSLISGVTGSGKTEVYLEIVAAVLHL 245
               L + Q +    ++     P  T G A    V+L+ GVTGSGKTEVY E VA  +  
Sbjct: 185 PHAALSEAQAEAARALIASLTAPPRTGGPAGDGGVTLLEGVTGSGKTEVYFEAVAEAVRR 244

Query: 246 GKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVR 305
           G Q L+L+PEI+LT+  L+RF  RFG +PA WHS +    RE+I   VA G I V+VG R
Sbjct: 245 GVQSLVLMPEIALTAQFLDRFAARFGARPAAWHSGVGGRRRERIRAGVAAGEIPVVVGAR 304

Query: 306 SALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESR 365
           SALFLPF+ LGLIV+DEEH+ +YKQE+G+ Y+ARDM++VR K+E+  +VL SATPSIE+R
Sbjct: 305 SALFLPFRSLGLIVVDEEHEAAYKQEDGVCYHARDMAVVRAKLENAALVLASATPSIETR 364

Query: 366 VNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTL 425
           VN    RY  V L  R+    LP ++ IDMR + I +G+ LSP +   I  T  R EQ L
Sbjct: 365 VNAQRGRYRRVVLPERFGGRRLPEIRAIDMRREQIPRGRYLSPTLTAAIAETNGRGEQAL 424

Query: 426 LFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSS 485
           LFLNRRGYAPLTLC+ CG+R +C +CS WLVEHR ++ L CH CGH+    ++CV CG+ 
Sbjct: 425 LFLNRRGYAPLTLCRACGHRYQCPNCSTWLVEHRFRRALVCHHCGHAERRPEACVACGTF 484

Query: 486 GKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQL 545
             + ACG G+ERIAEEV   FP  R+ +LSSD  GG  RL+ +L  +A+G  DI++GTQL
Sbjct: 485 DTLAACGPGVERIAEEVAATFPERRVIVLSSDFPGGAERLRAELQTVAEGGCDIVVGTQL 544

Query: 546 VAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQP 605
           VAKGHNFP ++LVGV+D D+GL + D R++ERTFQLL QVTGRAGR       L+Q YQ 
Sbjct: 545 VAKGHNFPHLTLVGVLDADIGLASGDPRAAERTFQLLQQVTGRAGRGEKPGRALVQTYQA 604

Query: 606 THPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAP 665
            HPV+ AL+SGDA+ FYE E  AR    LPPFGRLAA+I+S  + +  E +   L + A 
Sbjct: 605 EHPVIAALISGDAERFYEEETAARSMAGLPPFGRLAALIVSAAEREAAEAHGRALAQVAE 664

Query: 666 RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDI 725
               ++V GPAE+PL +VRGR+RFRLL+  +R  ++Q +         K   ++RV  D+
Sbjct: 665 PPPGVMVLGPAEAPLALVRGRHRFRLLVKAEREVDIQSYLRDWLARGPKPRGSVRVGIDV 724

Query: 726 DPQNFL 731
           DPQ+FL
Sbjct: 725 DPQSFL 730


>gi|27375556|ref|NP_767085.1| primosome assembly protein PriA [Bradyrhizobium japonicum USDA 110]
 gi|27348693|dbj|BAC45710.1| primosomal protein N' [Bradyrhizobium japonicum USDA 110]
          Length = 736

 Score =  633 bits (1632), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 325/734 (44%), Positives = 454/734 (61%), Gaps = 6/734 (0%)

Query: 3   SSGSSVEGVVCSRVI-ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNS 61
           +S SS      +R++ +L+  A+   Y Y VP  M+++ G +V VPL  R VL +VW  +
Sbjct: 4   TSRSSTASANATRMVDVLVPVALDQTYSYKVPRGMELKAGDLVGVPLGPREVLAVVWAEN 63

Query: 62  EEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSET---E 118
                    +L+ +    D  PL  ++   V WVA+YT SP G+V RM +  + E    E
Sbjct: 64  ANPDPRLHNRLKEVSEKLDLQPLKPELRSVVDWVANYTLSPRGMVLRMCLR-MGENLGPE 122

Query: 119 KMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQ 178
           ++   ++  G  PR  T AR RV+  + D  +  K +  + + VS+ VIDGL  +G +  
Sbjct: 123 RVRPGVRLIGDPPRRLTPARQRVIAVLSDRLLHGKSEAAKEAGVSAGVIDGLVDEGTLTV 182

Query: 179 IFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLE 237
                 P   +P+  F  P     Q+  V+ +  L   G F V+L+ GVTGSGKTEVY E
Sbjct: 183 EPMPPPPPPPAPDPDFGRPDFTPLQRTAVDTMRALAANGTFHVALLDGVTGSGKTEVYFE 242

Query: 238 IVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGA 297
            VA  +  G+Q LIL+PEI+LT   L+RF +RFGV+P EWHS L+   R + W  ++ G+
Sbjct: 243 AVAEAIRRGRQSLILMPEIALTGQFLDRFAQRFGVRPIEWHSELTPRTRARNWAAISEGS 302

Query: 298 ISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVS 357
             V+VG RSALFLP+  LGLIV+DEEHD +YKQ+EG+ Y+ARDM++VR  I   P+VL S
Sbjct: 303 APVVVGARSALFLPYANLGLIVVDEEHDQAYKQDEGVHYHARDMAVVRAHIAKIPIVLAS 362

Query: 358 ATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHT 417
           ATPS+ES VN    RY  + L +R+    +PH++ IDMR +  A+G+ +SP +   IR  
Sbjct: 363 ATPSVESEVNARKNRYQRIALPSRFGGQHMPHIEAIDMRREPPARGRFISPRLAGEIRTA 422

Query: 418 LARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQ 477
           + R EQ LLFLNRRGYAPLTLC+ CG+R  C  C  WLV+HR +++L CH CG S     
Sbjct: 423 IERREQALLFLNRRGYAPLTLCRACGHRFACTICDAWLVDHRFRQRLVCHHCGFSMPRPH 482

Query: 478 SCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEI 537
            C  C +   ++A G G+ER+ EE    FP AR  +LSSDL      ++ +L+ IA+G +
Sbjct: 483 VCPNCSAEESLVAVGPGVERLQEEAAALFPEARTMVLSSDLITSIETMRSELAEIAEGRV 542

Query: 538 DIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSL 597
           DIIIGTQLVAKGHNFPR++LVGVVD DLGL+N D R++ERT+QLL+QV GRAGR   + +
Sbjct: 543 DIIIGTQLVAKGHNFPRLNLVGVVDADLGLSNGDPRAAERTWQLLNQVIGRAGREQGRGV 602

Query: 598 GLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYA 657
           G +Q +QP HPVM+AL++ D ++FY+SEI  RE    PPFGRLA++IIS       E + 
Sbjct: 603 GYLQTHQPDHPVMKALIACDREAFYDSEIDLRERTLYPPFGRLASLIISAGDRPSAEGFG 662

Query: 658 YNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSN 717
             L   APR   +VV GPAE+PL +++GRYRFR+L+   R  +L  +         K   
Sbjct: 663 RRLVALAPRDERVVVLGPAEAPLAVIKGRYRFRILVKSARGFDLSDYLRNWLAVCPKPKG 722

Query: 718 ALRVQFDIDPQNFL 731
             +++ D+DPQ+FL
Sbjct: 723 NQKLEVDVDPQSFL 736


>gi|90421703|ref|YP_530073.1| primosome assembly protein PriA [Rhodopseudomonas palustris BisB18]
 gi|90103717|gb|ABD85754.1| replication restart DNA helicase PriA [Rhodopseudomonas palustris
           BisB18]
          Length = 734

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 317/721 (43%), Positives = 449/721 (62%), Gaps = 7/721 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +LL  A+   Y Y VP  +++  G +V VPL +R V+G+VW ++         +L+ +
Sbjct: 16  VDVLLPVALDQAYSYRVPRGVELAPGDVVCVPLGAREVIGVVWADNPNPDPRLHNRLKDV 75

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFTGIFPRI 133
           +   D P    ++   V WVA+YT SP G V RM +        E++   ++  G  P+ 
Sbjct: 76  DSKLDVPRFREELRRLVDWVANYTLSPRGQVLRMTLRMGEHLGPERVRLGVRLVGPKPQR 135

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIK--QIFEVISPVVDSPN 191
            T AR R+++ + DG +  K D I+ +  S  V+DGL  +G +K   +   ++P    P+
Sbjct: 136 MTPARARLIEILSDGLLHGKSDAIKEAGCSPGVVDGLVDEGTLKVEPMARALAPPAPDPD 195

Query: 192 LYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
             F+ P     Q    + +  L   G F V+L+ GVTGSGKTEVY E VA ++  G+Q L
Sbjct: 196 --FAQPDFSPEQTTAADSLRALAAGGAFKVALLDGVTGSGKTEVYFEAVAEIIRRGEQTL 253

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           IL+PEI+LT   L+RF +RFGV+P EWHS L+   R + W  +A G   V+VG RSALFL
Sbjct: 254 ILMPEIALTGQFLDRFAQRFGVRPLEWHSELTPRTRARNWAAIAAGEAQVVVGARSALFL 313

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           P+ KLGLI++DEEHD +YKQ+EG  Y+ARDM++VR  I   P++L SATPS+ES VN   
Sbjct: 314 PYAKLGLIIVDEEHDQAYKQDEGAHYHARDMAVVRASIAKIPIILASATPSVESEVNARK 373

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            RY  V L +R+    +P ++ ID+R +   +G+ ++P + + I   + R EQ LLFLNR
Sbjct: 374 GRYQRVALPSRFGGQHMPQIEAIDLRREGPMRGRYIAPRLAEQIGIAIERREQALLFLNR 433

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPLTLC+ CG+R  C  C  WLV+HR +++L CH CG S    + C  C +   ++A
Sbjct: 434 RGYAPLTLCRACGHRFACTICDAWLVDHRFRQRLVCHHCGFSMPRPKLCPHCNAEESLVA 493

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G+ER+ EE  + FP AR  +LSSDL      ++ +L+ IA+G +DIIIGTQLVAKGH
Sbjct: 494 VGPGVERLQEEAQKLFPDARTMVLSSDLVTSIESMRSELTEIAEGRVDIIIGTQLVAKGH 553

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           NFPR++LVGV+D DLGL N D R++ERT+QLL+QV GRAGR     +G +Q +QP HPVM
Sbjct: 554 NFPRLNLVGVIDADLGLGNGDPRAAERTYQLLNQVIGRAGRDQGYGIGYLQTHQPEHPVM 613

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
           +ALV+ D ++FYESEI ARE    PPFGRLA++I+S       E +A  L   +P    I
Sbjct: 614 KALVACDREAFYESEIDARERTGYPPFGRLASLIVSAGDRPTAEGFARKLVAMSPLDERI 673

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            V GPAE+PL +++GRYRFR+L+   R  +L  +  Q      K +  L ++ D+DPQ+F
Sbjct: 674 KVLGPAEAPLAVIKGRYRFRILVKSARGVDLSSYLRQWLALGPKTTGNLNLEVDVDPQSF 733

Query: 731 L 731
           L
Sbjct: 734 L 734


>gi|85713712|ref|ZP_01044702.1| Primosomal protein n [Nitrobacter sp. Nb-311A]
 gi|85699616|gb|EAQ37483.1| Primosomal protein n [Nitrobacter sp. Nb-311A]
          Length = 738

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 322/712 (45%), Positives = 444/712 (62%), Gaps = 3/712 (0%)

Query: 23  AVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCP 82
           A+   Y Y VP  M+V  G +V VPL  R V+ +VW  +         +L+ I    D P
Sbjct: 27  AIDHAYSYRVPDGMEVRPGDVVTVPLGPREVVAVVWAENPAPDPRLHNRLKDISGKLDVP 86

Query: 83  PLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFTGIFPRINTVARLR 140
           PL  ++   + WVA+YT SP G+V RM +        E+    ++ +G  PR  T AR R
Sbjct: 87  PLRDELRTLIDWVANYTLSPRGMVMRMSLRMGEHLGPERARPGVRLSGEPPRRMTPARRR 146

Query: 141 VLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILD 200
           +L  + DG +  K D  + + VS+ V+DGL  +G +       SP    P+  F++P   
Sbjct: 147 LLAVLSDGLLRAKSDAAKEAGVSTGVVDGLVDEGTLATEPMPRSPPPPPPDPDFAVPDFS 206

Query: 201 KNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLT 259
           ++Q+  V+ +  L + G F V+L+ GVTGSGKTEVY E VA  +  GKQVLIL+PEI+LT
Sbjct: 207 RSQRAAVDAMRALASNGTFHVALLDGVTGSGKTEVYFEAVAETVRRGKQVLILMPEIALT 266

Query: 260 SAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIV 319
               +RF  RFG +P EWHS L+   R + W  +A G   V+VG RSALFLP+  LGLI+
Sbjct: 267 GQFRDRFAARFGERPLEWHSELTPRNRARNWAAIAAGEAQVVVGARSALFLPYAGLGLII 326

Query: 320 IDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLS 379
           +DEEHD +YKQ+EG+ Y+ARDM++VR  +   P+VL SATPS+ES VN    RY  + L+
Sbjct: 327 VDEEHDQAYKQDEGVRYHARDMAVVRAHVAKIPIVLASATPSVESEVNARKGRYQRIALT 386

Query: 380 TRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLC 439
           +R+    LP +++ID+R +  ++G+ +SP +   I   + R EQ LLFLNRRGYAPLTLC
Sbjct: 387 SRFGGQHLPRIELIDLRREGPSRGRFISPRLAGEILAAIERREQALLFLNRRGYAPLTLC 446

Query: 440 QVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIA 499
           + CG+R  C  C  WLV+HR +++L CH CG S      C  C +   ++A G G+ER+ 
Sbjct: 447 RGCGHRFACAICDAWLVDHRFRERLVCHHCGFSMPRPHQCPHCAAEQSLVAVGPGVERLQ 506

Query: 500 EEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVG 559
           EE    FP AR  +LSSDL      ++ +L+ IA+G +DIIIGTQLVAKGH+FPR++LVG
Sbjct: 507 EEAAALFPDARTMVLSSDLITSIETMRSELNDIAEGRVDIIIGTQLVAKGHHFPRLNLVG 566

Query: 560 VVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDAD 619
           V+D DLGL N D R++ERTFQLL+QV GR GR     +G +Q +QP HPVM+ALV+ D +
Sbjct: 567 VIDADLGLGNGDPRAAERTFQLLNQVIGRTGRETGHGIGYLQTHQPEHPVMKALVASDRE 626

Query: 620 SFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESP 679
           +FY SEI ARE    PPFGRLA++IIS       E++A  L   AP    I V GPAE+P
Sbjct: 627 AFYASEIAARERTGYPPFGRLASLIISAGDRPSAESFARRLAAIAPIDERIQVLGPAEAP 686

Query: 680 LFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           L ++RGRYRFRLL+   R  +L G+      +  K    L+++ D+DPQ+FL
Sbjct: 687 LALIRGRYRFRLLVKSARGVDLSGYLRDWLASAPKTRGNLKLEVDVDPQSFL 738


>gi|39933258|ref|NP_945534.1| primosome assembly protein PriA [Rhodopseudomonas palustris CGA009]
 gi|39652883|emb|CAE25625.1| putative priA family helicase (primosomal protein N', replication
           factor Y) [Rhodopseudomonas palustris CGA009]
          Length = 736

 Score =  632 bits (1631), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 319/722 (44%), Positives = 442/722 (61%), Gaps = 3/722 (0%)

Query: 13  CSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKL 72
            S V +L+  A+   Y Y VP  + ++ G +V VPL +R VLG+VW  +         +L
Sbjct: 15  ASVVDVLVPVAIDQAYSYRVPRGLSLKPGDVVAVPLGAREVLGVVWAENPNPDPRLHNRL 74

Query: 73  RPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFTGIF 130
           + +    D PPL  ++   V WV+ YT S  G+V RM +        E+    ++  G  
Sbjct: 75  KDVAEKLDVPPLRDELRRMVDWVSTYTLSARGMVLRMCLRMGEHLGPERQRMGVRLVGSP 134

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
           P+  T AR R+L+ + DG +  K D+ + + VS  VIDGL  +G ++            P
Sbjct: 135 PQRMTPARRRLLEILSDGLLHGKSDVAKEAGVSPGVIDGLVDEGTLQVEPMPRENPAPEP 194

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
           +  F+       Q    E +  L T G F  +LI GVTGSGKTEVY E VA V+  G+Q 
Sbjct: 195 DPDFAPADFSPEQARAAETMRGLVTAGGFQAALIDGVTGSGKTEVYFEAVAEVVRQGRQS 254

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           LIL+PEI+LT   L+RF +RFGV+P EWHS L+   R + W  +A G   V+VG RS+LF
Sbjct: 255 LILMPEIALTGQFLDRFAQRFGVRPLEWHSELTPRTRARNWASIAAGEARVVVGARSSLF 314

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LP+  LGLI++DEEHD +YKQE+G  Y+ARDM++VR  I   P+VL SATPS+E+ VN  
Sbjct: 315 LPYADLGLIIVDEEHDQAYKQEDGAHYHARDMAVVRASIAKIPIVLASATPSVETEVNAR 374

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
             RY  + L +R+    +P ++ ID+R +   +G+ +SP + + I   + R EQ LLFLN
Sbjct: 375 KGRYTRIPLPSRFGGQHMPQIEAIDLRREPPMRGRFISPRLAEQIGFAIERGEQALLFLN 434

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC+ CG+R  C  C  WLV+HR +++L CH CG S     +C  CG+ G ++
Sbjct: 435 RRGYAPLTLCRACGHRFACTICDAWLVDHRFRQRLVCHHCGFSMPRPPACPHCGAEGSLV 494

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
           A G G+ER+ EE    FP AR  +LSSDL      ++ +L+ IA+G +DIIIGTQLVAKG
Sbjct: 495 AVGPGVERLQEEAANLFPNARTMVLSSDLITSIETMRAELNEIAEGRVDIIIGTQLVAKG 554

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           HNFPR++LVGVVD DLGL+N D R++ERTFQLL+QV GRAGR   + +G +Q +QP HPV
Sbjct: 555 HNFPRLNLVGVVDADLGLSNGDPRAAERTFQLLNQVIGRAGRDQGRGVGFLQTHQPEHPV 614

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           M+AL++ D ++FY SEI  RE    PPFGRLA++IIS       E +   L   AP    
Sbjct: 615 MKALIACDREAFYASEIDIRERTLYPPFGRLASLIISAGDRPTAEGFGRQLASAAPFDER 674

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           + V GPAE+PL +++GRYRFRLL+   R  +L  +         K    L+++ D+DPQ+
Sbjct: 675 VQVLGPAEAPLAVIKGRYRFRLLVKSVRGFDLSNYLRSWLAKGPKTKGNLKLEVDVDPQS 734

Query: 730 FL 731
           FL
Sbjct: 735 FL 736


>gi|209883740|ref|YP_002287597.1| primosomal protein N' [Oligotropha carboxidovorans OM5]
 gi|209871936|gb|ACI91732.1| primosomal protein N' [Oligotropha carboxidovorans OM5]
          Length = 805

 Score =  632 bits (1630), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 324/719 (45%), Positives = 449/719 (62%), Gaps = 3/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+  A+   Y YSVP  + + +G +V VPL +R V  +VW  +         +L+ I
Sbjct: 87  VDVLVPVALDQTYSYSVPEGLDLTVGDVVTVPLAAREVTAVVWAENPNPDPRLHNRLKDI 146

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFTGIFPRI 133
               D PPL  ++  FV WV+ YT +  G+VARM +        E++   ++  G  P  
Sbjct: 147 SGKLDVPPLREELRRFVDWVSTYTLASRGMVARMTLRMGEHLGPERVRLGVRLVGAPPAR 206

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR RVLD + DG +  K +  + + VS  VI+GL  +G +          +  P+  
Sbjct: 207 MTAARARVLDLLSDGLLRPKSEAAKEAGVSVSVIEGLVDEGTLTVEPMPREKPMQPPDPA 266

Query: 194 FSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           F+ P     Q     ++  L  K  FAV+L+ GVTGSGKTEVY E VA ++  G+Q LIL
Sbjct: 267 FAEPDFSPEQSAAAAEMHALAQKDDFAVALLDGVTGSGKTEVYFEAVAEIIRKGRQALIL 326

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI+LT   L+RF +RFGV+P EWHS L+   R + W  VA G   ++VG RSALFLP+
Sbjct: 327 MPEIALTGQFLDRFSQRFGVRPIEWHSELTPRTRARNWLAVANGEAQIVVGARSALFLPY 386

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
             LGLIV+DEEHD +YKQ +G  Y+ARDM++VRG I   PVVL SATPS+E+ VN  + R
Sbjct: 387 ADLGLIVVDEEHDQAYKQSDGAHYHARDMAVVRGHIAKIPVVLSSATPSVETEVNARTGR 446

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  + L +R+    +P ++ ID+R +   +G+ +SP + + ++  + R EQ LLFLNRRG
Sbjct: 447 YTRIALPSRFGGQHMPQIEAIDLRREGPPRGRFISPPLAEAVKFAVERREQALLFLNRRG 506

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+ CG+R  C  C  WLV+HR +++L CH CG S      C  CG+   + A G
Sbjct: 507 YAPLTLCRACGHRFSCNICDAWLVDHRFRQRLVCHHCGFSMPRPHQCPQCGAEESLAAIG 566

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ER+ EEV   FP AR  +LSSDL      ++ +L+ IA+G +DIIIGTQLVAKGHNF
Sbjct: 567 PGVERLQEEVANLFPEARTMVLSSDLITDIETMRSELNEIAEGRVDIIIGTQLVAKGHNF 626

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           PR++LVGVVD DLGL N D R++ERTFQLL+QV GRAGR   + +G +Q +QP HPVM+A
Sbjct: 627 PRLNLVGVVDADLGLGNGDPRAAERTFQLLNQVIGRAGREQGRGVGYLQTHQPEHPVMKA 686

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           LV+ D  +FY+SEI ARE    PPFGRLAA+II+     + E +A  L   APR   ++V
Sbjct: 687 LVASDRKAFYDSEIEARERAAYPPFGRLAALIIAAANRPDAEGFARKLVGLAPREERVIV 746

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL +++GR+RFR+L+  +R  +L G+         K   +L ++ DIDPQ+FL
Sbjct: 747 LGPAEAPLAVIKGRHRFRILVKSQRVFDLSGYLRTWLAAAPKTKGSLTLEVDIDPQSFL 805


>gi|115522314|ref|YP_779225.1| primosome assembly protein PriA [Rhodopseudomonas palustris BisA53]
 gi|115516261|gb|ABJ04245.1| replication restart DNA helicase PriA [Rhodopseudomonas palustris
           BisA53]
          Length = 732

 Score =  630 bits (1624), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 322/729 (44%), Positives = 454/729 (62%), Gaps = 3/729 (0%)

Query: 6   SSVEGVVCSRVI-ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEK 64
           S+   V  +RV+ +L+  A+   Y Y VP+ + ++ G +V VPL +R V+G+VW  +   
Sbjct: 4   STRRPVAATRVVDVLVPVALDQAYSYRVPAELDLQPGDVVGVPLGAREVIGVVWAENPNP 63

Query: 65  YKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEE 122
                 +L+ I    D P    ++   V WVA+YT SP G V RM +        E++  
Sbjct: 64  DPRLHNRLKDIAEKLDLPRFREELRSLVDWVANYTLSPRGQVLRMTLRMGEHLGPERVRL 123

Query: 123 KIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEV 182
            ++  G  P+  T AR R+LD + DG +  K +L + +  S+ VIDGL  +G +      
Sbjct: 124 GVRLIGPPPQRLTPARRRLLDIVSDGLLHGKSELAKEAGCSASVIDGLVDEGTLAVEHMP 183

Query: 183 ISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAV 242
            +    +P+  F+ P     Q+   E++  L   GF V+L+ GVTGSGKTEVY E +A V
Sbjct: 184 RAAAPPAPDPAFAAPDFSPEQRLAAERLRQLVAGGFEVALLDGVTGSGKTEVYFEAIAEV 243

Query: 243 LHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIV 302
           L  G+QVLIL+PEI+LT   L+RF  RFG +P EWHS L+   R + +  +  G   V+V
Sbjct: 244 LKRGEQVLILMPEIALTGQFLDRFAARFGARPLEWHSELTPRTRARNFAAITAGEAPVVV 303

Query: 303 GVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSI 362
           G RSALFLP+ KLGL+++DEEHD +YKQE+G  Y+ARDM++VR  I   P+VL SATPS+
Sbjct: 304 GARSALFLPYAKLGLLIVDEEHDQAYKQEDGAHYHARDMAVVRASIAKIPIVLASATPSV 363

Query: 363 ESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNE 422
           E+ VN    RY  V L +R+    +P ++ ID+R +   +G+ ++P + + I   + R E
Sbjct: 364 ETEVNARKGRYQRVPLPSRFGGQHMPQIEAIDLRQEGPGRGRFIAPRLAEQIGLAIERRE 423

Query: 423 QTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVC 482
           Q LLFLNRRGYAPLTLC+ CG+R  C  C  WLV+HR +++L CH CG S      C  C
Sbjct: 424 QALLFLNRRGYAPLTLCRACGHRFACTICDAWLVDHRFRQRLVCHHCGFSMPRPHLCPHC 483

Query: 483 GSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIG 542
           G+   + A G G+ER+ EE    FP AR  +LSSDL      ++ +L+ IA+G +DIIIG
Sbjct: 484 GAEESLAAIGPGVERLQEEAAALFPAARTMVLSSDLITSIEAMRSELNEIAEGRVDIIIG 543

Query: 543 TQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQA 602
           TQLVAKGHNFPR++LVGV+D DLGL N D R++ERTFQLL+QV GRAGR   + +G +Q 
Sbjct: 544 TQLVAKGHNFPRLNLVGVIDADLGLGNGDPRAAERTFQLLNQVIGRAGRDQGRGVGFLQT 603

Query: 603 YQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE 662
           +QP HPVM+ALV+ D ++FYESEI +RE    PPFGRLA++IIS       E +A  L  
Sbjct: 604 HQPEHPVMKALVACDREAFYESEIDSRERTGYPPFGRLASLIISAGDRPSAEGFARKLAA 663

Query: 663 HAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQ 722
            AP    I V GPAE+PL +++GRYR+R+L+   R+ +L G+  Q      K +  L+++
Sbjct: 664 SAPVDERIKVLGPAEAPLAVIKGRYRYRILVKSPRSLDLSGYLRQWLAAAPKTTGNLKLE 723

Query: 723 FDIDPQNFL 731
            D+DPQ+FL
Sbjct: 724 VDVDPQSFL 732


>gi|323137907|ref|ZP_08072982.1| primosomal protein N' [Methylocystis sp. ATCC 49242]
 gi|322396910|gb|EFX99436.1| primosomal protein N' [Methylocystis sp. ATCC 49242]
          Length = 760

 Score =  627 bits (1618), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 323/736 (43%), Positives = 441/736 (59%), Gaps = 22/736 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L   AV  PY Y  P A+ ++ G  V++PL +R   G+VW  S +        L+ +
Sbjct: 27  VEVLPPVAVDAPYSYFAPPALGLQPGDSVKIPLGTREAYGVVW--SVDAAPAARGNLKTV 84

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF--TGIFPRI 133
               D P LS+++ +F+ W+A YT +P G+  R+   A  E      +  +  TG  P  
Sbjct: 85  IARLDRPRLSQKLRDFIDWLARYTLAPRGMALRLATRAAEEAAPDAPRTLYRATGATPER 144

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T  R RVL   + G  + K+ L  A+  S  VID L   G ++ I     P+    +  
Sbjct: 145 LTPTRGRVLAAAEGGMAFTKKALADAAACSPGVIDALVDDGALETIAAPPDPIALPLDPD 204

Query: 194 FSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
              P+L+  Q    + +        +   L+ GVTG+GKTEVY E +AA L  G Q L++
Sbjct: 205 HGAPLLEPAQLAAAQALTAAVRAHAYKPFLLEGVTGAGKTEVYFEAIAAALKEGGQALVM 264

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI+LT+  LERF  RFG KPAEWHS +S   R +IWR  A G +SV+ G RSALFLPF
Sbjct: 265 MPEIALTAQFLERFATRFGEKPAEWHSGVSPRKRARIWRAAATGDLSVVAGARSALFLPF 324

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
           + L LIV+DEEH+ +YKQ++G+ Y+ARDM++VR ++E   + L SATPSIE+RVN    R
Sbjct: 325 RDLRLIVVDEEHEGAYKQDDGVSYHARDMAVVRARMEDATIALASATPSIETRVNAQRGR 384

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  + L  R  +  +P L+ IDMR +   +G+ ++P +   +  T++R EQ LLFLNRRG
Sbjct: 385 YGHLKLDARAGSRPMPLLESIDMRVEGPPRGRWIAPRLALAVGETISRGEQALLFLNRRG 444

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+VCG+R +C +C  WLVEHR ++ L CH CGH       C  C S   + ACG
Sbjct: 445 YAPLTLCRVCGHRFRCENCDAWLVEHRFRRALVCHHCGHVERRPDVCPECESEDSLAACG 504

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ER+AEE    FP ARI +LSSD  GG  RL+ +L  IAKG  DI+IGTQLVAKGHNF
Sbjct: 505 PGVERLAEEAATLFPDARILVLSSDFPGGAERLRRELEEIAKGAFDIVIGTQLVAKGHNF 564

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LVGVVD DLGL + D R++ERTFQLL+QVTGRAGR       LIQ +QP HPV+ A
Sbjct: 565 PHLTLVGVVDADLGLGSGDPRAAERTFQLLNQVTGRAGRGDKPGRALIQTFQPDHPVIAA 624

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEV-----------------EN 655
           L+SGDA+ FY  EI  RE   LPPFGRLAA+I+S                          
Sbjct: 625 LLSGDAEKFYAQEIALRERAGLPPFGRLAALIVSARAAAAAEAHARAIARAAHDLPPSPR 684

Query: 656 YAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKR 715
           Y        P + +I++ GPAE+P+ ++RGRYR+RLL+   R++++Q F   +   + K 
Sbjct: 685 YRVAALGGLPEADEIMLLGPAEAPIALIRGRYRYRLLVKAPRSADVQSFLRDLIGASPKE 744

Query: 716 SNALRVQFDIDPQNFL 731
              +RVQ D+DPQNF+
Sbjct: 745 RGGVRVQIDVDPQNFM 760


>gi|92116156|ref|YP_575885.1| primosome assembly protein PriA [Nitrobacter hamburgensis X14]
 gi|91799050|gb|ABE61425.1| replication restart DNA helicase PriA [Nitrobacter hamburgensis
           X14]
          Length = 738

 Score =  623 bits (1607), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 321/719 (44%), Positives = 444/719 (61%), Gaps = 3/719 (0%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L+  A+   Y Y VP  M+V  G +V VPL  R V+ +VW  +         +L+ I
Sbjct: 20  VDVLVPVAIDQAYSYRVPRGMEVAPGDLVTVPLGPREVIAVVWAENPAPDPRLHNRLKDI 79

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFTGIFPRI 133
               D PPL  ++   V WVA+YT S  G+V RM +    +   E++   ++ TG  P+ 
Sbjct: 80  GEKLDLPPLKDELRTLVDWVANYTLSARGMVMRMSLRMGEQLGPERVRPGVRLTGAPPQR 139

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T AR R++  + DG +  K D  + + VS+ V+DGL  +  +        P    P+  
Sbjct: 140 MTPARQRLIAVLSDGLLHGKSDAAKEAGVSAGVVDGLVDERTLTVEPMPRPPPPPPPDPD 199

Query: 194 FSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           F++P   ++Q+  V+ +  L + G F V+L+ GVTGSGKTEVY E VA  +  GKQ LIL
Sbjct: 200 FAVPDFSRSQRTAVDAMRALASNGTFHVALLDGVTGSGKTEVYFEAVAETIRRGKQALIL 259

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI LT    +RF  RFG +P EWHS L+   R + W  +A G   V+VG RSALFLP+
Sbjct: 260 MPEIVLTGQFRDRFAARFGERPLEWHSELTPRTRARNWAAIAAGEGQVVVGARSALFLPY 319

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
             LGLI++DEEHD +YKQ+EG  Y+ARDM++VR  I   P+VL SATPS+ES VN    R
Sbjct: 320 ADLGLIIVDEEHDQAYKQDEGTHYHARDMAVVRAHIAKIPIVLASATPSVESEVNARKGR 379

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  V L++R+    +P ++VID+R +   +G+ +SP +   +R  + R EQ LLFLNRRG
Sbjct: 380 YQRVALTSRFGGQHMPQIEVIDLRREGPPRGRFISPRLAGEVRAAIERREQALLFLNRRG 439

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+ CG+R  C  C  WLV+HR +++L CH CG S      C  C +   ++A G
Sbjct: 440 YAPLTLCRACGHRFACTICDAWLVDHRFRQRLVCHHCGFSMPRPHQCPHCAAEETLVAVG 499

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ER+ EE    FP AR  +LSSDL      ++ +L+ IA+G +DIIIGTQLVAKGH+F
Sbjct: 500 PGVERLQEEAAALFPDARTLVLSSDLVTSIETMRSELNDIAEGRVDIIIGTQLVAKGHHF 559

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           PR++LVGV+D DLGL N D R++ERTFQLL+QV GR GR     +G +Q +QP HPVM+A
Sbjct: 560 PRLNLVGVIDADLGLGNGDPRAAERTFQLLNQVIGRTGREQGHGVGYLQTHQPEHPVMRA 619

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           LV+ D ++FY SEI ARE    PPFGRLA++IIS       E++A  L   AP    I V
Sbjct: 620 LVASDREAFYASEIEARERSGYPPFGRLASLIISAGDRPTAESFARRLAAIAPIDERIQV 679

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            GPAE+PL +++GRYRFRLL+   R  +L G+  +      K    L+++ D+DPQ+FL
Sbjct: 680 LGPAEAPLAVIKGRYRFRLLVKSARGVDLSGYLREWLAAGPKTKGNLKLEIDVDPQSFL 738


>gi|294678727|ref|YP_003579342.1| primosomal protein N` [Rhodobacter capsulatus SB 1003]
 gi|294477547|gb|ADE86935.1| primosomal protein N` [Rhodobacter capsulatus SB 1003]
          Length = 727

 Score =  614 bits (1584), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 322/741 (43%), Positives = 459/741 (61%), Gaps = 24/741 (3%)

Query: 1   MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYN 60
           M+  G   EG   +RV +L  + +  P  Y  P       G+ V VPL  R V+G++W  
Sbjct: 1   MSEPGFFPEG---ARVSVLTAEPIGKPLDYLAPEGGCFP-GAFVEVPLGPRRVVGVIWGA 56

Query: 61  SEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV--SALSETE 118
            + ++  ++ KLRP+  V D PP+  ++ EF+  +  YT + +  V R+      L +  
Sbjct: 57  GDGRF--EAGKLRPVSRVLDVPPMRTELQEFLIRMGSYTMTSLPAVLRLATRTPGLFDPP 114

Query: 119 KMEEKIQFTGIFPRINTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVI 176
                 +     P   T AR +VL  ++D  G  +   +L + + V+  V+ GL   G I
Sbjct: 115 GARRIYRLGATAPGKLTEAREKVLAVLRDHGGAGFYLTELAQLAGVTPQVVKGLVKLGAI 174

Query: 177 KQIFEVISPVVDSP--NLYFSLP--ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKT 232
           ++  +      D P   L F+LP  +L ++Q         L  +GF V+L+ GVTGSGKT
Sbjct: 175 EETEQP----RDLPLARLDFTLPGKVLSEDQATAA---AALKGEGFGVTLLKGVTGSGKT 227

Query: 233 EVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQ 292
           EVYLE VA  L  G+Q L+LLPEI+LTS  L R + RFG +P EWHS ++ S R ++WR 
Sbjct: 228 EVYLEAVADCLRRGRQALVLLPEIALTSEFLSRVEARFGARPGEWHSGVTQSERRRLWRM 287

Query: 293 VARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFP 352
           VA G   ++VG RSALFLPF+ LGLIV+DEEHD SYKQEEG LYNARDM+++R  +    
Sbjct: 288 VATGGAQMVVGARSALFLPFQDLGLIVVDEEHDTSYKQEEGALYNARDMAVLRASLAGSQ 347

Query: 353 VVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMID 412
           VVL SATPS+ES VN  S +Y  + L+ R+  S LP ++ IDMR + I     +SP ++ 
Sbjct: 348 VVLASATPSLESWVNAASGKYRRIDLAARFGASELPEMRTIDMREERIESVHWISPSLVG 407

Query: 413 GIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHS 472
            ++ TL+R EQ +LFLNRRGYAP+TLC+ CG ++ C HC   +VEHR  K+L CHQCG +
Sbjct: 408 AVQATLSRGEQAMLFLNRRGYAPVTLCRACGQQIGCDHCDARMVEHRFLKRLVCHQCGET 467

Query: 473 AIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAI 532
                +C  CG  GK+   G G+ER+AEEV E FP AR+++LSSDL G    L+  +  I
Sbjct: 468 KPIPTACPACGVEGKLAPVGPGVERLAEEVAERFPTARVAVLSSDLFGSARALKEAVENI 527

Query: 533 AKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRF 592
           A+G  DI+IGTQ+VAKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR 
Sbjct: 528 AQGGADILIGTQIVAKGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRA 587

Query: 593 GLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQE 652
               L L+Q YQP HPV++A++ GD ++F+++E   R + N+PPFGR+A +I+SG + + 
Sbjct: 588 EKPGLALLQTYQPEHPVIRAILGGDEEAFWKAEAEGRRAANVPPFGRMAGIILSGAEIEP 647

Query: 653 VENYAYNLKEH-AP-RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD 710
           +  Y   L +H  P R     ++GPA +P+  +RGR+R RLLI   + + LQ    + + 
Sbjct: 648 LFAYGNALAQHDGPLRRIGAQLYGPAPAPIARIRGRHRVRLLIRADKTAPLQQAI-RAWL 706

Query: 711 NTIKRSNALRVQFDIDPQNFL 731
             +K+ N++R+  DIDPQ+FL
Sbjct: 707 RGVKQPNSVRLAIDIDPQSFL 727


>gi|84501639|ref|ZP_00999811.1| primosomal protein N' [Oceanicola batsensis HTCC2597]
 gi|84390260|gb|EAQ02819.1| primosomal protein N' [Oceanicola batsensis HTCC2597]
          Length = 731

 Score =  613 bits (1581), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 313/728 (42%), Positives = 451/728 (61%), Gaps = 21/728 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P+   ++ G+ V+VPL  R VLG+VW   +  Y +   K+RP+
Sbjct: 13  VSVLTTQPIDRLLDYRAPAGGCMQ-GAYVQVPLGPRQVLGVVWGPGQGNYDLS--KIRPV 69

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  +M EF+    DYT +PM  + R+   A  LS+   M++  +     P  
Sbjct: 70  TRVLDAAPMRDEMREFLTRAGDYTLTPMSAMLRLATRAPGLSDPPSMQKVYRLGQAEPDR 129

Query: 134 NTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQ---IFEVISPVVD 188
            T AR RVL+ ++D  G  + +++L   + VS+ VI GL  QG +++     +   P +D
Sbjct: 130 MTDARRRVLEVLRDYGGLSFTQKELAEMAGVSTGVIKGLVQQGAVREEQAPRDTPYPRMD 189

Query: 189 SPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           +       P+ D            L   G+  +L+ GVTGSGKTEVYLE VAA L  G+Q
Sbjct: 190 TDR--HGKPLTDSQAAAADRLSAALQDGGYGTTLLRGVTGSGKTEVYLEAVAACLAAGRQ 247

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
            L+LLPEI+L+   L R ++RFG KP EWHS ++ + R + W+ V +G   ++VG RSAL
Sbjct: 248 ALVLLPEIALSEQFLVRVEQRFGAKPVEWHSGVTMTERRRAWKMVGQGQAELVVGARSAL 307

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPF+ LGLIV+DEEHD SYKQE+G+LYNARDM+++R  I    VVL SATPS+E+  N 
Sbjct: 308 FLPFRDLGLIVVDEEHDTSYKQEDGVLYNARDMAVLRASIAGARVVLASATPSLETWANA 367

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
            + +Y  + L  RY  + LP ++ IDMR + I  G+ +SP +   ++  +A+ EQ+LLFL
Sbjct: 368 DAGKYDRLDLGARYGAAVLPEMRAIDMRAERIEPGRWISPALAHAVQRRIAKGEQSLLFL 427

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAP+TLC+ CG ++ C HC   +VEHR  K+L CHQCG +    ++C  CG  G++
Sbjct: 428 NRRGYAPVTLCRACGEQIGCDHCDARMVEHRFLKRLVCHQCGETRPMPEACPACGVEGRL 487

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
              G G+ER+AEEV E FP AR ++LSSDL      L+  ++ IA+G++DI+IGTQLVAK
Sbjct: 488 APIGPGVERLAEEVAEVFPEARAAVLSSDLFSSARALKEAIAGIAEGDVDIVIGTQLVAK 547

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR       L+Q +QP HP
Sbjct: 548 GHNFPNLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAETPGEALLQTHQPDHP 607

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           V++A+++GD ++F+ +E  AR    +PP+GRLAAVI+S T+ +       +L   A R+ 
Sbjct: 608 VIRAILTGDEEAFWTAEATARRLAGMPPYGRLAAVILSATEARTAFEAGQDL---ARRTG 664

Query: 669 DIV-----VFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQF 723
            +      VFGPA +P+  +RGR+R RLL+   +   LQ   +Q +   ++    LRV  
Sbjct: 665 PLARLQAQVFGPAAAPIARIRGRHRVRLLVKADKGVALQQAMAQ-WVGQLRPDRDLRVAV 723

Query: 724 DIDPQNFL 731
           DIDPQ+F 
Sbjct: 724 DIDPQSFF 731


>gi|23014822|ref|ZP_00054620.1| COG1198: Primosomal protein N' (replication factor Y) - superfamily
           II helicase [Magnetospirillum magnetotacticum MS-1]
          Length = 733

 Score =  611 bits (1575), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 317/720 (44%), Positives = 431/720 (59%), Gaps = 7/720 (0%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           RV ++L   + G Y Y+V     +  G  V VPL  R V G+VW   + K  +D  KLRP
Sbjct: 18  RVAVMLPLPLGGAYDYAV-GDQPLRSGDFVEVPLAGRLVAGVVWGMGDGK--VDGAKLRP 74

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKME--EKIQFTGIFPR 132
           +      P L      F+ WVA YT +P G V +M +S  S  E       ++     P 
Sbjct: 75  VARKLAAPSLPEVSRRFIDWVASYTMAPPGAVLKMAMSVASALEAAPPIHALRLAPAIPE 134

Query: 133 IN-TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPN 191
              T AR +V++           DL R + V   V+ GL   G ++ +     P    P+
Sbjct: 135 FKETAARRKVMETALRLPPLSAADLAREAGVGPAVVKGLVEAGALESVELPAPPAFAPPD 194

Query: 192 LYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           L      L   QQ   + +V     GF+V +I GVTGSGKTEVY E VAA L LGKQVL+
Sbjct: 195 LTAPRAELSPGQQAGADTLVAALDGGFSVIVIDGVTGSGKTEVYFEAVAAALGLGKQVLV 254

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           LLPEI+L++  L+RF++RFGVKPA WHS L  + R K WR VA G  +++VG RS LFLP
Sbjct: 255 LLPEIALSAQWLDRFRRRFGVKPALWHSDLGDATRRKTWRAVASGEAAIVVGARSGLFLP 314

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           F+ LGLIV+DEEHD ++KQE+ + Y+ARDM++VR ++  FP VL SATPS+ES  N  + 
Sbjct: 315 FQNLGLIVVDEEHDQAFKQEDHVCYHARDMAVVRARLGDFPAVLASATPSLESLANVQAG 374

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           RY  VHL  R+  + LP +  +D+R     +G+ LSP ++  +   LA  EQ +L+LNRR
Sbjct: 375 RYGLVHLPDRHAGAVLPDIVPVDLRRHPPPKGRWLSPLLVTALEEVLAAGEQAMLYLNRR 434

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIAC 491
           GYAPLTLC+ CG+RL+C HC+ WLVEHRS  +L CH CGH       C  C + G   AC
Sbjct: 435 GYAPLTLCRTCGHRLQCPHCTAWLVEHRSAGRLICHHCGHFIRLPPKCPECEAEGSFAAC 494

Query: 492 GFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHN 551
           G G+ER+AEE    FP AR+++++SD   G    +  +  ++  EID+++GTQ+VAKG++
Sbjct: 495 GPGVERVAEEAALLFPNARVAVMTSDTCSGPHAAEEFVRRVSDHEIDLLVGTQIVAKGYH 554

Query: 552 FPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQ 611
           FP ++LVGVVD DLGL   DLR+ ERT QLLSQV GRAGR       L+Q YQP HPV+ 
Sbjct: 555 FPLLTLVGVVDADLGLDGGDLRAGERTHQLLSQVAGRAGRAERPGRVLLQTYQPDHPVLG 614

Query: 612 ALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIV 671
           AL SG  D+F   E  AR    +PP+GRLAA+I+SG     VE YA +L + APR+  + 
Sbjct: 615 ALRSGQRDAFIAREAEARRDTGMPPYGRLAALILSGPDVSVVEAYARSLAKAAPRAEGVQ 674

Query: 672 VFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           V GPA +P+ ++RG++R R L+   R+ NLQ               ++RVQ D+DP +F+
Sbjct: 675 VLGPALAPMALLRGKHRRRFLVQSARSVNLQALIRDWLARCAP-PKSVRVQVDVDPYSFM 733


>gi|144898919|emb|CAM75783.1| primosome assembly protein PriA [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 732

 Score =  609 bits (1570), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 325/721 (45%), Positives = 438/721 (60%), Gaps = 7/721 (0%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR 73
           SRV +LL   ++G Y Y +     ++ G  V VPL  R V+G+VW   E    +   KL+
Sbjct: 16  SRVAVLLPLPLAGLYDY-LTGVESLQAGDFVAVPLGRREVIGVVW--GEATGGVAEAKLK 72

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTG--IFP 131
           P+     CPPL     +F+ WVA YT +P G V RM +S     E + + +      + P
Sbjct: 73  PVIRRLACPPLPAISRKFIDWVAGYTIAPPGAVLRMAMSVPQALEPLRDLVACRAAMVLP 132

Query: 132 RIN-TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
            I  T AR RVL    D       DL R + V   V+ GL   G ++ +     P   SP
Sbjct: 133 EIKLTEARRRVLRVAGDLPPLLPADLAREAGVGPAVVKGLLEAGALEPVPMAPPPPFASP 192

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           +     P L   QQ   + +      GF+VS+I GVTGSGKTEVY E +AA L  G+Q L
Sbjct: 193 DPDHPGPSLSPGQQAAADHLRQAVAGGFSVSVIDGVTGSGKTEVYFEAIAAALAAGRQSL 252

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           ILLPEI+L++  LERF++RFGV+PA+WHS LS + R   WR V  G   V+VG RSALFL
Sbjct: 253 ILLPEIALSAQWLERFRRRFGVEPAQWHSELSDAKRRDTWRAVVAGTAKVVVGARSALFL 312

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           P+K+LGL+++DEEHD  +KQ++G+ Y+ARDM++VRG++   PVVL SATPS+E+  N  S
Sbjct: 313 PYKELGLLIVDEEHDAGFKQDDGVAYHARDMAVVRGQLGGCPVVLASATPSMETVANIAS 372

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            RY  +HL  R+  +ALP + +ID+R     +G  LSP ++  +  TLA  EQ +LFLNR
Sbjct: 373 GRYTRLHLPDRHAGAALPAMDLIDLRRDPPPRGFWLSPLLVKAVEDTLAAGEQAMLFLNR 432

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPLTLC+ CG+RL+C HC+ WLVEHR   ++ CH CGH       C  C +     A
Sbjct: 433 RGYAPLTLCRKCGHRLQCPHCTAWLVEHRGAGRMVCHHCGHHVRPPTKCPQCEAEDSFAA 492

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
           CG G+ERIAEE    FP ARI +++SD   G  +    +  +A+ EID++IGTQ+VAKG+
Sbjct: 493 CGPGVERIAEEAAHRFPNARIGVMASDTVTGPQQAADFVRRVAEHEIDLLIGTQIVAKGY 552

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LVGVVD DLGL   DLR+ ERT QLL QV GRAGR       L+Q +QP HPVM
Sbjct: 553 HFPLLTLVGVVDADLGLDGGDLRAGERTHQLLCQVAGRAGRAERPGRVLLQTFQPAHPVM 612

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
            AL SG  D F E+E  AR    +PP+GRLAA+I+SG +   V+++A  L   AP     
Sbjct: 613 VALTSGGRDDFIEAEAEARRLAGMPPYGRLAALIVSGPEAGAVDDFARKLARAAPSLEGF 672

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            V GPA +PL ++RGR+R R LI  +R+  L G   + +   +   +A+RVQ D+DP  F
Sbjct: 673 QVIGPAPAPLALLRGRHRRRFLIKVRRDVALHGPL-RAWLAAVPAPSAIRVQVDVDPYGF 731

Query: 731 L 731
           L
Sbjct: 732 L 732


>gi|83313352|ref|YP_423616.1| primosome assembly protein PriA [Magnetospirillum magneticum AMB-1]
 gi|82948193|dbj|BAE53057.1| Primosomal protein N' (replication factor Y) - superfamily II
           helicase [Magnetospirillum magneticum AMB-1]
          Length = 713

 Score =  605 bits (1560), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 314/717 (43%), Positives = 430/717 (59%), Gaps = 7/717 (0%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           ++L   + G Y Y+V     +  G  V VPL +R V G+VW   + +  +D  KLRP+ +
Sbjct: 1   MMLPLPLGGAYDYAV-GDEALRPGDFVEVPLGNRLVAGVVWGAGDGR--VDMAKLRPVAH 57

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRI---N 134
                 L      FV WVA YT +P G V +M +S  S  E +   +            +
Sbjct: 58  RLSARHLPEVSRRFVDWVAAYTLAPPGAVLKMAMSVPSALEPVPPILALRLAAAPPAFKD 117

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           T AR +V++           DL R + V   V+ GL   GV+  +     P    P+L  
Sbjct: 118 TAARRKVMEAAGRLPPLSAADLAREAGVGPAVVKGLVEAGVLDVVELPPPPAFAPPDLQA 177

Query: 195 SLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLP 254
               L   QQD  + +V     GF+V LI GVTGSGKTEVY E VA  L  GKQVL+LLP
Sbjct: 178 PRAELSPGQQDGADTLVAALGGGFSVQLIDGVTGSGKTEVYFEAVAEALARGKQVLVLLP 237

Query: 255 EISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKK 314
           EI+L++  L+RF++RFGV+PA WHS L  + R K WR VA G  +++VG RS LFLPF  
Sbjct: 238 EIALSAQWLDRFRRRFGVRPAMWHSDLGDATRRKTWRAVASGEAAIVVGARSGLFLPFHN 297

Query: 315 LGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYH 374
           LGLIV+DEEHD ++KQE+ + Y+ARDM++VR ++  FPVVL SATPS+ES  N  + RY 
Sbjct: 298 LGLIVVDEEHDPAFKQEDHVCYHARDMAVVRARLGGFPVVLASATPSLESLANVQAGRYG 357

Query: 375 SVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYA 434
            +HL  R+  + LP +  +D+R     +G+ LSP+++  +   +A  EQ +L+LNRRGYA
Sbjct: 358 LIHLPDRHAGAVLPDIVPVDLRRYPPPRGRWLSPQLVAALEEVMAAGEQAMLYLNRRGYA 417

Query: 435 PLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFG 494
           PLTLC+ CG+RL+C HC+ WLVEHRS  +L CH CGH       C  C +     ACG G
Sbjct: 418 PLTLCRTCGHRLQCPHCTAWLVEHRSAGRLICHHCGHHIRLPPKCPECEAEANFAACGPG 477

Query: 495 IERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPR 554
           +ER+AEE    FP ARI++++SD   G       +  ++  EID+++GTQ+VAKG++FP 
Sbjct: 478 VERVAEEAALLFPNARIAVMTSDTCSGPHAAAEFVRRVSDHEIDLLVGTQIVAKGYHFPM 537

Query: 555 MSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALV 614
           ++LVGVVD DLGL   DLR+ ERT QLLSQV GRAGR       L+Q YQP HPVM+AL 
Sbjct: 538 LTLVGVVDADLGLDGGDLRAGERTHQLLSQVAGRAGRAERPGRVLLQTYQPDHPVMRALR 597

Query: 615 SGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFG 674
           SG+ D+F   E  AR    +PP+GRLAA+I+SG     VE+YA  L + APR+  + V G
Sbjct: 598 SGERDAFIAREAEARRDAGMPPYGRLAALILSGADVGIVESYARTLAKAAPRTEGVQVLG 657

Query: 675 PAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           PA +P+ ++RGR+R R L+   R+ NLQ               ++RVQ D+DP +F+
Sbjct: 658 PAPAPMALLRGRHRRRFLVQSARSVNLQALLRDWLARAAP-PKSVRVQVDVDPYSFM 713


>gi|258542905|ref|YP_003188338.1| primosome assembly protein PriA [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633983|dbj|BAH99958.1| primosomal protein N' [Acetobacter pasteurianus IFO 3283-01]
 gi|256637043|dbj|BAI03012.1| primosomal protein N' [Acetobacter pasteurianus IFO 3283-03]
 gi|256640095|dbj|BAI06057.1| primosomal protein N' [Acetobacter pasteurianus IFO 3283-07]
 gi|256643152|dbj|BAI09107.1| primosomal protein N' [Acetobacter pasteurianus IFO 3283-22]
 gi|256646207|dbj|BAI12155.1| primosomal protein N' [Acetobacter pasteurianus IFO 3283-26]
 gi|256649259|dbj|BAI15200.1| primosomal protein N' [Acetobacter pasteurianus IFO 3283-32]
 gi|256652246|dbj|BAI18180.1| primosomal protein N' [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655303|dbj|BAI21230.1| primosomal protein N' [Acetobacter pasteurianus IFO 3283-12]
          Length = 756

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 331/756 (43%), Positives = 457/756 (60%), Gaps = 35/756 (4%)

Query: 1   MASSGS-SVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWY 59
           M  SG+ +      +R+ +LL    +GP+ Y  P  M ++ G IV  PL  R   G+VW 
Sbjct: 11  MPDSGNLTASACSTTRISVLLPMPFAGPFDYRAPVDMDLQPGDIVVAPLGKRQETGVVWG 70

Query: 60  NSEE----------KYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARM 109
                         + K+D+ +LRP+    D PPLS ++ +F+ WVA YT +P G+V  M
Sbjct: 71  TRSSLPADLAPPATEKKVDAARLRPVVCRLDLPPLSAELRQFIDWVAAYTLTPPGMVLAM 130

Query: 110 VVS-------------ALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDL 156
            +              AL+E   +E          R+ T AR +VLD + DG      D+
Sbjct: 131 TLRLHMRAAPTPTMGWALAENPDLEAL--------RL-TPARQKVLDLLADGNHRTTTDI 181

Query: 157 IRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTK 216
             A+ VS+ V+ GL   GV++ +          P+ +++ P+L+  QQ     +    T+
Sbjct: 182 TNATSVSAGVVKGLANAGVLRPVSLGPERPFGQPDAHYNPPVLEGEQQTAAVALRQTVTE 241

Query: 217 G-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPA 275
             F+V+L+ GVTGSGKTE+YLE +A  L  GKQ LILLPEI+L++  +ERF +RFGV+PA
Sbjct: 242 NRFSVTLLEGVTGSGKTEIYLEAIAECLEQGKQALILLPEIALSAQWMERFSRRFGVQPA 301

Query: 276 EWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGIL 335
            WHS +    R   W   A G+ SVIVG RSALFLPF  LGLI++DEEH+  +KQEEG++
Sbjct: 302 VWHSEIGQRARRLTWLGAADGSASVIVGARSALFLPFHNLGLIIVDEEHEALFKQEEGVI 361

Query: 336 YNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDM 395
           YNARDM++VRG++  FPVV+VSATPS+E+  N  + RY  + L TR+  + LP  +V+D+
Sbjct: 362 YNARDMAVVRGRLARFPVVVVSATPSLETLANVEAGRYRHLVLPTRHGGAELPETRVLDL 421

Query: 396 RGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWL 455
           R    ++G  LSPE+++ I  TL R EQ +LFLNRRGYAPLTLC+ CG+R++C HC+ WL
Sbjct: 422 RDHPPSRGLFLSPELVEDIGATLERQEQVMLFLNRRGYAPLTLCRSCGHRMECPHCTAWL 481

Query: 456 VEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILS 515
           VEHR++K L CH C H+     +C  CGS   + A G GIERI EE  + FP AR+ ++S
Sbjct: 482 VEHRNRKVLSCHYCDHTEPMPPTCPQCGSDHSLTAIGPGIERITEEARQLFPDARLLVMS 541

Query: 516 SDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSS 575
           SD  GG       ++ I++ E+D+IIGTQ+VAKG +FP ++LVGVVD DLGL  ADLR+ 
Sbjct: 542 SDTLGGPAATAEAVAKISRREVDLIIGTQIVAKGWHFPHLTLVGVVDADLGLGGADLRAG 601

Query: 576 ERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLP 635
           ERT QLL QV GRAGR       ++Q+Y P HPVMQAL+SGD D+F + E   R+    P
Sbjct: 602 ERTIQLLHQVAGRAGRASSPGRVILQSYAPEHPVMQALLSGDFDAFMQQEAAQRKPGFWP 661

Query: 636 PFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHG 695
           P+GRLAA+I+S       +  A  L   AP    I V GPA +PL ++RGR+R RLL+  
Sbjct: 662 PYGRLAALIVSADTPVAADEAAAQLGRTAPYGEGIQVLGPAPAPLAVLRGRHRRRLLLRT 721

Query: 696 KRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            RN  +Q    +         NA +V  DIDP +FL
Sbjct: 722 HRNIAVQPILRRWLGMVNLGRNA-KVDVDIDPVSFL 756


>gi|329114534|ref|ZP_08243293.1| Primosomal protein N [Acetobacter pomorum DM001]
 gi|326696014|gb|EGE47696.1| Primosomal protein N [Acetobacter pomorum DM001]
          Length = 775

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 329/742 (44%), Positives = 452/742 (60%), Gaps = 34/742 (4%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE---------- 63
           +R+ +LL    +GP+ Y  P  M ++ G IV  PL  R   G+VW  +            
Sbjct: 44  TRISVLLPMPFAGPFDYRAPVDMDLQPGDIVVAPLGKRQETGVVWDTTSSLPADLAPPAT 103

Query: 64  KYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS----------- 112
           + K+D+ +LRP+    D PPLS ++ +F+ WVA YT +P G+V  M +            
Sbjct: 104 EKKVDAARLRPVVCRLDLPPLSAELRQFIDWVAAYTLTPPGMVLAMTLRLHMRAAPTPTM 163

Query: 113 --ALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGL 170
             AL+E   +E          R+ T AR +VLD + DG      D+  A+ VS+ V+ GL
Sbjct: 164 GWALAENPDLEAL--------RL-TPARQKVLDLLADGNHRTTTDITNATGVSAGVVKGL 214

Query: 171 KAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGS 229
              GV++ +          P+ +++ PIL+  QQ     +    T+  F+V+L+ GVTGS
Sbjct: 215 ANTGVLRPVSLGPERPFGHPDAHYNPPILEGEQQSAAMALRQTVTENRFSVTLLEGVTGS 274

Query: 230 GKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKI 289
           GKTE+YLE +AA L  GKQ LILLPEI+L++  +ERF +RFGV+PA WHS +    R   
Sbjct: 275 GKTEIYLEAIAACLEQGKQALILLPEIALSAQWMERFSRRFGVQPAVWHSEIGQRARRLT 334

Query: 290 WRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIE 349
           W   A G+ SVIVG RSALFLPF  LGLI++DEEH+  +KQEEG++YNARDM++VRG++ 
Sbjct: 335 WLGAADGSASVIVGARSALFLPFHNLGLIIVDEEHEALFKQEEGVIYNARDMAVVRGRLA 394

Query: 350 SFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPE 409
            FPVV+VSATPS+E+  N  + RY  + L TR+  + LP  +V+D+R     +G  LSPE
Sbjct: 395 RFPVVVVSATPSLETLANVEAGRYRHLVLPTRHGGAELPETRVLDLRDHPPPRGLFLSPE 454

Query: 410 MIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQC 469
           +++ I  TL R EQ +LFLNRRGYAPLTLC+ CG+R++C HC+ WLVEHR++K L CH C
Sbjct: 455 LVEDIGATLERQEQVMLFLNRRGYAPLTLCRSCGHRMECPHCTAWLVEHRNRKVLSCHYC 514

Query: 470 GHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQL 529
            H+     +C  CGS   + A G GIERI EE  + FP AR+ ++SSD  GG       +
Sbjct: 515 DHTEPMPPACPQCGSDHSLTAIGPGIERITEEARQLFPDARLLVMSSDTLGGPAATAEAV 574

Query: 530 SAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRA 589
           + I++ E+D+IIGTQ+VAKG +FP ++LVGVVD DLGL  ADLR+ ERT QLL QV GRA
Sbjct: 575 AKISRREVDLIIGTQIVAKGWHFPHLTLVGVVDADLGLGGADLRAGERTIQLLHQVAGRA 634

Query: 590 GRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTK 649
           GR       ++Q+Y P HPVMQAL+S D D+F + E   R+    PP+GRLAA+I+S   
Sbjct: 635 GRASSPGRVILQSYTPEHPVMQALLSADFDAFMQQEAAQRKPGFWPPYGRLAALIVSADT 694

Query: 650 YQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMY 709
               +  A  L   AP    I V GPA +PL ++RGR+R RLL+   RN  +Q    +  
Sbjct: 695 PVAADEAAAQLGRTAPYGEGIQVLGPAPAPLAVLRGRHRRRLLLRTHRNIAVQPILRRWL 754

Query: 710 DNTIKRSNALRVQFDIDPQNFL 731
                  NA +V  DIDP +FL
Sbjct: 755 GMVNLARNA-KVDVDIDPVSFL 775


>gi|332186818|ref|ZP_08388560.1| primosome assembly protein PriA [Sphingomonas sp. S17]
 gi|332013151|gb|EGI55214.1| primosome assembly protein PriA [Sphingomonas sp. S17]
          Length = 723

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 306/727 (42%), Positives = 444/727 (61%), Gaps = 11/727 (1%)

Query: 12  VCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSE--EKYKIDS 69
           + SR  +L+L +  GP  Y VP+ M V+ GSIV  PL  R +LG+VW         ++  
Sbjct: 1   MSSRARVLVLNSALGPLDYRVPAGMTVQPGSIVVAPLGPRQLLGVVWEPERMPSDAEVGD 60

Query: 70  LKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF--T 127
            +LRP+  V D PPL   +   ++W ADY  +P   V RM +S+ S  E      ++  T
Sbjct: 61  NRLRPLLGVADAPPLPTPLRRLIEWTADYYLAPPAAVVRMALSSTSALEGARTVTEYRVT 120

Query: 128 GIFPRINTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISP 185
           G  P   T  R + L++I D  G I   R+L   + VS  VI GL   G I+ +   I  
Sbjct: 121 GHVPDRLTPQRAQALERIGDRQGLI---RELATMADVSDAVIRGLVKNGAIEGVEVDIDS 177

Query: 186 VVDSPNLYFSLPILDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
               P+     P L ++Q+   + +V  +    F   L+ GVTGSGKTEVY E VA  + 
Sbjct: 178 PFPLPDPDHHRPELSEDQRAAADTLVAGVAAHAFQPVLLDGVTGSGKTEVYFEAVAEAVA 237

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            G+QVL+LLPEI+LT   L+RF  RFG +P  WHS L +S R + WR +A G   V VG 
Sbjct: 238 EGRQVLVLLPEIALTEPFLKRFHDRFGCEPVAWHSGLRSSQRRRAWRAIASGQGLVTVGA 297

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALFLP++ LGLIV+DE H+ S+KQE+G+ Y+ARD++++RGK E  PV+L SATP+IE+
Sbjct: 298 RSALFLPYRNLGLIVVDEAHETSFKQEDGVHYHARDVAVMRGKFEPCPVILASATPAIET 357

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
           R      RY  V L  R+  + +P ++ ID+      +G+ ++P+++  ++ TL + EQ+
Sbjct: 358 RQQVALGRYTEVKLPGRFGPAQMPTIEAIDLIQNPPERGRWIAPKLVAAMKETLEKREQS 417

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           LL+LNRRGYAPLTLC+ CG+R +C +C+ W+VEHR  ++L CH CGH     ++C  CG 
Sbjct: 418 LLYLNRRGYAPLTLCRTCGHRFQCPNCTAWMVEHRLVRRLACHHCGHVMPTPRACPECGG 477

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
              ++ACG G+ERIA+E    FP A+I++++SD      +    +  +  G+IDI++GTQ
Sbjct: 478 EDSLVACGPGVERIADEATALFPEAKIAVVTSDTIWSPAKAAEFVGRMEAGDIDIVVGTQ 537

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           L+ KG++FP ++LVGV+D DLGL   DLR++ERTFQ + QV+GRAGR        IQ + 
Sbjct: 538 LITKGYHFPNLTLVGVIDADLGLDGGDLRAAERTFQQIRQVSGRAGRGAKPGHVFIQTHS 597

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P   VMQALV+GDA++FY +E  AR   + PPFGR AA+I+S       ++ A  +   A
Sbjct: 598 PKAQVMQALVTGDAEAFYTAETEARRDADAPPFGRYAAIIVSSEDQGAAQSAAEMIARAA 657

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFD 724
           P+   + VFGPA +PL M+RGR+RFRLL+H +R   +Q    + +   ++ S  +RV  D
Sbjct: 658 PKVDGMHVFGPAPAPLAMLRGRHRFRLLVHARRALAVQDVIRE-WLGGLEWSAKVRVAVD 716

Query: 725 IDPQNFL 731
           +DP +FL
Sbjct: 717 VDPYSFL 723


>gi|84683491|ref|ZP_01011394.1| primosomal protein N' [Maritimibacter alkaliphilus HTCC2654]
 gi|84668234|gb|EAQ14701.1| primosomal protein N' [Rhodobacterales bacterium HTCC2654]
          Length = 729

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 311/730 (42%), Positives = 453/730 (62%), Gaps = 23/730 (3%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR 73
            RV +L  Q +     Y  P     E G+ V VPL  R V+G+VW   E+ +  D+ KLR
Sbjct: 9   GRVSVLTTQGIDRLLTYRAPEGGCWE-GAFVEVPLGPRKVMGVVWGPGEQGF--DASKLR 65

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFP 131
            +  V D PP+  +M EF+  V DYT +PM  + R+   A  LS    M +  +     P
Sbjct: 66  AVIRVLDVPPMRAEMAEFLTRVGDYTLTPMNFMLRLATRAPGLSNPPSMRKIYRLGHHEP 125

Query: 132 RINTVARLRVLDKIKDG--KIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
              T AR RVL+ ++      +  ++L   + V+S V+ GL   G +++  E     +  
Sbjct: 126 DRKTEARERVLEVLESQAHSAFTLKELAEEAGVTSSVVKGLVKLGAVEE--EESPRDLPF 183

Query: 190 PNLYFSLP--ILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
           P+L ++ P   L  +Q      +      G F  +L+ GVTGSGKTEVYLE VA  L  G
Sbjct: 184 PHLDYTAPGKALTGDQAAAAGALRDGVRSGTFGATLLRGVTGSGKTEVYLEAVAECLAQG 243

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           +Q L+LLPEI+LTS  L+R ++RFG KPAEWHS ++ + R ++WR VA G   +++G RS
Sbjct: 244 RQALVLLPEIALTSEFLKRVEERFGAKPAEWHSGVTMTERRRVWRMVAEGGAQMVIGARS 303

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLPF+ +GLIV+DEEHD SYKQE+G+LY+ARDMS++RG I    VVL SATPS+E+  
Sbjct: 304 ALFLPFRDIGLIVVDEEHDNSYKQEDGVLYSARDMSVLRGSINGAQVVLASATPSLETWA 363

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N  + +Y+ + L++R+  + LP ++ IDMR + +   + +SP +   +R  +   EQ L+
Sbjct: 364 NAQAGKYNRLDLTSRFGPAVLPEMRTIDMRQEDLPGNRWISPTLATAVRGRIDEGEQALI 423

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRGYAP+T+C+ CG+++ C HC   +VEHR  K+L CHQCG +    ++C  C + G
Sbjct: 424 FLNRRGYAPVTVCRACGHQIGCDHCDARMVEHRFLKRLVCHQCGETKPMPETCPSCETEG 483

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
           K+   G G+ER+AEEV E FP AR+++LSSDL      L+ Q+  IA G  DIIIGTQ+V
Sbjct: 484 KLAPVGPGVERMAEEVAETFPDARVAVLSSDLFASARALKAQIELIAAGGADIIIGTQIV 543

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGHNFP+++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR  +  L L+Q++QP 
Sbjct: 544 AKGHNFPKLTLVGVIDADLGLQGSDLRAAERTFQLIRQVAGRAGRGDVSGLALLQSFQPE 603

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR 666
           HPV++A++SGD + F+++E   R++  +PP+GRLA ++IS        + A NL     R
Sbjct: 604 HPVIRAILSGDEEGFWKAEASERQAAGVPPYGRLAGIVISAPDL----DAAMNLGTALAR 659

Query: 667 SSDIV------VFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
           +   +      VFGPA +P+  +RGR+R RLL+   + + LQ    +   N   + + +R
Sbjct: 660 ADGPIVQIGAQVFGPAPAPIARIRGRHRVRLLVKAPKTAPLQTALRKWLANMDVKGD-IR 718

Query: 721 VQFDIDPQNF 730
           +  DIDPQ+F
Sbjct: 719 LSVDIDPQSF 728


>gi|119385225|ref|YP_916281.1| primosome assembly protein PriA [Paracoccus denitrificans PD1222]
 gi|119374992|gb|ABL70585.1| primosomal protein N' [Paracoccus denitrificans PD1222]
          Length = 733

 Score =  602 bits (1552), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 323/727 (44%), Positives = 453/727 (62%), Gaps = 18/727 (2%)

Query: 17  IILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIE 76
           I +L Q V G   Y  P    V LG +V VPL  R V+G VW      +  D+ +LRP+ 
Sbjct: 13  IAVLTQEVVGVLDYLAPEG-GVRLGQLVVVPLGPRRVMGAVWGPGIGDF--DAARLRPVA 69

Query: 77  YVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRIN 134
            + D PPL+  M EF+  + +YT +P+ L+ RM   A  L +       I   G  P   
Sbjct: 70  RLIDAPPLTPGMIEFLIRMGEYTLTPLPLLLRMATRAPDLDQPPSARRIIHRAGPPPARM 129

Query: 135 TVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPV-VDSPN 191
           T AR  VL  I+D  G  +   +L + + VS+ V+ GL   G +    EV++P  V  P 
Sbjct: 130 TDARAAVLRVIEDHGGAGFAPGELAQLAGVSASVVQGLVKAGTLA---EVLAPRDVPYPR 186

Query: 192 LYFSLP--ILDKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           L   LP   L ++Q +  E +   L +  +  +L+ GVTGSGKTEVYLE VA  L  G+Q
Sbjct: 187 LDPGLPGKPLAEDQAEAAETLRDALKSHAYGTTLLRGVTGSGKTEVYLEAVAECLRQGRQ 246

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
            L+LLPEI+L++  L+R + RFG +P EWHS ++ + R ++W   A+  + ++VG RSAL
Sbjct: 247 ALVLLPEIALSAEFLDRVEARFGARPGEWHSGITRTERRRLWTMAAQNHVGLVVGARSAL 306

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPF  LGLIV+DEEHD SYKQE+ + Y+ARDM+++R  +E+  VVL SATPS+ES VN 
Sbjct: 307 FLPFADLGLIVVDEEHDSSYKQEDAVYYSARDMAVLRASVEAAQVVLASATPSVESWVNA 366

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
            S +Y  + L  RY  + LP +  ID+R Q + +G+ +SP +   IR    R EQ+LLFL
Sbjct: 367 GSGKYRRLDLRARYGTADLPEMGTIDLRQQEMERGRWISPRLAAEIRARKERGEQSLLFL 426

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAP+T C+ CG ++ C HC   +VEHR + +L CHQCG +     +C  CG  GKM
Sbjct: 427 NRRGYAPITACRACGQQIGCDHCDARMVEHRFQNRLVCHQCGATKPIPNACPSCGVEGKM 486

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
            A G G+ER+AEEV E FP A+ ++LSSDL      L+  ++ I  G  DIIIGTQ+VAK
Sbjct: 487 TAIGPGVERLAEEVAERFPEAKATVLSSDLFHSARALKEAIAEIGAGSTDIIIGTQIVAK 546

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFG--LKSLGLIQAYQPT 606
           GHNFPR++LVGV+D DLGL  ADLR++ER+FQL+ QV GRAGR G   + L L+Q +QP 
Sbjct: 547 GHNFPRLTLVGVIDADLGLQGADLRAAERSFQLMRQVAGRAGREGGDARGLALLQTHQPD 606

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAP- 665
           HPV++A++SG+ ++F+++E  AR++  +PPFGRLA +I+S      VE+YA  L   A  
Sbjct: 607 HPVIRAILSGEDEAFWDAEAVARQAAGMPPFGRLAGIILSHPDQPVVEDYARELARRAEP 666

Query: 666 -RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFD 724
            R+    +FGPA +P+  +R RYR R+LI   R + +QG  ++   +  K  + LR+  D
Sbjct: 667 LRAIGAELFGPAPAPIARIRARYRVRMLIRAPRQAPVQGAIAEWLASAPKPPSNLRLAVD 726

Query: 725 IDPQNFL 731
           IDPQ+FL
Sbjct: 727 IDPQSFL 733


>gi|85703566|ref|ZP_01034670.1| primosomal protein N' [Roseovarius sp. 217]
 gi|85672494|gb|EAQ27351.1| primosomal protein N' [Roseovarius sp. 217]
          Length = 733

 Score =  602 bits (1551), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 317/726 (43%), Positives = 449/726 (61%), Gaps = 19/726 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q + GP  Y  P    V  G+ V VPL  R VLG+VW      +  D  K R I
Sbjct: 15  VAVLTAQPLDGPLDYLAPEG-GVMAGAFVEVPLGPRRVLGVVWGPGRGGF--DLKKARSI 71

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  +M EF++   +YT +P+  + R+   A  LSE   M++  +   + P  
Sbjct: 72  GRVLDVAPMRGEMQEFLRRAGEYTLTPLPAMLRLATRAPGLSEPPSMQKIYRLGDMEPAR 131

Query: 134 NTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP- 190
            T AR RVL+ ++D  G  +  +++   + V+S V+ GL AQG +    E  +P  D+P 
Sbjct: 132 LTDARARVLEVLRDHGGLGFTLKEVSDLAGVTSSVVKGLVAQGAV---LEEDTPR-DTPF 187

Query: 191 -NLYFSLPI--LDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
             L   LP   L ++Q      +   L  +G+  +L+ GVTGSGKTEVYLE VA  L  G
Sbjct: 188 ARLDPDLPAKALTEDQATAARSLCAGLRGQGYGTTLLRGVTGSGKTEVYLEAVAEALRQG 247

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
            Q L+LLPEI+LT+  L R + RFG +PAEWHS ++ + R ++W+ V +G   ++VG RS
Sbjct: 248 GQALVLLPEIALTAEFLTRVEARFGARPAEWHSGVTMTERRRVWKMVGQGGAQMVVGARS 307

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLPF+ L LIV+DEEHD SYKQE+G LY+ARDM+++R  + S  VVL SATPS+ES  
Sbjct: 308 ALFLPFQNLRLIVVDEEHDSSYKQEDGALYHARDMAVLRASLCSARVVLASATPSLESWA 367

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N  + +Y  + L +R+  + +P L  IDMR +T+   + +SP +   +   +A  EQ LL
Sbjct: 368 NAEAGKYERLDLDSRFGVAVMPELAAIDMRAETLPSNRWISPTLQAAVNARVAAGEQALL 427

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRGYAP T+C+ CG+++ CLHC   +VEHR +K+L CHQCG SA   ++C  CG +G
Sbjct: 428 FLNRRGYAPTTICRACGHQIGCLHCDARMVEHRFQKRLMCHQCGESAAMPEACPACGVAG 487

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
           K+ A G G+ER+AEE    FP ARI++LSSDL G    L+ Q+  IA+G  DIIIGTQLV
Sbjct: 488 KLAAVGPGVERLAEEAAALFPQARIAVLSSDLFGSARALKEQIVEIAQGAADIIIGTQLV 547

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGHNFP ++LVGV+D DLGL   DLR++ERTFQL+ QV GRAGR       L+Q +QP 
Sbjct: 548 AKGHNFPLLTLVGVIDADLGLQGLDLRAAERTFQLMRQVAGRAGRAERAGRALLQTFQPE 607

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP 665
           HPV++A+++GD + F+ +E   R    +PP+GR+A +I+S    Q V +    L +   P
Sbjct: 608 HPVIRAILAGDEEGFWRAEAEGRRQAGVPPYGRMAGIILSSPDMQAVFDLGEALARRDGP 667

Query: 666 -RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFD 724
            R+    VFGPA +P+  +RGR+R RLL+   + + LQ   S+ +   ++    +R+  D
Sbjct: 668 IRAVGAQVFGPAPAPIARIRGRHRVRLLVKASKGAALQAAVSE-WVGQVRLPAQMRLTVD 726

Query: 725 IDPQNF 730
           IDPQ+F
Sbjct: 727 IDPQSF 732


>gi|254477171|ref|ZP_05090557.1| primosomal protein N', putative [Ruegeria sp. R11]
 gi|214031414|gb|EEB72249.1| primosomal protein N', putative [Ruegeria sp. R11]
          Length = 731

 Score =  601 bits (1550), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 310/726 (42%), Positives = 446/726 (61%), Gaps = 15/726 (2%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           RV +L  Q +     Y  P      LG+ V VPL  R VLG++W      +  DS KLRP
Sbjct: 12  RVGVLTTQPLDRVLDYRAPEG-GCHLGAYVEVPLGPRRVLGVIWGPGAGDF--DSAKLRP 68

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPR 132
           +  V D  P+  +M +F+   ADYT +P+  + R+   A  LS+   M + ++ TG  P 
Sbjct: 69  VNRVLDVAPMRDEMRQFLTKSADYTLTPLPAMLRLATRAPGLSDPVSMRKVLRPTGQMPD 128

Query: 133 INTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
             T AR RVL    +  G  +  ++L   + V++ VI GL  QG +++  E     +  P
Sbjct: 129 RMTEARERVLTAADEYGGLAFTAKELADLAGVTTSVIKGLVKQGALRE--EDAPRDLPYP 186

Query: 191 NLYFSLP--ILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
            L   LP   L ++Q     ++      G +  +L+ GVTGSGKTEVYLE VAA L  G+
Sbjct: 187 RLDPDLPGKTLTEDQAAAAARLGEGVASGRYGTTLLKGVTGSGKTEVYLEAVAAALRAGR 246

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           Q L+LLPEI+LT+  L+R ++RFG  PAEWHS  + + R ++WR V +G   +++G RSA
Sbjct: 247 QALVLLPEIALTAEFLKRVEQRFGATPAEWHSGATMTERRRVWRMVGQGKAQLVIGARSA 306

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LFLP++ LGLI++DEEHD SYKQ++G+ YNARDM+++R  + S  VVL SATPS+E+  N
Sbjct: 307 LFLPYQNLGLIIVDEEHDTSYKQDDGVCYNARDMAVLRAAMCSAQVVLASATPSLETWAN 366

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + +Y  + L +R+  S LP ++ IDMR + +A    +SP +   +   L R EQ+LLF
Sbjct: 367 AEAGKYQRLDLKSRFGASVLPDMRAIDMRAEQLAPSTWISPSLRQAMATRLERGEQSLLF 426

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRG+AP+T+C+ CG  + C HC   +VEHR  K+L CHQCG +    ++C  C   GK
Sbjct: 427 LNRRGFAPVTICRACGGHVTCDHCDSRMVEHRFMKRLMCHQCGETKPVPEACPTCQVEGK 486

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           M   G GIER+ EE    FP ARI++LSSDL G    L+ ++  IA GE DI++GTQLVA
Sbjct: 487 MAPVGPGIERLGEETAALFPEARIAVLSSDLFGSARALKQRIEEIAAGEADIVLGTQLVA 546

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR       L+Q +QP H
Sbjct: 547 KGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRADKPGEALMQTFQPEH 606

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP- 665
           PV++A++SGD ++F+++E   R++  +PP+GR+A +++SG     V +    L +   P 
Sbjct: 607 PVIRAILSGDEEAFWKAEAAERQAAGVPPYGRMAGIVLSGPDLPAVMDLGLALSRNDMPL 666

Query: 666 RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDI 725
           R     VFGPA +P+  +RGR+R RLLI   + + LQ   ++ +   ++    LR+  DI
Sbjct: 667 RQIGAQVFGPAPAPIARIRGRHRVRLLIKAAKGTPLQDAIAR-WIRPVRLKGDLRLSVDI 725

Query: 726 DPQNFL 731
           DPQNF 
Sbjct: 726 DPQNFF 731


>gi|56697959|ref|YP_168330.1| primosome assembly protein PriA [Ruegeria pomeroyi DSS-3]
 gi|56679696|gb|AAV96362.1| primosomal protein N' [Ruegeria pomeroyi DSS-3]
          Length = 736

 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 318/741 (42%), Positives = 458/741 (61%), Gaps = 20/741 (2%)

Query: 1   MASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYN 60
           + S G   EG + S   +L  Q +     Y  P      +G+ V VPL  R VLG+VW  
Sbjct: 6   LDSGGFFEEGALVS---VLTTQPLDRTLDYKAPEG-GCFVGAFVEVPLGPRKVLGVVWGP 61

Query: 61  SEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETE 118
               +  D  ++R +  V D  P+  +M  F+   ADYT +PM  + R+   A  L +  
Sbjct: 62  GRGDF--DRSRIRSVLRVLDVAPMREEMRSFLGRTADYTLTPMPAMLRLATRAPGLGDPP 119

Query: 119 KMEEKIQFTGIFPRINTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVI 176
            M +  +  G+ P   T AR RVL+ ++D  G  +  ++L   + V++ V+ GL  QG +
Sbjct: 120 SMRKVYRLGGVDPDRMTDARARVLEVLRDYGGLAFTLKELAEMAGVTASVVKGLVKQGAV 179

Query: 177 KQIFEVISPV-VDSPNLYFSLP--ILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKT 232
           +   E  SP  +  P+L   LP   L ++Q    + +      G +  +L+ GVTG+GKT
Sbjct: 180 R---EEDSPRDLPYPHLDPDLPGKALTEDQVRAADSLRAGLRSGRYGTTLLKGVTGAGKT 236

Query: 233 EVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQ 292
           EVYLE VA  L +G+Q L+LLPEI+LT+  L R + RFG +PAEWHS  + + R ++WR 
Sbjct: 237 EVYLEAVAEALRMGRQALVLLPEIALTAEFLSRVEARFGARPAEWHSGATMTERRRVWRM 296

Query: 293 VARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFP 352
           V +GA  ++VG RSALFLPF+ LGLI++DEEHD SYKQE+G+LYNARDM+++R  I    
Sbjct: 297 VGQGAAQLVVGARSALFLPFRDLGLIIVDEEHDTSYKQEDGVLYNARDMAVLRAAICGAR 356

Query: 353 VVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMID 412
           VVL SATPS+ES  N  + +Y  V L++R+  + LP +Q IDMR +T+     +SP +  
Sbjct: 357 VVLASATPSLESWANADAGKYERVELTSRFGPAVLPQMQAIDMRAETMQPSSWISPNLRR 416

Query: 413 GIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHS 472
            +   LA+ EQ+LLFLNRRGYAP+TLC+ CG ++ C HC   +VEHR  K+L CHQCG +
Sbjct: 417 AVSDRLAKGEQSLLFLNRRGYAPVTLCRACGQQIGCDHCDARMVEHRFLKRLMCHQCGET 476

Query: 473 AIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAI 532
               ++C  CG+ G++   G GIER+AEE    FP ARI++LSSD+ G    L+ ++ AI
Sbjct: 477 KPIPETCPHCGAEGRLAPVGPGIERLAEEATASFPEARIAVLSSDMFGTARALKERIEAI 536

Query: 533 AKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRF 592
           A GE DI+IGTQLVAKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR 
Sbjct: 537 AAGEADIVIGTQLVAKGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRA 596

Query: 593 GLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQE 652
                 L+Q YQP HPV++A+++GD + F+ +E   R++  +PP+GR+A +I+SG +   
Sbjct: 597 EKPGQALLQTYQPEHPVIRAILAGDEERFWRAEAAERQAAGVPPYGRMAGIILSGPEAGP 656

Query: 653 VENYAYNL--KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD 710
           V +    +   + A R     VFGPA +P+  VRGR+R RLL+   + + LQ   ++ + 
Sbjct: 657 VFDLGTAMARNDAALRQIGAQVFGPAPAPIARVRGRHRVRLLVKAPKGAPLQEAIAR-WI 715

Query: 711 NTIKRSNALRVQFDIDPQNFL 731
             ++    LR+  DIDPQ+FL
Sbjct: 716 APLRLKGDLRLSVDIDPQSFL 736


>gi|87200406|ref|YP_497663.1| primosome assembly protein PriA [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87136087|gb|ABD26829.1| primosomal protein N' [Novosphingobium aromaticivorans DSM 12444]
          Length = 733

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 312/728 (42%), Positives = 448/728 (61%), Gaps = 18/728 (2%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW-YNSEEKYKIDSLKL 72
           +RV  L+  A  GP  Y VP+ M VE GS+V  PL  R ++G+VW  +     ++   +L
Sbjct: 14  TRVRCLIFNAALGPLDYRVPAGMTVEPGSVVIAPLGPRQIIGVVWDADRLPATEVPEGRL 73

Query: 73  RPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF--TGIF 130
           RP+  V   PPL   +   ++W ADY  +P+  VARM +S+ +  +      ++  TG  
Sbjct: 74  RPLLKVLPVPPLPAPLRRLIEWTADYYLAPLAAVARMALSSNAALQGGSTVTEYRLTGKE 133

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
           P   T  RL  LD ++D +    R+L   + VS  V+ G+   G+++ +      VVDS 
Sbjct: 134 PGRLTPQRLIALDLLQDQQA-TIRELSEIAGVSDAVLRGMVNAGLLEPV------VVDSD 186

Query: 191 NLY------FSLPILDKNQQDVVEQ-VVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVL 243
             Y      F+ P L + Q +V  + V  +  + F   L+ GVTGSGKTE Y E VAA L
Sbjct: 187 RPYPAADPHFAAPDLSEQQAEVAARFVASVRAREFHPFLLDGVTGSGKTETYFEGVAAAL 246

Query: 244 HLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVG 303
             G+QVL+LLPEI+LT   L+RF+ RFGV P  WHSSL +S R + WR V+ GA  V+VG
Sbjct: 247 EAGRQVLVLLPEIALTETFLKRFEARFGVPPVTWHSSLKSSERRRAWRSVSSGAAQVVVG 306

Query: 304 VRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIE 363
            RSALFLPF  LGLIV+DE H+IS+KQ++G+ YNARD++++R   E  PV+L SATP++E
Sbjct: 307 ARSALFLPFADLGLIVVDEAHEISFKQDDGVRYNARDVAVMRAHFEKIPVILASATPALE 366

Query: 364 SRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQ 423
           S     + RY  V L  R+  + +PH+QV+D+R +   +G  ++P ++  ++  L + EQ
Sbjct: 367 SLQMAEAGRYERVVLPARFGGATMPHIQVVDLRVEQPERGHWIAPPLVRALKDRLEKGEQ 426

Query: 424 TLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCG 483
           +LLFLNRRGYAPLTLC+ CG R +C +CS WLVEHR  ++L CH CGH      +C  C 
Sbjct: 427 SLLFLNRRGYAPLTLCRTCGYRFQCPNCSAWLVEHRLSRRLACHHCGHEVPPPDACPECH 486

Query: 484 SSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGT 543
               ++ACG G+ERIA+EV E  P AR+++++SD      +    +   +   ID+I+GT
Sbjct: 487 EPDCLVACGPGVERIADEVAEILPHARVALVTSDTLTSPAKAAEFVEMASNKAIDVIVGT 546

Query: 544 QLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAY 603
           QLV KG++FP ++LVGV+D D+GL   DLR++ERT+Q ++QV GRAGR       LIQ  
Sbjct: 547 QLVTKGYHFPELTLVGVIDADMGLEGGDLRAAERTYQQVAQVAGRAGRGEKPGEVLIQTR 606

Query: 604 QPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEH 663
            P  PV++AL SGD D+FYE+E  AR     PPFGR AA+I+S     E  + A  +   
Sbjct: 607 HPEAPVIEALASGDRDAFYEAEAEARRDAGAPPFGRWAAIIVSSEDEAEARDAARGIGGS 666

Query: 664 APRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQF 723
           APR  D+++ GPA +PL ++RGRYR+RLLI+ +R++ LQ    +  D  ++    +RV  
Sbjct: 667 APRLDDVLILGPAPAPLSLLRGRYRYRLLINARRSTELQRVIREWLD-PLRFPPGVRVAV 725

Query: 724 DIDPQNFL 731
           DIDP +F+
Sbjct: 726 DIDPYSFV 733


>gi|84514467|ref|ZP_01001831.1| primosomal protein N' [Loktanella vestfoldensis SKA53]
 gi|84511518|gb|EAQ07971.1| primosomal protein N' [Loktanella vestfoldensis SKA53]
          Length = 730

 Score =  598 bits (1541), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 311/724 (42%), Positives = 449/724 (62%), Gaps = 15/724 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P      LG+ V VPL  R VLG+VW   +  Y  DS K+R +
Sbjct: 12  VGVLTTQPLDRLLDYKAPEG-GCHLGAFVEVPLGPRKVLGVVWGPGQGDY--DSAKIRSV 68

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  +M +F+   ADYT +PM  + R+   A  L +   M +  +     P  
Sbjct: 69  IRVLDLAPMRDEMRDFLIRAADYTLTPMPAMLRLGTRAPGLGDAPSMRKVYRLGTRDPDR 128

Query: 134 NTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQ---IFEVISPVVD 188
            T AR +VL  ++D  G  +   +L  A+ V + V+ GL AQG + +     +V  P +D
Sbjct: 129 KTAARDKVLAVLRDYGGLAFTLGELADAADVGTSVVKGLVAQGAVLEEDAPRDVPYPPLD 188

Query: 189 SPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
             +   +L        D +     L  +G+  +L+ GVTGSGKTEVYLE VA  L +GKQ
Sbjct: 189 PDHGGKALNPDQAVGADALRAA--LRKEGYGTTLLKGVTGSGKTEVYLEAVAECLRMGKQ 246

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
            L+LLPEI+L+   +ER + RFG++PAEWHS ++ + R + +R V +G   ++VG RSAL
Sbjct: 247 ALVLLPEIALSGEFIERVEARFGMRPAEWHSGVTMTERRRCFRMVGQGDAQLVVGARSAL 306

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPF+ LGLIV+DEEHD SYKQE+G+LYNARDM+++R  +    VVL SATPS+ES  N 
Sbjct: 307 FLPFRNLGLIVVDEEHDTSYKQEDGVLYNARDMAVLRAALCGAQVVLASATPSLESWANA 366

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
            + +Y  + L+ R+  + +P +  IDMR + +  G+ +SP + D I + L + EQ+L+FL
Sbjct: 367 QAGKYARLDLTARFGAAVMPEMAAIDMRVEELPHGRWVSPTLRDAIANRLEKGEQSLIFL 426

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAP+TLC+ CG+++ C HC   +VEHR +K+L CHQCG +      C  CG++ K+
Sbjct: 427 NRRGYAPVTLCRACGHQIGCDHCDARMVEHRFQKRLMCHQCGETKPIPVICPSCGAADKL 486

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
            A G G+ER+ EEV   FP ARI++LSSDL G    ++  ++ IA+G  DIIIGTQLVAK
Sbjct: 487 AAVGPGVERMGEEVAALFPTARIAVLSSDLYGSARAMKAHIAEIAQGGTDIIIGTQLVAK 546

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR  +    L+Q YQP HP
Sbjct: 547 GHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAAIPGAALLQTYQPDHP 606

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP-R 666
           V++A+++GD +SF+ +E   R    +PP+GR+A +I+SG   + V +   ++ +   P R
Sbjct: 607 VIRAILNGDEESFWSAEAAERRGAGVPPYGRMAGIILSGPDLKAVFDLGNDMARRDGPLR 666

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
                VFGPA +P+  VRG++R RLL+   +++ LQ   +Q        +N LR+  DID
Sbjct: 667 QIGAQVFGPAPAPIARVRGKHRVRLLVKADKSAPLQAALAQWVAQFRLPAN-LRLAIDID 725

Query: 727 PQNF 730
           PQ+F
Sbjct: 726 PQSF 729


>gi|149186080|ref|ZP_01864394.1| primosome assembly protein PriA [Erythrobacter sp. SD-21]
 gi|148830111|gb|EDL48548.1| primosome assembly protein PriA [Erythrobacter sp. SD-21]
          Length = 725

 Score =  595 bits (1535), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 311/723 (43%), Positives = 434/723 (60%), Gaps = 8/723 (1%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSE-EKYKIDSLKL 72
           +RV  L+L A  GP  Y VP  M VELG +V  PL  RTV+GIVW         + + KL
Sbjct: 6   NRVRCLVLNAALGPLDYKVPDGMAVELGQVVECPLGPRTVIGIVWEAERLPGTDVPAEKL 65

Query: 73  RPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGI 129
           RP+  ++  PPL   +   ++W ADY  + +  VARM +S   AL     + E  + TG 
Sbjct: 66  RPLRGLYPIPPLPAPLRRLIEWTADYYVASLASVARMALSSGGALKGPASITE-YRLTGG 124

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T  RL  ++ + +G+    R+L   + VS  V+ GL  QGV++ +        ++
Sbjct: 125 MPERMTPQRLAAMEAL-EGEQATIRELSGIAGVSEGVLRGLVNQGVLEPVEVDCDRPYEA 183

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
               F+   L + Q++V +       +  FA  L+ GVTGSGKTE Y E VA  L +G+Q
Sbjct: 184 ARPDFAQVELSEQQREVSDIFSAAVREAKFAPFLLDGVTGSGKTETYFEPVAEALRMGRQ 243

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VL+LLPEI+LT   L RF++RFG  P  WHSSL ++ R + WR VA G+  V+VG RSAL
Sbjct: 244 VLVLLPEIALTENFLHRFEERFGASPVLWHSSLKSTERRRAWRAVASGSAQVVVGARSAL 303

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPF KLGLIV+DE H+ S+KQE+G+ YNARD++++R   E FP++L SATP++ES    
Sbjct: 304 FLPFAKLGLIVVDEAHETSFKQEDGVRYNARDVAVMRAHFERFPIILASATPALESLQMA 363

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
            S  Y  V L +R+  + +P +  ID+  +    G  L+  ++DGI   L R+EQ+LLFL
Sbjct: 364 ESGIYEKVDLPSRFGGAQMPAIDTIDLTEEKPPHGMWLAQRLVDGIAERLERSEQSLLFL 423

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+ CG R +C +CS WLVEHR  ++L CH CGH A     C  CG    +
Sbjct: 424 NRRGYAPLTLCRNCGFRYQCPNCSAWLVEHRFTRRLACHHCGHEAPSPGQCKECGEPDCL 483

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIA+EV E  P AR+ + +SD     GR    ++++  GEID+I+GTQLV K
Sbjct: 484 VACGPGVERIADEVAERLPEARVFVATSDTLNSPGRAAEFIASVDAGEIDVIVGTQLVTK 543

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           G +FP ++LVGVVD DLGL   DLR+ ERT+Q ++QV GRAGR       LIQ   P   
Sbjct: 544 GFHFPELTLVGVVDADLGLEGGDLRAGERTYQQVAQVAGRAGRGAKPGEVLIQTRHPEAS 603

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           V+ AL +GD D+FY +E   R     PPFGR A++I+S     E    A  + +  P  +
Sbjct: 604 VIAALAAGDRDAFYTAETEMRRDAGAPPFGRWASIIVSSEDESEAREAARRIGDTRPDVA 663

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
           D ++ GPA +P+  +RGRYR+RLLI+ +R+  LQ    + +   +     +RV  DIDP 
Sbjct: 664 DCMILGPAPAPMAQLRGRYRYRLLINARRSVQLQDVIRR-WLGRLDHPPGIRVAVDIDPY 722

Query: 729 NFL 731
           +F+
Sbjct: 723 SFV 725


>gi|241762563|ref|ZP_04760638.1| primosomal protein N' [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241372891|gb|EER62578.1| primosomal protein N' [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 722

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 300/722 (41%), Positives = 440/722 (60%), Gaps = 8/722 (1%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNS-EEKYKIDSLKLR 73
           R+ +L      G   YS+P    V  G +V +PL  R +LG++W      + KI   +LR
Sbjct: 4   RISVLTTNPSLGILTYSLPEGKAVTAGQLVSIPLGPRQILGMLWEEDVSNQIKIADNRLR 63

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGIF 130
           P+  ++D P  S    +F++WV+ Y  +P+G V RM +    A  E+ +++        +
Sbjct: 64  PVSKIYDLPEASHCYRKFIQWVSSYYMAPLGAVLRMGIPFSPATIESREIKNYYVPKREW 123

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
           P++ T  R + L+K+  G+    R+L   +++S  VI  L   G+I +    +  V+  P
Sbjct: 124 PKL-TPLRQQALEKL-SGEKGSVRELAEKAEISPAVIRALIKTGLITEQKTSLEIVLSLP 181

Query: 191 NLYFSLPILDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
           +  F+ PIL + Q    E +   +  K F   L+ GVTGSGKTEVY E +A  L  GKQ 
Sbjct: 182 DPDFNAPILSETQSKAAEILKESIAKKSFETFLLDGVTGSGKTEVYFEAIAQTLRDGKQS 241

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           LILLPEI+LT   L+RFQ RFG +P  WHS LS + R K W+ +  G   V++G RSALF
Sbjct: 242 LILLPEIALTEPFLKRFQARFGCEPVVWHSDLSQARRRKNWQAIVTGQAKVVIGARSALF 301

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPFK +GLI++DE H+ S+KQE+G+ Y ARD++++R K E+ PV+L +ATP+IES +   
Sbjct: 302 LPFKAIGLIIVDEAHETSFKQEDGVCYQARDVAVMRAKFENIPVILATATPAIESVMQVR 361

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
              Y  + L+ R+ ++ LP + VI+M  Q +A+G+ L+P ++  + + + R+EQ LLFLN
Sbjct: 362 LGNYKEIRLAERHGSAGLPTIHVINMTEQALAKGRWLAPPLVKALTNAVERHEQGLLFLN 421

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC+ CG+R+KC HC+ W+VEHR   ++ CH CG +      C  C ++  ++
Sbjct: 422 RRGYAPLTLCRHCGHRIKCPHCTAWMVEHRQLGQMICHHCGFTMPVPDKCPECQTADSLV 481

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
           ACG G+ERIAEE    FP ARI  ++SD      +    +  + +G IDIIIGTQL+ KG
Sbjct: 482 ACGPGVERIAEETALLFPEARIETITSDTLATPKQAAEFVEKMDQGAIDIIIGTQLITKG 541

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           ++FPR+++VGVVD D+GL   DLR+SE +FQ ++QV GRAGR  L     IQ Y+P  PV
Sbjct: 542 YHFPRLTVVGVVDADIGLQGGDLRASEHSFQQIAQVAGRAGRSALDGHVFIQTYEPETPV 601

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           + AL SGD ++FY++E+  RE    PPFGR  A+IIS  K +  E   + L +  P    
Sbjct: 602 ISALASGDREAFYQTELEIREITEAPPFGRYVALIISSEKQEIAEAVGHQLGQRKPEGDG 661

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           I VFGPA +PL  +RGRYR+R LI  KRN  +Q    Q + + I   +++R+  D+DP +
Sbjct: 662 IEVFGPAPAPLLQLRGRYRYRFLIQAKRNIPIQRVIHQ-WLSKISIPSSVRITIDVDPYS 720

Query: 730 FL 731
           F 
Sbjct: 721 FF 722


>gi|260753456|ref|YP_003226349.1| primosome assembly protein PriA [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258552819|gb|ACV75765.1| primosomal protein N' [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 722

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 301/722 (41%), Positives = 438/722 (60%), Gaps = 8/722 (1%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNS-EEKYKIDSLKLR 73
           R+ +L      G   YS+P    V  G +V +PL  R +LG++W      + KI   +LR
Sbjct: 4   RISVLTTNPSLGILTYSLPEGKAVAAGQLVSIPLGPRQILGMLWEEDVSNQIKIADNRLR 63

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGIF 130
           P+  ++D P  S    +F++WV+ Y  +P+G V RM +    A  E+ +++        +
Sbjct: 64  PVSKIYDLPEASHCYRKFIQWVSSYYMAPLGAVLRMGIPFSPATIESREIKNYYVPKKEW 123

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
           P++ T  R + L+K+  G+    R+L   ++VS  VI  L   G+I +    +   +  P
Sbjct: 124 PKL-TPLRQQALEKL-SGEKGSVRELAEKAEVSPAVIRALIKTGLITEQKTSLEIALSLP 181

Query: 191 NLYFSLPILDKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
           N  F+ PIL + Q    E +   +  K F   L+ GVTGSGKTEVY E +A  L  GKQ 
Sbjct: 182 NPDFNAPILSETQSKAAEILKESIAKKSFETFLLDGVTGSGKTEVYFEAIAQTLRDGKQS 241

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           LILLPEI+LT   L+RFQ RFG +P  WHS LS + R K W+ +  G   V++G RSALF
Sbjct: 242 LILLPEIALTEPFLKRFQGRFGCEPVVWHSDLSQARRRKNWQAIVTGQAKVVIGARSALF 301

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPFK +GLI++DE H+ S+KQE+G+ Y ARD++++R K E+ PV+L +ATP+IES +   
Sbjct: 302 LPFKAIGLIIVDEAHETSFKQEDGVCYQARDVAVMRAKFENIPVILATATPAIESVMQVR 361

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
              Y  + L+ R+ ++ LP + VI+M  Q +A+G+ L+P ++  +   + R+EQ LLFLN
Sbjct: 362 LGNYKEIRLAERHGSAGLPTIHVINMTEQALAKGRWLAPPLVKALTSAVERHEQGLLFLN 421

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC+ CG+R+KC HC+ W+VEHR   ++ CH CG +      C  C ++  ++
Sbjct: 422 RRGYAPLTLCRHCGHRIKCPHCTAWMVEHRQLGQMICHHCGFTMPVPDKCPECQTADSLV 481

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
           ACG G+ERIAEE    FP ARI  ++SD      +    +  + +G IDIIIGTQL+ KG
Sbjct: 482 ACGPGVERIAEEAALLFPEARIETITSDTLATPKQAAEFVEKMDQGAIDIIIGTQLITKG 541

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           ++FPR+++VGVVD D+GL   DLR+SE +FQ ++QV GRAGR  L     IQ Y+P  PV
Sbjct: 542 YHFPRLTVVGVVDADIGLQGGDLRASEHSFQQIAQVAGRAGRSALDGHVFIQTYEPETPV 601

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           + AL SGD ++FY++E+  RE    PPFGR  A+IIS  K +  E   + L +  P    
Sbjct: 602 ISALASGDREAFYQTELEIREITEAPPFGRYVALIISSEKQEIAEAVGHQLGQRKPEGDG 661

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           I VFGPA +PL  +RGRYR+R LI  KRN  +Q    Q + + I   +++R+  D+DP +
Sbjct: 662 IEVFGPAPAPLLQLRGRYRYRFLIQAKRNIPIQRIIHQ-WLSKISIPSSVRITIDVDPYS 720

Query: 730 FL 731
           F 
Sbjct: 721 FF 722


>gi|114764457|ref|ZP_01443682.1| primosomal protein N' [Pelagibaca bermudensis HTCC2601]
 gi|114543024|gb|EAU46043.1| primosomal protein N' [Roseovarius sp. HTCC2601]
          Length = 729

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 308/723 (42%), Positives = 441/723 (60%), Gaps = 11/723 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P     E G+ V VPL  R VLG+VW     K   D  K+RP+
Sbjct: 11  VAVLTTQPLDRLLDYKAPEGGCWE-GAFVEVPLGPRKVLGVVWGPG--KGDFDHAKVRPV 67

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  ++  F++   +YT +P+  + R+   A  L E   M +  +     P  
Sbjct: 68  TRVLDVAPMRAELRSFLERAGEYTLTPLTAMLRLATRAPGLGEAPSMRKIYRLGDAEPER 127

Query: 134 NTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPN 191
            T AR RVL+ + +  G    + +L  A+ V+  VI GL   G +++            +
Sbjct: 128 MTDARRRVLEVLSEMGGLSLTQGELADAAGVTPSVIKGLAKMGAVREEEAPRDTAFPRLD 187

Query: 192 LYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
             +    L ++Q    + +      G +   L+ GVTGSGKTEVYLE VA  L  G+Q L
Sbjct: 188 PDYGGKQLAEDQAAAAQSLREGVASGRYGTVLLKGVTGSGKTEVYLEAVAECLAQGRQAL 247

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           +LLPEI+LTS  L R + RFG KPAEWHS ++ + R ++W+QVA+G   ++VG RSALFL
Sbjct: 248 VLLPEIALTSEFLTRVEARFGAKPAEWHSGVTVTERRRVWKQVAQGGAQLVVGARSALFL 307

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PF+ LGL V+DEEHD SYKQ+EG+LYNARDM+++R  I S  VVL SATPS+ES  N  +
Sbjct: 308 PFRDLGLTVVDEEHDTSYKQDEGVLYNARDMAVLRASICSGRVVLASATPSLESWANADA 367

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  + L +R+  S +P ++ +DMR +T+   + +SP +   +   + R EQ +LFLNR
Sbjct: 368 GKYQRLDLVSRFGASVMPEMRSLDMRAETLPSNRWVSPSLQSEVLARIERGEQAMLFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAP+T+C+ CG+++ C HC   +VEHR  ++L CHQCG +    + C  C +  K+ A
Sbjct: 428 RGYAPVTICRACGHQIGCPHCDARMVEHRFLQRLVCHQCGETVPKPEVCPSCEAEDKLAA 487

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G+ER+AEEV E FP AR+++LSSDL G    L+ ++  IA G  DI+IGTQLVAKGH
Sbjct: 488 VGPGVERLAEEVAELFPQARLAVLSSDLFGSARALKEEIEKIASGGADIVIGTQLVAKGH 547

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           NFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR     + L+Q YQP HPV+
Sbjct: 548 NFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAEKPGVALLQTYQPEHPVI 607

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP-RSS 668
           +A++SGD + F+++E   R +  +PP+GRLA VI+S T+ QEV +    + ++ AP R  
Sbjct: 608 RAILSGDEEGFWQAEAEERRAAGMPPYGRLAGVILSSTEAQEVFDLGNAMARQDAPLRRI 667

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
              V+GPA +P+  VRGR+R RLL+   + + LQ   +  +    +    LR+  DIDPQ
Sbjct: 668 GAQVYGPAPAPIAKVRGRHRVRLLVKAPKGTALQPALAD-WAAQFRLRGELRMAIDIDPQ 726

Query: 729 NFL 731
           NF 
Sbjct: 727 NFF 729


>gi|85709174|ref|ZP_01040240.1| primosomal protein N [Erythrobacter sp. NAP1]
 gi|85690708|gb|EAQ30711.1| primosomal protein N [Erythrobacter sp. NAP1]
          Length = 721

 Score =  594 bits (1531), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 315/726 (43%), Positives = 443/726 (61%), Gaps = 14/726 (1%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSE-EKYKIDSLKL 72
           +RV +L+L A  G   Y +   M+VE GS+V  PL  RTV GIVW        ++D+ KL
Sbjct: 2   NRVRLLVLNAALGALDYKLAEGMEVEPGSVVIAPLGPRTVTGIVWDEGRLPGAEVDASKL 61

Query: 73  RPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGI 129
           R +  V   PPLS  +   ++W ADY  +P+  VARMV+S   AL       E  + +G 
Sbjct: 62  RALREVVPVPPLSEPLRRLIEWTADYYCAPLASVARMVLSSGGALGGPTTTTE-YRLSGG 120

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
            P   T  R   ++ + +G+    R+L   ++VS  V+ GL  QGVI+ +   I    D 
Sbjct: 121 TPERMTPQRAAAIEAL-EGEQGTIRELSGIAEVSEGVLRGLVNQGVIEPVTVSIDRPYDR 179

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
            +     P L  +Q  V +Q+V     + F   L+ GVTGSGKTE Y E VA  L +G+Q
Sbjct: 180 ADADHHQPALSDDQMRVAKQLVKAVEARKFEPFLLDGVTGSGKTETYFEPVAEALRMGRQ 239

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VL+LLPEI+LT   L RF+ RFG  P +WHSSL ++ R + WR ++ G   VIVG RSAL
Sbjct: 240 VLVLLPEIALTENFLTRFEDRFGAAPVQWHSSLKSTERRRAWRAISTGEAQVIVGARSAL 299

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLP+  LGLIV+DE H+IS+KQ++G+ YNARD+S++R + E  PVVL SATP++ES    
Sbjct: 300 FLPYADLGLIVVDEAHEISFKQDDGVRYNARDVSVMRARFEEIPVVLASATPALESLHMA 359

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
            +  Y  + L +R+  + LP ++++D+  +  A G+ L+  +I+G+   L   EQ+LLFL
Sbjct: 360 NTGTYTKLELPSRFGGAQLPAIKLVDLTIEKPASGRWLAAPLIEGLEARLEAGEQSLLFL 419

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAPLTLC+ CG+R +C +CS WLVEHR   +L CH CG       +C  CG +  +
Sbjct: 420 NRRGYAPLTLCRNCGHRFQCPNCSAWLVEHRLSARLACHHCGLETRPPDACPECGEADCL 479

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
           +ACG G+ERIA+EV E FP AR+++ +SD  G   R    L+ +    ID+I+GTQLV K
Sbjct: 480 VACGPGVERIADEVSELFPEARVAVATSDTLGSPARAAEFLAQVEARAIDVIVGTQLVTK 539

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           G +FP ++LVGVVD DLGL   DLR++ERT+Q ++QV GRAGR       LIQ   P   
Sbjct: 540 GFHFPELTLVGVVDADLGLEGGDLRAAERTYQQVAQVAGRAGRGAKPGEVLIQTRHPDAA 599

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS 668
           V+ AL +GD D+FYE+E  AR     PPFGR A++I+S    +E    A  L +  P   
Sbjct: 600 VIAALANGDRDAFYEAETDARRDAGAPPFGRWASIILSSEDEREAREAAARLGDSRPHLD 659

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSN---ALRVQFDI 725
           D+++ GPA +PL ++R RYR+R LI+ +R++NLQG    M  + I R +    +RV  DI
Sbjct: 660 DLMILGPAPAPLALLRNRYRYRFLINARRSANLQG----MLRDWIGRQDFAPGIRVGVDI 715

Query: 726 DPQNFL 731
           DP +F+
Sbjct: 716 DPYSFV 721


>gi|159044475|ref|YP_001533269.1| primosome assembly protein PriA [Dinoroseobacter shibae DFL 12]
 gi|157912235|gb|ABV93668.1| primosomal protein N' [Dinoroseobacter shibae DFL 12]
          Length = 727

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 316/725 (43%), Positives = 445/725 (61%), Gaps = 15/725 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P    V+ G  V VPL  R V+G+VW   +  +  D  KLR +
Sbjct: 9   VAVLTTQPLDRTLDYKAPEGGCVQ-GDFVEVPLGPRKVVGVVWGPGQGDW--DPAKLRRV 65

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D PP+  +M  F+   A YT +PM  + R+   A  L +   M + +      P  
Sbjct: 66  LRVLDTPPMRDEMRAFLTRAARYTLTPMPAMLRLATRAPGLGDAPSMRKVLVAGEGEPAR 125

Query: 134 NTVARLRVLDKIK--DGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQ---IFEVISPVVD 188
            T AR+RV+D +    G    + +L+ A+ VS+ VI GL A G I +     ++  P +D
Sbjct: 126 MTEARMRVMDALAAYGGAPVTQAELVEAAGVSASVIKGLVAAGAIHEQDTPRDLPYPPLD 185

Query: 189 SPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
                   P+  + +      +  +  + +  +L+ GVTGSGKTEVYLE VAA L  G+Q
Sbjct: 186 PARP--GKPLTPEQEAAAGHLLHGIEAEAYGTTLLKGVTGSGKTEVYLEAVAACLAKGRQ 243

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
            L+LLPEI+L++  L R + RFG +PAEWHS ++ + R + WR VA G    +VG RSAL
Sbjct: 244 ALVLLPEIALSAEFLTRVEARFGARPAEWHSGVTMTERRRCWRMVAEGGARFVVGARSAL 303

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPF+ LGLIV+DEEHD SYKQEEG+LYNARDM+++R  + S  VVL SATPS+ES  N 
Sbjct: 304 FLPFQDLGLIVVDEEHDTSYKQEEGVLYNARDMAVLRASLASAQVVLASATPSLESWANA 363

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
            + +Y  V L  R+  + LP +  IDMR + +  G+ LSP +   +   L   EQ+LLFL
Sbjct: 364 EAGKYLRVDLGARFGAAELPEMAAIDMRAEEVPFGRWLSPSLKRAVTARLEAGEQSLLFL 423

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAP+TLC+ CG+++ C  C   +VEHR +K+L CHQCG +    ++C  C + GK+
Sbjct: 424 NRRGYAPVTLCRACGHQIGCETCDARMVEHRFQKRLMCHQCGATRAIPEACPSCEAEGKL 483

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
            A G G+ER+AEE  E FP ARI++LSSDL G    L+ Q+  IA+G  DIIIGTQLVAK
Sbjct: 484 AAVGPGVERLAEEAAEAFPDARIAVLSSDLFGSARALKAQIVEIAEGAADIIIGTQLVAK 543

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR   +   L+Q YQP HP
Sbjct: 544 GHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAEKRGEALLQTYQPDHP 603

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAPRS 667
           V++A+++GD ++F+ +E   R +  +PP+GR+A +I+S    QEV +    L + HAP S
Sbjct: 604 VIRAILTGDEEAFWRAEAGERHAAGMPPYGRMAGIILSSPDLQEVFDLGNALARNHAPLS 663

Query: 668 S-DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
           +    V+GPA +P+  +RGR+R RLL+   +   LQ   ++ +   +K    LR+  DID
Sbjct: 664 AVGATVYGPAPAPIARIRGRHRVRLLVTAPKGVALQDALAR-WVGQVKTGPNLRLAVDID 722

Query: 727 PQNFL 731
           PQ+F 
Sbjct: 723 PQSFF 727


>gi|56552817|ref|YP_163656.1| primosome assembly protein PriA [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|56544391|gb|AAV90545.1| primosomal protein N' [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 722

 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 302/722 (41%), Positives = 439/722 (60%), Gaps = 8/722 (1%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNS-EEKYKIDSLKLR 73
           R+ +L      G   YS+P    V  G +V +PL  R +LG++W      + KI   +LR
Sbjct: 4   RISVLTTNPSLGILTYSLPEGKAVAAGQLVSIPLGPRQILGMLWEEDVSNQIKIADNRLR 63

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSET-EKMEEKIQFTGI--F 130
           P+  ++D P  S    +F++WV+ Y  +P+G V RM +  L  T E  E K  +     +
Sbjct: 64  PVSKIYDLPEASHCYRKFIQWVSSYYMAPLGAVLRMGIPFLPATIESREIKNYYVPKREW 123

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
           P++ ++ R + L+K+  G+    R+L   ++VS  VI  L   G+I +    +   +  P
Sbjct: 124 PKLTSL-RQQALEKL-SGEKGSVRELAEKAEVSPAVIRALIKTGLITEQKTSLEIALSLP 181

Query: 191 NLYFSLPILDKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
           N  F+ PIL + Q    E +   +  K F   L+ GVTGSGKTEVY E +A  L  GKQ 
Sbjct: 182 NPDFNAPILSETQSKAAEILKESIAKKSFETFLLDGVTGSGKTEVYFEAIAQTLRDGKQS 241

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           LILLPEI+LT   L+RFQ RFG +P  WHS LS + R K W+ +  G   V++G RSALF
Sbjct: 242 LILLPEIALTEPFLKRFQARFGCEPVVWHSDLSQARRRKNWQAIVTGQAKVVIGARSALF 301

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPFK +GLI++DE H+ S+KQE+G+ Y ARD++++R K E+  V+L +ATP+IES +   
Sbjct: 302 LPFKAIGLIIVDEAHETSFKQEDGVCYQARDVAVMRAKFENISVILATATPAIESVMQVR 361

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
              Y  + L+ R+ ++ LP + VI+M  Q +A+G+ L+P ++  + + + R+EQ LLFLN
Sbjct: 362 LGNYKEIRLAERHGSAGLPTIHVINMTEQALAKGRWLAPPLVKALTNAVERHEQGLLFLN 421

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC+ CG+R+KC HC+ W+VEHR   ++ CH CG +      C  C ++  ++
Sbjct: 422 RRGYAPLTLCRHCGHRIKCPHCTAWMVEHRQLGQMICHHCGFTMPVPDKCPECQTADSLV 481

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
           ACG G+ERIAEE    FP ARI  ++SD      +    +  + +G IDIIIGTQL+ KG
Sbjct: 482 ACGPGVERIAEETALLFPEARIETITSDTLATPKQAAEFVEKMDQGAIDIIIGTQLITKG 541

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           ++FPR+++VGVVD D+GL   DLR+SE +FQ ++QV GRAGR  L     IQ Y+P  PV
Sbjct: 542 YHFPRLTVVGVVDADIGLQGGDLRASEHSFQQIAQVAGRAGRSALDGHVFIQTYEPETPV 601

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           + AL SGD ++FY++E+  RE    PPFGR  A+IIS  K +  E   + L +  P    
Sbjct: 602 ISALASGDREAFYQTELEIREITEAPPFGRYVALIISSEKQEIAEAVGHQLGQRKPEGDG 661

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           I VFGPA +PL  +RGRYR+R LI  KRN  +Q    Q + + I   +++R+  D+DP +
Sbjct: 662 IEVFGPAPAPLLQLRGRYRYRFLIQAKRNIPIQRIIHQ-WLSKISIPSSVRITIDVDPYS 720

Query: 730 FL 731
           F 
Sbjct: 721 FF 722


>gi|126730496|ref|ZP_01746307.1| primosome assembly protein PriA [Sagittula stellata E-37]
 gi|126709229|gb|EBA08284.1| primosome assembly protein PriA [Sagittula stellata E-37]
          Length = 729

 Score =  593 bits (1528), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 315/734 (42%), Positives = 443/734 (60%), Gaps = 29/734 (3%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR 73
           +R+ +L  Q +     Y  P      LG+ V VPL  R VLG+VW   E ++  D+ KLR
Sbjct: 9   ARIGVLTAQPLDRLLDYRAPEG-GCFLGAYVEVPLGPRKVLGVVWGPGEGQF--DAAKLR 65

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFP 131
            +  V D  P+  +M  F++    YT +PM  + R+   A  L +   M +  +     P
Sbjct: 66  SVIRVLDAAPMRAEMRAFLEKAGAYTLTPMSAMLRLATRAPGLGDAPSMRKIYRRGEGEP 125

Query: 132 RINTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
              T AR RV+   ++  G     R+L  A+ V+S V+ GL   G I++         +S
Sbjct: 126 ERMTDARRRVIAASEELGGLALTLRELAEAAGVTSSVVKGLVKSGAIRE--------EES 177

Query: 190 PNLYFSLPILDKN--QQDVVEQVVPLC--------TKGFAVSLISGVTGSGKTEVYLEIV 239
           P    + P LD +   +D+ E              +  +   L+ GVTGSGKTEVYLE V
Sbjct: 178 PR-DTAFPWLDPDYGGKDLTEDQAAAADVLRDGQQSGTYGTVLLKGVTGSGKTEVYLEAV 236

Query: 240 AAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAIS 299
           A  L  G+Q L+LLPEI+L++  L R + RFG +PAEWHS ++ + R ++WR V  G   
Sbjct: 237 AECLRQGRQALVLLPEIALSAEFLARVETRFGARPAEWHSGVTMTERRRVWRMVGEGRAQ 296

Query: 300 VIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSAT 359
           ++VG RSALFLPF++LGLIV+DEEHD SYKQE+G+LYNARDM+++R  I    VVL SAT
Sbjct: 297 MVVGARSALFLPFQRLGLIVVDEEHDTSYKQEDGVLYNARDMAVLRASILGAQVVLASAT 356

Query: 360 PSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLA 419
           PS+ES  N  + +Y  + L++R+  + LP ++ IDMR Q +   + +SP +   ++  + 
Sbjct: 357 PSLESWANADAGKYRRLVLTSRFGEAVLPEMRAIDMRRQDVPSNRWISPALAAAVKARME 416

Query: 420 RNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSC 479
           R EQ LLFLNRRGYAP+TLC+ CG ++ C HC   +VEHR  K+L CHQCG +    + C
Sbjct: 417 RGEQALLFLNRRGYAPVTLCRACGQQIGCDHCDARMVEHRFLKRLVCHQCGETKPMPEVC 476

Query: 480 VVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDI 539
             CG+  K+ A G G+ER+AEE    FP ARI++LSSDL G    L+ Q+  IA G  DI
Sbjct: 477 PSCGAEDKLAAVGPGVERLAEEAQAQFPDARIAVLSSDLYGTAHELKAQIEGIAAGGADI 536

Query: 540 IIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGL 599
           IIGTQLVAKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR   +   L
Sbjct: 537 IIGTQLVAKGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAEKRGEAL 596

Query: 600 IQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYN 659
           +Q YQP HPV++++++GD ++F+ +E   R    +PPFGRLA +I+SG   QEV +    
Sbjct: 597 LQTYQPEHPVIRSILAGDEEAFWSAEADERRLGGMPPFGRLAGIILSGPDVQEVFDLGNW 656

Query: 660 L--KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSN 717
           L   + A R     VFGPA +P+  VRGR+R RLL+  ++   LQG  +  +   +K   
Sbjct: 657 LARNDGALRRVGAQVFGPAPAPIARVRGRHRVRLLVRAEKGVALQGALAD-WVRPVKLKG 715

Query: 718 ALRVQFDIDPQNFL 731
            +R+  DIDPQ+F 
Sbjct: 716 EMRLAIDIDPQSFF 729


>gi|254464245|ref|ZP_05077656.1| primosomal protein N', putative [Rhodobacterales bacterium Y4I]
 gi|206685153|gb|EDZ45635.1| primosomal protein N', putative [Rhodobacterales bacterium Y4I]
          Length = 735

 Score =  592 bits (1526), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 315/740 (42%), Positives = 453/740 (61%), Gaps = 19/740 (2%)

Query: 5   GSSVEGV----VCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYN 60
           GSS+ G        RV +L  Q +     Y  P      LG+ V VPL  R VLG+VW  
Sbjct: 2   GSSMSGQEFFQAGERVGVLTTQPLDRLLDYRAPEG-GCFLGAYVEVPLGPRKVLGVVWGP 60

Query: 61  SEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETE 118
               +  DS KLR +  V D  P+  +M +F+   ADYT +PM  + R+   A  LS+  
Sbjct: 61  GAGDF--DSAKLRSVIRVLDVAPMRTEMRQFLGKAADYTLTPMPAMLRLATRAPGLSDPP 118

Query: 119 KMEEKIQFTGIFPRINTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVI 176
            M + ++     P   T AR RVL+ +++  G  +  R+L   + V+  V+ GL  QG +
Sbjct: 119 SMRKILRRGDGVPDRMTEARTRVLEVLEEFGGLAFTPRELADMADVTPSVVKGLVKQGAL 178

Query: 177 KQIFEVISPVVDSPNLYFSLPI--LDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTE 233
           ++  E        P+L   LP   L ++Q +    +      G +  +L+ GVTGSGKTE
Sbjct: 179 RE--EEAPRDTPYPHLDPELPSKQLTEDQANAAAALADAVHSGRYGTTLLKGVTGSGKTE 236

Query: 234 VYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQV 293
           VYLE VAA L  G+Q L+LLPEI+LT+  L R + RFG KPAEWHS  + + R ++W+ V
Sbjct: 237 VYLEAVAATLRAGRQALVLLPEIALTAEFLTRVEARFGAKPAEWHSGATLTERRRVWKMV 296

Query: 294 ARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPV 353
            +GA  +++G RSALFLPF+ LGLI++DEEHD SYKQE+G+LYNARDM+++R  + S  V
Sbjct: 297 GQGAAQLVIGARSALFLPFRDLGLIIVDEEHDTSYKQEDGVLYNARDMAVLRAAMCSAQV 356

Query: 354 VLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDG 413
           VL SATPS+ES  N  + +Y  ++L++R+  S LP ++ +DMR + +     +SP +   
Sbjct: 357 VLASATPSLESWANAEAGKYKRLNLTSRFGASVLPDMRAVDMRSEDLLPSTWISPTLKQA 416

Query: 414 IRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSA 473
           +   + R EQ+LLFLNRRG+AP+T+C+ CG ++ C HC   +VEHR  K+L CHQCG + 
Sbjct: 417 MTLRMERGEQSLLFLNRRGFAPVTICRACGAQVACDHCDARMVEHRFMKRLMCHQCGETK 476

Query: 474 IYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIA 533
              ++C  C   GKM   G GIER+AEE    FP ARI++LSSDL G    L+ ++  IA
Sbjct: 477 PVPEACPSCEVEGKMAPVGPGIERLAEEATALFPEARIAVLSSDLFGSARALKQRIEEIA 536

Query: 534 KGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFG 593
            GE DII+GTQLVAKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR  
Sbjct: 537 AGEADIILGTQLVAKGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAE 596

Query: 594 LKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEV 653
                L+Q +QP HPV++A++SGD ++F+++E   R++  +PP+GR+A +I+SG     V
Sbjct: 597 RPGEALMQTFQPEHPVIRAILSGDEENFWKAEAAERQAAGVPPYGRMAGIILSGPDLAAV 656

Query: 654 ENYAYNL-KEHAP-RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDN 711
            +    + +   P R     +FGPA +P+  VRGR+R RLL+   +   LQ   ++ +  
Sbjct: 657 FDLGNAMARNDGPLRQIGAQLFGPAPAPIARVRGRHRVRLLVKAAKGVPLQDAIAR-WIA 715

Query: 712 TIKRSNALRVQFDIDPQNFL 731
            ++    LR+  DIDPQ+F 
Sbjct: 716 PLRLKGDLRLSVDIDPQSFF 735


>gi|149915602|ref|ZP_01904128.1| primosomal protein N' [Roseobacter sp. AzwK-3b]
 gi|149810494|gb|EDM70337.1| primosomal protein N' [Roseobacter sp. AzwK-3b]
          Length = 733

 Score =  592 bits (1525), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 311/729 (42%), Positives = 439/729 (60%), Gaps = 23/729 (3%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P      +G+ V VPL  R V G+VW      + I   K+R +
Sbjct: 15  VGVLTTQPLDRLLDYRAPEG-GCHVGAFVEVPLGPRKVPGVVWGPGRGDFDIS--KVRQV 71

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  +M EF++  ADYT +PM  + R+   A  LS    M++  +     P  
Sbjct: 72  LRVLDVAPMRAEMQEFLRRAADYTLTPMPAMLRLATRAPGLSNPPSMQKIYRSGTAAPDR 131

Query: 134 NTVARLRVLDKIKD-GKI-WEKRDLIRASQVSSHVIDGLKAQGVIKQ-------IFEVIS 184
            T AR RVL  + + G + +   +L   + V++ VI GL  QG + +        F  + 
Sbjct: 132 MTDARRRVLSVLSEYGTLSFTLGELAEQAGVTTSVIKGLVKQGAVLEEDCPRDLPFPHLD 191

Query: 185 PVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
           P +   +L       D            L   G+  +L+ GVTGSGKTEVYLE VA  L 
Sbjct: 192 PALGGKDLT------DDQSSAAATLCAALRGGGYGTTLLRGVTGSGKTEVYLEAVAETLR 245

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            G+Q L+LLPEI+LTS  L R + RFG +PAEWHS ++ + R + W+ +      V+VG 
Sbjct: 246 QGRQALVLLPEIALTSEFLTRIEARFGARPAEWHSGVTMTERRRTWKMLGEAGCQVVVGA 305

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALFLPF+ LGLIV+DEEHD SYKQE+G+LYNARDM+++R  I    VVL SATPS+ES
Sbjct: 306 RSALFLPFRDLGLIVVDEEHDTSYKQEDGVLYNARDMAVLRASICGAQVVLASATPSLES 365

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
             N  + +Y  + L+ R+  + +P ++ IDMR +T+   + +SP +   +   +   EQ 
Sbjct: 366 WANAEAGKYTRLDLTARFGAAVMPQMRAIDMRNETLPASRWISPSLQAAVTARVDVGEQA 425

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           LLF+NRRGYAP+TLC+ CG+++ C HC   +VEHR +++L CHQCG +    ++C  CG 
Sbjct: 426 LLFINRRGYAPVTLCRACGHQIGCDHCDARMVEHRFQQRLVCHQCGETKAVPKACPSCGV 485

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
             K+ A G G+ER+ EE    FP ARI+ LSSDL G    L+ Q+ AIA+G+ DI+IGTQ
Sbjct: 486 EDKLAAVGPGVERLTEEAQALFPQARIATLSSDLFGSARALKDQIRAIAEGDSDIVIGTQ 545

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           LVAKGHNFPR++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR       L+Q +Q
Sbjct: 546 LVAKGHNFPRLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRTEKPGTALLQTFQ 605

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEH 663
           P HPV++A++SGD + F+ +E   R    +PP+GR+A +I+S T  +EV ++A  L +  
Sbjct: 606 PDHPVIRAILSGDEEGFWRAEAEERRHAGVPPYGRMAGIILSSTDAREVFDFATELARRD 665

Query: 664 AP-RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQ 722
            P R+    VFGPA +P+  +RGR+R RLL+   R   LQG  +Q +   +K    LR+ 
Sbjct: 666 GPLRAVGAQVFGPAPAPIARIRGRHRVRLLVKAARGVALQGAVAQ-WVAQLKPPGQLRLS 724

Query: 723 FDIDPQNFL 731
            DIDPQ+FL
Sbjct: 725 IDIDPQSFL 733


>gi|126725538|ref|ZP_01741380.1| primosome assembly protein PriA [Rhodobacterales bacterium
           HTCC2150]
 gi|126704742|gb|EBA03833.1| primosome assembly protein PriA [Rhodobacterales bacterium
           HTCC2150]
          Length = 731

 Score =  591 bits (1524), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 311/730 (42%), Positives = 452/730 (61%), Gaps = 27/730 (3%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P      LG+ V VPL  R V+G+VW   +  Y I  +K+R +
Sbjct: 13  VSVLTTQPIDRLLDYKAPEG-GCFLGAFVEVPLGPRRVIGVVWGAGKGDYDI--VKIRAV 69

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+   M EF+    +YT +PM  + R+   A  L +   M +  +     P  
Sbjct: 70  HRVLDVAPMGADMREFLIRAGEYTITPMATMLRLATRAPGLGDPLSMRKIYRIGEGVPDR 129

Query: 134 NTVARLRVLDKIKD-GKI-WEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP- 190
            T AR +V+  + D G++ +  R+L   + VSS V+ GL AQGV+ +         DSP 
Sbjct: 130 ETPARKKVIQALADYGELAFTLRELAEMAGVSSSVVKGLVAQGVVDE--------EDSPR 181

Query: 191 -----NLYFSLP--ILDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLEIVAAV 242
                 L ++L    L K+Q + V+++   L +K +  +L+ GVTGSGKTEVYLE VA  
Sbjct: 182 DLPYGKLDYTLKGKELSKDQANAVDKLKEGLQSKVYGTTLLKGVTGSGKTEVYLEAVAEC 241

Query: 243 LHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIV 302
           +  G+Q L+LLPEI+LTS  L+R ++RFG  PAEWHS ++ + R + WR V +G   +IV
Sbjct: 242 IKNGRQALVLLPEIALTSQFLDRVRERFGAMPAEWHSGVTQTERRRCWRMVGQGNAELIV 301

Query: 303 GVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSI 362
           G RSALFLPF+ LGLIV+DEEHD SYKQE+G+LYNARDMS++R  I    VVL SATPS+
Sbjct: 302 GARSALFLPFRDLGLIVVDEEHDTSYKQEDGVLYNARDMSVLRAAIGGAQVVLSSATPSL 361

Query: 363 ESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNE 422
           ES  N  + +Y  + L++R+  + LP +  IDMR + +   + +S ++   I   + + E
Sbjct: 362 ESWANVEAGKYQRLDLTSRFGTAVLPSMNAIDMRAENLPSNRWISEKLQSEINTRIGKGE 421

Query: 423 QTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVC 482
           Q+LLF+NRRG+AP+TLC+ CG+++ C  C   +VEHR +++L CHQCG +    ++C  C
Sbjct: 422 QSLLFINRRGFAPITLCRACGHQIGCDQCDARMVEHRFQRRLMCHQCGETKAIPETCPDC 481

Query: 483 GSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIG 542
           G+  K+ A G G+ER+ EE    FP ARI++LSSDL G    ++ Q+  +AKGE DIIIG
Sbjct: 482 GAEDKLAAVGPGVERLGEEAVALFPDARIAVLSSDLFGSARAMKAQIETLAKGEADIIIG 541

Query: 543 TQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQA 602
           TQLVAKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV+GRAGR   +    +Q 
Sbjct: 542 TQLVAKGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVSGRAGRAEKQGAAFLQT 601

Query: 603 YQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-K 661
           YQP HPV++A++SGD + F+ +E  AR+S  +PP+GRLA +++S     E+     ++ +
Sbjct: 602 YQPEHPVIRAVLSGDEEGFWAAEANARKSTGVPPYGRLAGIVLSSPDENEIHMLGNDMAR 661

Query: 662 EHAPRSS-DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
              P ++    V+GPA +P+  VRGR+R RLL+  ++N  LQ    Q +        + R
Sbjct: 662 RTGPLAAIGAQVYGPAPAPIARVRGRHRLRLLVKCEKNRPLQAAL-QKWVAQFNVPKSTR 720

Query: 721 VQFDIDPQNF 730
           +  DIDPQ+F
Sbjct: 721 LSIDIDPQSF 730


>gi|163742248|ref|ZP_02149636.1| primosome assembly protein PriA [Phaeobacter gallaeciensis 2.10]
 gi|161384578|gb|EDQ08959.1| primosome assembly protein PriA [Phaeobacter gallaeciensis 2.10]
          Length = 755

 Score =  590 bits (1520), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 308/726 (42%), Positives = 444/726 (61%), Gaps = 15/726 (2%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           RV +L  Q +     Y  P      LG+ V VPL  R VLG++W      +  DS KLRP
Sbjct: 36  RVGVLTTQPLDRCLDYRAPEG-GCHLGAYVEVPLGPRRVLGVIWGPGAGDF--DSAKLRP 92

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPR 132
           +  V D  P+  +M +F+   ADYT +P+  + R+   A  LS+   M + ++ TG  P 
Sbjct: 93  VNRVLDVAPMRDEMRQFLTKSADYTLTPLPAMLRLATRAPGLSDPVSMRKVLRPTGQMPD 152

Query: 133 INTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
             T AR RVL  +++  G  +  ++L   + V++ V+ GL  QG +++  E     +  P
Sbjct: 153 RMTDARERVLSAVEEYGGLAFTAKELADLAGVTTSVVKGLVKQGALRE--EEAPRDLPYP 210

Query: 191 NLYFSLP--ILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
            L   LP   L  +Q      +      G +  +L+ GVTGSGKTEVYLE VAA L  G+
Sbjct: 211 RLDPDLPGKTLTDDQAAAANTLGEGVAGGRYGTTLLKGVTGSGKTEVYLEAVAATLRAGR 270

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           Q L+LLPEI+LT+  L+R ++RFG  PAEWHS  + + R ++WR V +G   +++G RSA
Sbjct: 271 QALVLLPEIALTAEFLKRVEQRFGATPAEWHSGATMTERRRVWRMVGQGKAQLVIGARSA 330

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LFLP++ LGLI++DEEHDISYKQ+EG+ YNARDM+++R  + S  VVL SATPS+E+  N
Sbjct: 331 LFLPYQNLGLIIVDEEHDISYKQDEGVCYNARDMAVLRAAMCSAQVVLASATPSLETWAN 390

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + +Y  + L+ R+ ++ LP ++ IDMR + +     +SP +   +   + R EQ+LLF
Sbjct: 391 AEAGKYKRLDLAARFGSAVLPEMRAIDMRAEKLPASTWISPTLKQAMTARIERGEQSLLF 450

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRG+AP+T+C+ CG  + C HC   +VEHR  K+L CHQCG +     +C  C   GK
Sbjct: 451 LNRRGFAPVTICRACGGHVTCDHCDSRMVEHRFMKRLMCHQCGETKPVPDACPTCQVEGK 510

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           M   G GIER+ EE    FP ARI++LSSDL      L+ ++  IA GE DII+GTQLVA
Sbjct: 511 MAPVGPGIERLGEETGALFPEARIAVLSSDLFASARALKQRIEEIAAGEADIILGTQLVA 570

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR       L+Q +QP H
Sbjct: 571 KGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRADKPGEALMQTFQPEH 630

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP- 665
           PV++A++SGD ++F+ +E   R++  +PP+GR+A +++SG +   V +    L +   P 
Sbjct: 631 PVIRAILSGDEEAFWRAEAAERQAAGVPPYGRMAGIVLSGPELPAVMDLGMALARNDGPL 690

Query: 666 RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDI 725
           R     VFGPA +P+  +RGR+R RLLI   + + LQ   ++ +    +    LR+  DI
Sbjct: 691 RQIGAQVFGPAPAPIARIRGRHRVRLLIKASKGTPLQDAIAR-WIKPARLKGDLRLSVDI 749

Query: 726 DPQNFL 731
           DPQNF 
Sbjct: 750 DPQNFF 755


>gi|163738335|ref|ZP_02145750.1| primosomal protein N' [Phaeobacter gallaeciensis BS107]
 gi|161388256|gb|EDQ12610.1| primosomal protein N' [Phaeobacter gallaeciensis BS107]
          Length = 755

 Score =  589 bits (1519), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 307/726 (42%), Positives = 444/726 (61%), Gaps = 15/726 (2%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           RV +L  Q +     Y  P      LG+ V VPL  R VLG++W      +  DS KLRP
Sbjct: 36  RVGVLTTQPLDRCLDYRAPEG-GCHLGAYVEVPLGPRRVLGVIWGPGAGDF--DSAKLRP 92

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPR 132
           +  V D  P+  +M +F+   ADYT +P+  + R+   A  LS+   M + ++ TG  P 
Sbjct: 93  VNRVLDVAPMRDEMRQFLTKSADYTLTPLPAMLRLATRAPGLSDPVSMRKVLRPTGQMPD 152

Query: 133 INTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
             T AR RVL  +++  G  +  ++L   + V++ V+ GL  QG +++  E     +  P
Sbjct: 153 RMTDARERVLSAVEEYGGLAFTAKELADLAGVTTSVVKGLVKQGALRE--EEAPRDLPYP 210

Query: 191 NLYFSLP--ILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
            L   LP   L ++Q      +      G +  +L+ GVTGSGKTEVYLE VAA L  G+
Sbjct: 211 RLDPDLPGKTLTEDQAAAANTLGEGVAGGRYGTTLLKGVTGSGKTEVYLEAVAATLRAGR 270

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           Q L+LLPEI+LT+  L+R ++RFG  PAEWHS  + + R ++WR V +G   +++G RSA
Sbjct: 271 QALVLLPEIALTAEFLKRVEQRFGATPAEWHSGATMTERRRVWRMVGQGKAQLVIGARSA 330

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LFLP++ LGLI++DEEHD SYKQ+EG+ YNARDM+++R  + S  VVL SATPS+E+  N
Sbjct: 331 LFLPYQNLGLIIVDEEHDTSYKQDEGVCYNARDMAVLRAAMCSAQVVLASATPSLETWAN 390

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + +Y  + L+ R+ ++ LP ++ IDMR + +     +SP +   +   + R EQ+LLF
Sbjct: 391 AEAGKYKRLDLAARFGSAVLPEMRAIDMRAEKLPASTWISPTLKQAMTARIERGEQSLLF 450

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRG+AP+T+C+ CG  + C HC   +VEHR  K+L CHQCG +     +C  C   GK
Sbjct: 451 LNRRGFAPVTICRACGGHVTCDHCDSRMVEHRFMKRLMCHQCGETKPVPDACPTCQVEGK 510

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           M   G GIER+ EE    FP ARI++LSSDL      L+ ++  IA GE DII+GTQLVA
Sbjct: 511 MAPVGPGIERLGEETAALFPEARIAVLSSDLFASARALKQRIEEIAAGEADIILGTQLVA 570

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR       L+Q +QP H
Sbjct: 571 KGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRADKPGEALMQTFQPEH 630

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP- 665
           PV++A++SGD ++F+ +E   R++  +PP+GR+A +++SG +   V +    L +   P 
Sbjct: 631 PVIRAILSGDEEAFWRAEAAERQAAGVPPYGRMAGIVLSGPELPAVMDLGMALARNDGPL 690

Query: 666 RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDI 725
           R     VFGPA +P+  +RGR+R RLLI   + + LQ   ++ +    +    LR+  DI
Sbjct: 691 RQIGAQVFGPAPAPIARIRGRHRVRLLIKASKGTPLQDAIAR-WIKPARLKGDLRLSVDI 749

Query: 726 DPQNFL 731
           DPQNF 
Sbjct: 750 DPQNFF 755


>gi|148553145|ref|YP_001260727.1| primosome assembly protein PriA [Sphingomonas wittichii RW1]
 gi|148498335|gb|ABQ66589.1| primosomal protein N' [Sphingomonas wittichii RW1]
          Length = 734

 Score =  588 bits (1517), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 300/725 (41%), Positives = 435/725 (60%), Gaps = 11/725 (1%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNS--EEKYKIDSLK 71
           +R  +LLL    GP  Y       VE GSIV  PL  R ++G+VW         ++   +
Sbjct: 14  ARAHVLLLNPALGPLDYRADREHVVEPGSIVLAPLGPRQMVGVVWEEETLPSADQVGDNR 73

Query: 72  LRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF--TGI 129
           LRP+  V+D PPL+  +   ++W +DY  +P   V RM + + S  +     +++  TG 
Sbjct: 74  LRPLLDVYDVPPLAAPLRRLIEWTSDYYLAPPAAVLRMALPSSSALDGARTIVEYRATGE 133

Query: 130 FPRINTVARLRVLDKI--KDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVV 187
            P   T  R + LD+I  + G I   R+L   + VS  VI GL   G I+ +   I    
Sbjct: 134 RPGRMTPQREQALDRIGQRQGLI---RELATIADVSEGVIRGLVKSGAIEAVTVSIDTPW 190

Query: 188 DSPNL-YFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
           D+P+  + ++ + D+ Q         +  K F   L+ GVTGSGKTEVY E VA  L  G
Sbjct: 191 DAPDPDHKAVELSDEQQLAAGMLAEAVAAKRFQPFLLDGVTGSGKTEVYFEAVAEALRAG 250

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           +Q L+LLPEI+LT   L+RF+ RFG  P  WHS L  S R + WR +  G   V+VG RS
Sbjct: 251 RQTLVLLPEIALTEPFLKRFEARFGHLPVAWHSELRQSQRRRAWRGIVHGEAKVVVGARS 310

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLP++ LGLI++DE H+ S+KQE+G+LY+ARD++++R K+E  P+VL SATP+IE+R 
Sbjct: 311 ALFLPYRDLGLIIVDEAHETSFKQEDGVLYHARDVAVMRAKLEEIPIVLASATPAIETRQ 370

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
                RY  + L+ R+  + +P ++ ID+      +G+ ++P ++  +   L + EQ+LL
Sbjct: 371 QATIGRYTELKLTARHGAAEMPEIEAIDLLADPPPRGRWIAPTLVRALADRLEKKEQSLL 430

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRGYAPLTLC+ CG+R +C +C+ W+VEHR   +L CH CGHS      C  C    
Sbjct: 431 FLNRRGYAPLTLCRTCGHRFQCPNCTAWMVEHRLLGRLQCHHCGHSMAPPAECPECKDED 490

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
            ++ACG G+ERIA+EV   FP AR++I +SD      R    +  +  G+ID+++GTQLV
Sbjct: 491 SLVACGPGVERIADEVAALFPDARVAIATSDTLSTPARAAEFVERMEAGDIDVVVGTQLV 550

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
            KG++FP ++LVGV+D DLGL+  DLR++ER+FQ ++QV GRAGR        IQ + P 
Sbjct: 551 TKGYHFPELTLVGVIDADLGLSGGDLRAAERSFQQIAQVAGRAGRGAKPGHVYIQTHAPK 610

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR 666
            PV+QAL+SGDA SFY +E  AR+    PPFGR AA+IIS  K +E    A  +   AP 
Sbjct: 611 APVIQALLSGDAQSFYTAETEARKIAEAPPFGRYAAIIISAEKLEEAATTARLIGRTAPA 670

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
              + V+GPA +PL M+RGR+R RLL+H +R+ ++Q      +   ++    +RV  D+D
Sbjct: 671 IDGMHVYGPAPAPLAMLRGRHRQRLLVHARRSLDVQQVIRD-WLGPLQWPRGVRVAVDVD 729

Query: 727 PQNFL 731
           P +FL
Sbjct: 730 PYSFL 734


>gi|260426996|ref|ZP_05780975.1| primosomal protein N' (ATP-dependent helicase PriA) [Citreicella
           sp. SE45]
 gi|260421488|gb|EEX14739.1| primosomal protein N' (ATP-dependent helicase PriA) [Citreicella
           sp. SE45]
          Length = 729

 Score =  588 bits (1515), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 302/725 (41%), Positives = 444/725 (61%), Gaps = 15/725 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P     + G+ V VPL  R VLG+VW      +  D  ++R +
Sbjct: 11  VAVLTTQPLDRALDYKAPEGGCWQ-GAFVEVPLGPRKVLGVVWGPGRGDF--DYARVRSV 67

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  ++  F++   DYT +P+  + R+   A  L +   M +  +     P  
Sbjct: 68  IRVLDAAPMRDELRSFLERAGDYTLTPLPAMLRLATRAPGLGDAPSMRKIYRLGDSEPER 127

Query: 134 NTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQ---IFEVISPVVD 188
            T AR RVLD + D  G    + +L   + V+  VI GL   G +++     +   P +D
Sbjct: 128 MTDARRRVLDVLSDMGGLALTQGELAETAGVTPSVIKGLAKTGAVREEEAPRDTPFPRLD 187

Query: 189 SPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
            P+ Y    + D       +    + +  +   L+ GVTGSGKTEVYLE VA  L  G+Q
Sbjct: 188 -PD-YGGKALADDQAVAAQDLRAGVASGRYGTVLLKGVTGSGKTEVYLEAVAECLAQGRQ 245

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
            L+LLPEI+LT+  L R + RFG +PAEWHS ++ + R ++W+Q+A G   ++VG RSAL
Sbjct: 246 ALVLLPEIALTAEFLTRVEARFGARPAEWHSGVTVTERRRVWKQIAAGGAQLVVGARSAL 305

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLP++ LGL+V+DEEHD SYKQ+EG+ YNARDM+++R  I +  VVL SATPS+ES  N 
Sbjct: 306 FLPYRDLGLVVVDEEHDTSYKQDEGVFYNARDMAVLRASICAAQVVLASATPSLESWANA 365

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
            + +Y  + L++R+  S LP ++ IDMR +T+   + +SP +   +   L + EQ +LFL
Sbjct: 366 DAGKYRRLDLTSRFGASVLPEMRAIDMRAETLPSNRWVSPSLQSEVLARLQKGEQAMLFL 425

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAP+T+C+ CG+++ C HC   +VEHR  ++L CHQCG +    ++C  CG+  K+
Sbjct: 426 NRRGYAPVTICRACGHQIGCPHCDARMVEHRFLQRLVCHQCGETIAKPETCPSCGAEDKL 485

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
            A G G+ER+AEE  E FP AR+++LSSDL G    L+ ++  IA+G  DI+IGTQLVAK
Sbjct: 486 AAVGPGVERLAEEAAELFPQARLAVLSSDLFGSARALKEEIEKIAQGGADIVIGTQLVAK 545

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR     + L+Q YQP HP
Sbjct: 546 GHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAEKPGVALLQTYQPEHP 605

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP-R 666
           V++A++SGD + F+++E   R +  +PP+GRLA VI+S T+ QEV +    + ++ AP R
Sbjct: 606 VIRAILSGDEEGFWQAEADERRAAGMPPYGRLAGVILSSTEVQEVFDLGNAMARQDAPLR 665

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
                V+GPA +P+  VRGR+R RLL+   +   LQ   ++ +    +    LR+  DID
Sbjct: 666 RIGAQVYGPAPAPVARVRGRHRVRLLVKAPKGVALQPALAE-WAAQFRLRGELRMAIDID 724

Query: 727 PQNFL 731
           PQ+F 
Sbjct: 725 PQSFF 729


>gi|260431121|ref|ZP_05785092.1| primosomal protein N' (ATP-dependent helicase PriA) [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260414949|gb|EEX08208.1| primosomal protein N' (ATP-dependent helicase PriA) [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 731

 Score =  588 bits (1515), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 305/725 (42%), Positives = 446/725 (61%), Gaps = 17/725 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P      LG+ V VPL  R VLG+VW      +  D  K+R +
Sbjct: 13  VAVLTTQPLDRTLDYKAPEG-GCFLGAFVEVPLGPRKVLGVVWGAGRGDF--DRSKIRSV 69

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  +M  F++  ADYT +PM  + R+   A  L +   M +  +     P  
Sbjct: 70  IRVLDVAPMREEMRLFLQRAADYTLTPMPAMLRLATRAPGLGDPLSMRKIYRLGSGTPDR 129

Query: 134 NTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPV-VDSP 190
            T AR RVL+ ++D  G  +  ++L   + V+S V+ GL  QG ++   E  SP  +  P
Sbjct: 130 MTDARARVLEVLRDYGGLAFTLKELAEMAGVTSSVVKGLVKQGAVR---EEDSPRDLPYP 186

Query: 191 NLYFSLP--ILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
            L    P   L  +Q    + +      G +  +L+ GVTGSGKTEVYLE VA  L +G+
Sbjct: 187 TLDPDRPGKALTPDQTAAADTLRAALRSGTYGTTLLKGVTGSGKTEVYLEAVAEALRMGR 246

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           Q L+LLPEI+LT+  L R ++RFG +PAEWHS  + + R ++WR V +G   ++VG RSA
Sbjct: 247 QALVLLPEIALTAEFLTRVEERFGARPAEWHSGATMTERRRVWRMVGQGDAQMVVGARSA 306

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LFLPF+ LGLIV+DEEHD SYKQE+G+ YNARDM+++R  I    V+L SATPS+ES  N
Sbjct: 307 LFLPFRDLGLIVVDEEHDTSYKQEDGVHYNARDMAVLRAAICGSRVILASATPSLESWAN 366

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + +Y  + L++R+  + LP ++ IDMR + +  G  +SP +   ++  + + EQ+LLF
Sbjct: 367 AEAGKYDRLDLTSRFGAAVLPDMKTIDMRAEKMQPGTWISPSLRQAVQARIEKGEQSLLF 426

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           +NRRGYAP+TLC+ CG ++ C HC   +VEHR  K+L CHQCG +    ++C  CG  GK
Sbjct: 427 INRRGYAPVTLCRACGEQIACDHCDARMVEHRFLKRLMCHQCGETKPMPEACPACGVEGK 486

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           +   G GIER+AEE    FP ARI++LSSDL G    L+ ++  IA+G+ DI+IGTQLVA
Sbjct: 487 LAPVGPGIERLAEEAEATFPDARIAMLSSDLFGSARALKAKIEEIAEGDADIVIGTQLVA 546

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR       L+Q +QP H
Sbjct: 547 KGHNFPNLTLVGVIDSDLGLHGSDLRAAERTFQLMRQVAGRAGRADKPGTALLQTFQPEH 606

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP- 665
           PV++A++SGD + F+ +E   R++  +PP+GR+A +++SG +   V +    L +  +P 
Sbjct: 607 PVIRAILSGDEEGFWRAEAAGRQAAGVPPYGRMAGIVLSGPEVGPVFDIGNALARNDSPL 666

Query: 666 RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDI 725
           R     VFGPA +P+  +RGR+R RLL+   + + +Q   ++ +   ++    +R+  DI
Sbjct: 667 RQIGAQVFGPAPAPIARIRGRHRVRLLVKAPKGAPIQDAITR-WIAPLRLKGDIRLTVDI 725

Query: 726 DPQNF 730
           DPQ+F
Sbjct: 726 DPQSF 730


>gi|85374570|ref|YP_458632.1| primosome assembly protein PriA [Erythrobacter litoralis HTCC2594]
 gi|84787653|gb|ABC63835.1| primosomal protein N [Erythrobacter litoralis HTCC2594]
          Length = 721

 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 307/729 (42%), Positives = 438/729 (60%), Gaps = 20/729 (2%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKY---KIDSL 70
           +R  IL   A      Y VP  M V  GS+V  PL  R +LG+VW   EE+     +   
Sbjct: 2   NRARILTFNAALPVLDYRVPEGMSVVPGSVVVAPLGPREILGVVW--EEERLPGQSVPDA 59

Query: 71  KLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA-------LSETEKMEEK 123
           KLRP+      PPL  ++   ++W ADY  +PM  VARMV+S+       ++ TE     
Sbjct: 60  KLRPLRDTVPVPPLRPELRRLIEWTADYYCAPMSAVARMVLSSGGALRGPMTTTE----- 114

Query: 124 IQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVI 183
            + +G  P   T  R R ++++ +G+    R+L   ++VS  V+ GL  QGV++ +   I
Sbjct: 115 YRLSGGMPERMTAQRERAMERL-EGEQATIRELAEIAEVSDGVLRGLVNQGVLEPVVVDI 173

Query: 184 SPVVDSPNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAV 242
                  +   + PIL   Q++V +++V     + FA  L+ GVTGSGKTE Y E VAA 
Sbjct: 174 DRSYPRAHPDHAEPILSAEQKEVADELVAAVEAEEFAPILLDGVTGSGKTETYFEPVAAA 233

Query: 243 LHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIV 302
           L + +QVL+LLPEI+LT A L RF  RFG  P  WHSSL ++ R + WR ++ G   V+V
Sbjct: 234 LRMDRQVLVLLPEIALTEAFLRRFADRFGAAPIVWHSSLKSTERRRAWRAISTGEAQVVV 293

Query: 303 GVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSI 362
           G RSALFLP+  LGLIV+DE H++S+KQ++G+ YNARD++++RG  E  PV+L SATP++
Sbjct: 294 GARSALFLPYDNLGLIVVDEAHEVSFKQDDGVRYNARDVAVMRGHFEKHPVILASATPAL 353

Query: 363 ESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNE 422
           ES     S  Y  + L +RY  + LP +++ID+  +   +G+ L+P +   +   L R E
Sbjct: 354 ESLQMAESGIYRKLDLPSRYGGAELPDIKLIDLTEEKPERGRWLAPSLARELFARLERGE 413

Query: 423 QTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVC 482
           Q+LLFLNRRGYAPLTLC+ CG R +C +CS WLVEHR  ++L CH CGH     ++C  C
Sbjct: 414 QSLLFLNRRGYAPLTLCRNCGFRFQCSNCSAWLVEHRFSQRLACHHCGHEEQPPETCPDC 473

Query: 483 GSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIG 542
                ++ACG G+ERIA+EV E  P AR+++++SD      +    +      EID+I+G
Sbjct: 474 NEPDCLVACGPGVERIADEVAEILPDARVAVVTSDTLNTPDKAAEFVRQAEAREIDVIVG 533

Query: 543 TQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQA 602
           TQLV KG +FP ++LVGVVD DLGL   DLR++ERT+Q ++QV GRAGR       LIQ 
Sbjct: 534 TQLVTKGFHFPELTLVGVVDADLGLEGGDLRAAERTYQQVAQVAGRAGRGSKPGEVLIQT 593

Query: 603 YQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE 662
             P  PV++AL +GD D+FYE+E  AR     PPFGR AA+I+S     E    A  +  
Sbjct: 594 RHPEAPVIEALAAGDRDAFYEAETEARRFAGAPPFGRWAAIIVSSEDEAEAREAAQRIGA 653

Query: 663 HAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQ 722
             PR  DI + GPA +P+ ++RGRYR+R L++ +R++ +Q    Q  D  +     +RV 
Sbjct: 654 TQPRIEDIAILGPAPAPMALLRGRYRYRFLVNARRSAKVQEALRQWLD-PLDFPRGVRVS 712

Query: 723 FDIDPQNFL 731
            DIDP +F+
Sbjct: 713 IDIDPYSFV 721


>gi|126737212|ref|ZP_01752947.1| primosome assembly protein PriA [Roseobacter sp. SK209-2-6]
 gi|126721797|gb|EBA18500.1| primosome assembly protein PriA [Roseobacter sp. SK209-2-6]
          Length = 731

 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 306/726 (42%), Positives = 442/726 (60%), Gaps = 15/726 (2%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           RV +L  Q +     Y  P       G+ V VPL  R VLG++W +    +  DS KLR 
Sbjct: 12  RVAVLTAQPLDRLLDYRAPEGGCFR-GAFVEVPLGPRKVLGVIWGSGSGDF--DSAKLRS 68

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPR 132
           +  V D  P+  +M  F+   ADYT +PM  + R+   A  LS+   M + ++     P 
Sbjct: 69  VIRVLDVAPMRDEMRAFLGKAADYTLTPMHAMLRLATRAPGLSDPPSMRKILRLGEGEPD 128

Query: 133 INTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
             T AR +VL  +++  G  +  ++L   + V++ V+ GL  QG +++  E     +  P
Sbjct: 129 RMTDARAKVLAVMEEFGGLAFTPKELADMAGVTASVVKGLVKQGALRE--EETPRDLPYP 186

Query: 191 NLYFSLPILDKNQQD---VVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
            L   LP  +  Q          V + + G+  +L+ GVTGSGKTEVYLE VA+ L  G+
Sbjct: 187 RLDPELPGKELTQDQSAAAAALAVGVQSGGYGTTLLKGVTGSGKTEVYLEAVASCLRKGR 246

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           Q L+LLPEI+LT+  L+R ++RFG  PAEWHS ++ + R ++WR V +G   +++G RSA
Sbjct: 247 QALVLLPEIALTAEFLKRVEQRFGATPAEWHSGVTMTERRRVWRMVGQGNAQLVIGARSA 306

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LFLPF+ LGLI++DEEHD SYKQE+G+LYNARDMS++R  + S  VVL SATPS+E+  N
Sbjct: 307 LFLPFRDLGLIIVDEEHDTSYKQEDGVLYNARDMSVLRAALCSAQVVLASATPSLETWAN 366

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + +Y  + L+ R+  + LP ++ +DMR + +     +SP +   ++  L   EQ+LLF
Sbjct: 367 AEAGKYKRLDLTARFGTAVLPEMKALDMRAEEMLPSTWISPSLKFAMKKRLEAGEQSLLF 426

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRG+AP+T+C+ CG ++ C HC   +VEHR  K+L CHQCG +    ++C  C   GK
Sbjct: 427 LNRRGFAPVTICRACGAQVACDHCDARMVEHRFLKRLMCHQCGETKPVPEACPSCQVEGK 486

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           M   G GIER+ EE    FP ARI++LSSDL G    L+ ++  IA GE DII+GTQLVA
Sbjct: 487 MAPVGPGIERLGEEAAALFPEARIAVLSSDLFGSARALKTRIEEIAAGEADIILGTQLVA 546

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP ++LVGV+D DLGL  +DLR+ ERTFQL+ QV GRAGR       L+Q +QP H
Sbjct: 547 KGHNFPLLTLVGVIDADLGLQGSDLRAGERTFQLMRQVAGRAGRAERPGEALLQTFQPEH 606

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEH-AP- 665
           PV++A++SGD + F+ +E   R    +PP+GR+A +I+SG+   +V +    L ++  P 
Sbjct: 607 PVIRAILSGDEEEFWRAEAEQRREAGVPPYGRMAGIILSGSDLAQVFDLGNALAQNDGPL 666

Query: 666 RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDI 725
           R     +FGPA +P+  VRGR+R RLL+   + + LQ   ++ +    K    LR+  DI
Sbjct: 667 RQIGAQLFGPAPAPIARVRGRHRVRLLVKAAKGAPLQEALAR-WVAPFKLRGDLRLNIDI 725

Query: 726 DPQNFL 731
           DPQNF 
Sbjct: 726 DPQNFF 731


>gi|259417319|ref|ZP_05741238.1| primosomal protein N' (ATP-dependent helicase PriA) [Silicibacter
           sp. TrichCH4B]
 gi|259346225|gb|EEW58039.1| primosomal protein N' (ATP-dependent helicase PriA) [Silicibacter
           sp. TrichCH4B]
          Length = 735

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 310/726 (42%), Positives = 445/726 (61%), Gaps = 15/726 (2%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           RV +L  Q +     Y  P      LG+ V VPL  R V+G+VW      +  D+ KLR 
Sbjct: 16  RVGVLTAQPLDRLLDYRAPEG-GCFLGAFVEVPLGPRKVVGVVWGPGAGDF--DAAKLRS 72

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPR 132
           +  V D  P+  +M  F++  A YT +PM ++ R+   A  L++   M + ++     P 
Sbjct: 73  VIRVLDLAPMRAEMRSFLERAAQYTLTPMSMMLRLATRAPGLADPPSMRKVLRRGDGEPD 132

Query: 133 INTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
             T AR +VLD + +  G  +   +L   + V++ V+ GL  QG I++  E     +  P
Sbjct: 133 RMTDARAKVLDVMDEYEGAAFTASELSGLAGVTTSVVKGLVKQGAIRE--EEAPRDLPFP 190

Query: 191 NLYFSLP--ILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
            L   LP   L ++Q      +      G +  +L+ GVTGSGKTEVYLE VAA L  G+
Sbjct: 191 PLDPELPGKTLSEDQATAAAALEAGVNGGRYGTTLLKGVTGSGKTEVYLEAVAACLRKGR 250

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           Q L+LLPEI+LT+  L+R + RFG  PAEWHS ++ + R ++WR V +GA  +++G RS+
Sbjct: 251 QALVLLPEIALTAEFLKRVEARFGAVPAEWHSGVTMTERRRVWRMVGQGAAQLVIGARSS 310

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           L+LPF+ LGLI++DEEHD SYKQEEG+LYNARD+++ R  +    VVL SATPS+E+  N
Sbjct: 311 LYLPFRDLGLIIVDEEHDTSYKQEEGVLYNARDLAVWRASLCQAQVVLASATPSLETWAN 370

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + +Y  + L++R+  S LP ++ IDMR + +     +SP +   ++  L R EQ+LLF
Sbjct: 371 AEAGKYQRLDLTSRFGESVLPEMRAIDMRSEELLPSTWISPTLKHAMKLRLERGEQSLLF 430

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRG+AP+T+C+ CG ++ C +C   +VEHR  K+L CHQCG +      C  C   GK
Sbjct: 431 LNRRGFAPVTICRACGTQVACDNCDARMVEHRFMKRLMCHQCGETKPVPTECPSCKVEGK 490

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           M   G GIER+ EE    FP ARI++LSSDL G    L+ ++  IA GE DII+GTQLVA
Sbjct: 491 MAPVGPGIERLGEEAAALFPEARIAVLSSDLFGSARALKQRIEEIAAGEADIILGTQLVA 550

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR   +   L+Q++QP H
Sbjct: 551 KGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAERRGEALMQSFQPEH 610

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP- 665
           PV++A++SGD +SF+ +E   R++  +PP+GR+A +I+SGT   +V +    L +   P 
Sbjct: 611 PVIRAILSGDEESFWRAEAEQRQAAGVPPYGRMAGIILSGTDLAQVFDLGGALARNDGPL 670

Query: 666 RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDI 725
           R     +FGPA +P+  VRGR+R RLLI   +   LQ   ++ +    K    LR+  DI
Sbjct: 671 RQVGAQLFGPAPAPIARVRGRHRVRLLIKADKGVPLQDAITR-WTAPFKLRGDLRLNVDI 729

Query: 726 DPQNFL 731
           DPQNFL
Sbjct: 730 DPQNFL 735


>gi|94495691|ref|ZP_01302271.1| primosomal protein N' [Sphingomonas sp. SKA58]
 gi|94425079|gb|EAT10100.1| primosomal protein N' [Sphingomonas sp. SKA58]
          Length = 723

 Score =  585 bits (1509), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 314/733 (42%), Positives = 434/733 (59%), Gaps = 23/733 (3%)

Query: 12  VCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSE--EKYKIDS 69
           + SR  +LLL A  GP  Y VP  M+VE GSIV  PL  R ++G+VW      E   +  
Sbjct: 1   MSSRARVLLLNAALGPLDYRVPHGMRVEHGSIVVAPLGPRQIIGVVWEEDRFPEVESVGD 60

Query: 70  LKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF--T 127
            +LR +  V D PPL   +   ++W ADY  SP   V RM +S++S  E     I++  T
Sbjct: 61  NRLRNLLEVVDAPPLPEPLRRLIEWTADYYLSPPAAVLRMALSSMSALEGARTVIEYRAT 120

Query: 128 GIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQ-IFEVISPV 186
           G  P   T  R + L++I      E++ LIR   +   V D +  +G+IKQ IFE +   
Sbjct: 121 GAVPERMTEQRAQALERIG-----ERQGLIRELAMIGGVSDAV-IRGLIKQDIFEPVEVS 174

Query: 187 VDSPNLYFSLPILDKNQQDVVE--------QVVPLCTKGFAVSLISGVTGSGKTEVYLEI 238
           VD+P   F +P  D    D+ E            +    FA  L+ GVTGSGKTEVY E 
Sbjct: 175 VDTP---FPMPDPDHAPPDLSEAQRAAAGQMADAVRAADFAPFLLDGVTGSGKTEVYFEA 231

Query: 239 VAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAI 298
           +AA +   +QVL+LLPEI+LT   LERF+KRFG  P  WHS L  S R + WR +A G  
Sbjct: 232 IAAAIRADRQVLVLLPEIALTEPFLERFEKRFGCVPVNWHSGLRQSERRRAWRAIASGQA 291

Query: 299 SVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSA 358
            V+VG RSALFLP+ KLGLI++DE H+ S+KQE+G+ Y+ARD++++RG IE FPVVL SA
Sbjct: 292 QVVVGARSALFLPYPKLGLIIVDEAHEASFKQEDGVHYHARDVAVMRGLIEKFPVVLASA 351

Query: 359 TPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTL 418
           TP+IE+R      RY  + L +R+  + +P +  I++      +G+ ++P ++  I  T+
Sbjct: 352 TPAIETRHQVELGRYAEIKLPSRFGGAEMPDIHGINLLTDPPERGRWIAPPLVQAIDETM 411

Query: 419 ARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQS 478
           AR EQ+LLFLNRRGYAPLTLC+ CG R +C +C+ W+VEHR   +L CH CGH     + 
Sbjct: 412 ARGEQSLLFLNRRGYAPLTLCRHCGYRFQCPNCTAWMVEHRLTHRLACHHCGHVIPAPRR 471

Query: 479 CVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEID 538
           C  C     ++ACG G+ERIA+EV   +P AR +I +SD      R    + ++  G++D
Sbjct: 472 CPECKEEDSLVACGPGVERIADEVKTLWPQARTAIATSDTLWSPARAAEFVKSVEGGDVD 531

Query: 539 IIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLG 598
           IIIGTQLV KG++FP ++LVGV+D DLGL   DLR++ERTFQ + QV GRAGR       
Sbjct: 532 IIIGTQLVTKGYHFPNLTLVGVIDADLGLEGGDLRAAERTFQQVMQVAGRAGRGEKPGHV 591

Query: 599 LIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY 658
            IQ   P   V+Q+L+  D + FY  E   R   N PPFGR AA+I+S     E    A 
Sbjct: 592 FIQTRMPESEVIQSLIDADPERFYAVETENRRRANAPPFGRFAAIIVSSEDADEAAQTAR 651

Query: 659 NLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNA 718
            + + AP    + V+GPA +PL ++RGR+R RLLIH  R  ++Q    +   N + +S  
Sbjct: 652 LIGKSAPVIEGMRVYGPAPAPLAVLRGRHRHRLLIHASRQVDIQAAIREWLGNLVWKSGT 711

Query: 719 LRVQFDIDPQNFL 731
            RV  D+DP +F+
Sbjct: 712 -RVAVDVDPYSFM 723


>gi|254512229|ref|ZP_05124296.1| putative primosomal protein N' [Rhodobacteraceae bacterium KLH11]
 gi|221535940|gb|EEE38928.1| putative primosomal protein N' [Rhodobacteraceae bacterium KLH11]
          Length = 731

 Score =  585 bits (1509), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 306/725 (42%), Positives = 448/725 (61%), Gaps = 17/725 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P      LG+ V VPL  R VLG+VW   +  + +   K R +
Sbjct: 13  VAVLTTQPLDRALDYKAPEG-GCFLGAFVEVPLGPRKVLGVVWGPGQGGFDLG--KARSV 69

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V +  P+  +M  F+  VADYT +PM  + R+   A  L +   M +  +     P  
Sbjct: 70  IRVLEVAPMREEMRLFLGKVADYTLTPMPAMLRLATRAPGLGDPPSMRKVYRMGTGQPDR 129

Query: 134 NTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPV-VDSP 190
            T AR RVL+ ++D  G  +  ++L   + V+  V+ GL  QG ++   E  SP  +  P
Sbjct: 130 MTDARTRVLEVLRDYGGLAFTLKELAEQAGVTPSVVKGLVKQGAVR---EEDSPRDLPYP 186

Query: 191 NLYFSLPILD--KNQQDVVEQV-VPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
           +L   LP  D  ++Q   VE++     T  +  +L+ GVTGSGKTEVYLE VA  L +G+
Sbjct: 187 HLDPDLPGKDLTEDQGAAVERLHAGQRTGDYGTTLLKGVTGSGKTEVYLEAVAETLRMGR 246

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           Q L+LLPEI+LT+  L R ++RFG +PAEWHS  + + R ++WR V +G   ++VG RSA
Sbjct: 247 QALVLLPEIALTAEFLMRVEERFGARPAEWHSGATMTERRRVWRMVGQGDAQLVVGARSA 306

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LFLPF+ LGL+V+DEEHD SYKQE+G+ Y+ARDM+++R  I    V+L SATPS+ES  N
Sbjct: 307 LFLPFRNLGLVVVDEEHDTSYKQEDGVHYSARDMAVLRSSICGARVILASATPSLESWAN 366

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + +Y  + L+ R+  + LP ++ IDMR + +  G  +SP +   +R  + R EQ+LLF
Sbjct: 367 AEAGKYERLDLTARFGAAVLPEMKSIDMRAEQLQPGTWISPSLRQAVRQRIERGEQSLLF 426

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           +NRRGYAP+TLC+ CG ++ C HC   +VEHR  K+L CHQCG +    ++C  CG  GK
Sbjct: 427 INRRGYAPVTLCRACGAQIACDHCDARMVEHRFLKRLMCHQCGETKPMPEACPSCGVEGK 486

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           +   G GIER+AEE    FP A+I++LSSDL G    L+ ++  IAKG+ DI+IGTQLVA
Sbjct: 487 LAPVGPGIERLAEEAEATFPDAKIAMLSSDLFGSARALKAKIEEIAKGDADIVIGTQLVA 546

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP+++LVGV+D DL L  ADLR++ERTFQL+ QV GRAGR       L+Q +QP H
Sbjct: 547 KGHNFPKLTLVGVIDADLSLHGADLRAAERTFQLMRQVAGRAGRADKPGQALLQTFQPEH 606

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENY--AYNLKEHAP 665
           PV++A++SGD + F+ +E   R++  +PP+GR+A +++SG +   V +   A    + A 
Sbjct: 607 PVIRAILSGDEEGFWRAEAAGRQAAGVPPYGRMAGIVLSGPEVGPVFDIGNAMARNDGAL 666

Query: 666 RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDI 725
           R     VFGPA +P+  +RGR+R RLL+   + + +Q   ++ +   ++    +R+  DI
Sbjct: 667 REIGAQVFGPAPAPIARIRGRHRVRLLVKAPKGAPVQDAIAR-WIAPLRLKGDIRLTVDI 725

Query: 726 DPQNF 730
           DPQ+F
Sbjct: 726 DPQSF 730


>gi|126462973|ref|YP_001044087.1| primosome assembly protein PriA [Rhodobacter sphaeroides ATCC
           17029]
 gi|126104637|gb|ABN77315.1| primosomal protein N' [Rhodobacter sphaeroides ATCC 17029]
          Length = 730

 Score =  585 bits (1507), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 319/737 (43%), Positives = 447/737 (60%), Gaps = 17/737 (2%)

Query: 4   SGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE 63
           +G   EG   +RV +L  + +     Y  P     +LG  V VPL  R V+G+VW   E 
Sbjct: 2   TGRFAEG---ARVGVLTTEPLGRVLDYRAPEG-GCDLGDYVVVPLGPRRVMGVVWGPGEG 57

Query: 64  KYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKME 121
            +  D+ KLR IE V D  P+  +M  F+   ADYT +P+  + R+   A  L E   + 
Sbjct: 58  GF--DAAKLRGIERVLDAAPMREEMRLFLARAADYTLTPLPAMLRLASRAPGLGEPPAVR 115

Query: 122 EKIQFTGIFPRINTVARLRVLDKIK--DGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQI 179
              + +G  P   T  R RVLD +    G      +L   + V+  V+ GL   G I + 
Sbjct: 116 RVYRASGHEPARLTEPRQRVLDALAAYGGAPVTLAELSAEAGVTGSVVKGLVKAGAILE- 174

Query: 180 FEVISPVVDSPNLYFSLPI-LDKNQQDVVEQVVPLCT-KGFAVSLISGVTGSGKTEVYLE 237
            E    +   P    + P+ L+ +Q    E +V       ++ +L+ GVTGSGKTEVYLE
Sbjct: 175 EEAPRDLPYPPLDPGAAPVRLEGDQVAAAEALVAAVAADSYSTTLLKGVTGSGKTEVYLE 234

Query: 238 IVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGA 297
            VA  L  G+Q L+LLPEI+LTS  L R + RFG +PAEWHS ++ + R ++WR V+ G 
Sbjct: 235 AVAECLRRGRQALVLLPEIALTSEFLARVEARFGARPAEWHSGVTATERRRLWRMVSEGQ 294

Query: 298 ISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVS 357
              + G RSALFLPF+ LGL+V+DEEHD SYKQEEG LYNARDM+++R  I   P VL S
Sbjct: 295 AQFVAGARSALFLPFRDLGLVVVDEEHDTSYKQEEGALYNARDMAVLRASICGCPAVLAS 354

Query: 358 ATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHT 417
           ATPS+ES VN    RY  + L  R+  + LP +  ID+R + +   + +S  +   +   
Sbjct: 355 ATPSLESWVNAAQGRYARLDLGARFGAAELPEMHAIDLRPEKLPANRWISEALARSVEAR 414

Query: 418 LARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQ 477
           +AR EQ+LLFLNRRGYAP+T+C+ CG+++ C HC   +VEHR +K+L CHQCG +    +
Sbjct: 415 IARGEQSLLFLNRRGYAPVTICRACGHQIGCDHCDARMVEHRFQKRLVCHQCGATKPMPE 474

Query: 478 SCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEI 537
           +C  CG  G+M   G G+ER+AEEV E FP AR+++LSSDL G    L+ Q++AIA+G  
Sbjct: 475 ACPSCGVEGRMAPVGPGVERLAEEVAERFPQARVAVLSSDLFGSARALKEQIAAIAEGGA 534

Query: 538 DIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGR-FGLKS 596
           DIIIGTQ+VAKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR  G + 
Sbjct: 535 DIIIGTQIVAKGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLVRQVAGRAGRSAGRRG 594

Query: 597 LGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEV-EN 655
           + L+Q  QP HPV++A++ GD ++F+++E   R    +PP+GRLA +I+S     +V E 
Sbjct: 595 VALVQTCQPEHPVIRAILGGDEEAFWKAEAEERRVAGMPPYGRLAGIILSSPDVAQVFET 654

Query: 656 YAYNLKEHAP-RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIK 714
            A   +   P R     VFGPA +P+  VRGR+R RLL+   + + LQ   ++ +   +K
Sbjct: 655 GAELARADGPLRRIGAQVFGPAPAPIARVRGRHRVRLLVKAGKGAPLQAALAE-WIAQVK 713

Query: 715 RSNALRVQFDIDPQNFL 731
               LR+  DIDPQ+FL
Sbjct: 714 LPANLRLAVDIDPQSFL 730


>gi|254486082|ref|ZP_05099287.1| primosomal protein N', putative [Roseobacter sp. GAI101]
 gi|214042951|gb|EEB83589.1| primosomal protein N', putative [Roseobacter sp. GAI101]
          Length = 731

 Score =  584 bits (1506), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 310/726 (42%), Positives = 435/726 (59%), Gaps = 19/726 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P      LG+ V VPL  R VLG+VW   +  Y +   K+R +
Sbjct: 13  VGVLTTQPLGRALDYKAPEG-GCHLGAFVEVPLGPRKVLGVVWGAGQGDYDLS--KVRSV 69

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  ++  F+   A YT +PM  + R+   A  L +   M +  +     P  
Sbjct: 70  IRVLDAAPMREELRSFLSRAAAYTLTPMPAMLRLATRAPGLGDPPSMRKIYRRGTAEPDR 129

Query: 134 NTVARLRVLDKIKD-GKI-WEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPN 191
            T AR RVL  + D G + +  ++L   + V+S VI GL AQ     + E  SP  D P 
Sbjct: 130 MTDARRRVLATLADYGDLSFTLKELAEMAGVTSSVIKGLVAQ---DAVIEQDSPR-DVPF 185

Query: 192 LYFSLPILDKNQQDVVEQVVPLCTKG-----FAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
                 +  K           L  KG     +A +L+ GVTGSGKTEVYLE VAA L  G
Sbjct: 186 ARMDPTLPSKELTADQAAASALLAKGVASETYATTLLRGVTGSGKTEVYLEAVAAALKAG 245

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           +Q L+LLPEI+LT   L R   RFG KPAEWHS  + + R +IWR V +G   V++G RS
Sbjct: 246 RQALVLLPEIALTEQFLHRIAARFGTKPAEWHSGATMTERRRIWRMVGQGNAQVVIGARS 305

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLPF+ LGLIV+DEEHD SYKQEEG+LYNARDM+++R  I    VVL SATPS+ES  
Sbjct: 306 ALFLPFQNLGLIVVDEEHDTSYKQEEGVLYNARDMAVLRASICGAQVVLASATPSLESWA 365

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N  + +Y  V L++R+  + +P +  IDMR + +   K +SP +   +   L R EQ +L
Sbjct: 366 NAEAGKYTRVELTSRFGPAVMPKMGAIDMRAEGLPSDKWVSPTLRAEVDKRLERGEQAML 425

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           F+NRRGYAP+TLC+ CG+++ C  C   +VEHR  K+L CHQCG S    ++C  C ++G
Sbjct: 426 FINRRGYAPVTLCRACGHQIGCDDCDARMVEHRFLKRLVCHQCGESKPMPEACPSCDATG 485

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
           K+ A G G+ER+ EE    +P AR++ LSSD+ G    L+ +++ IA+G  DIIIGTQLV
Sbjct: 486 KLAAVGPGVERLGEEAAALWPDARVATLSSDMYGSARALKAEIAGIAEGAADIIIGTQLV 545

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR       L+Q YQP 
Sbjct: 546 AKGHNFPNLTLVGVIDADLGLMGSDLRAAERTFQLMRQVAGRAGRAETPGTALLQTYQPD 605

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP 665
           HPV++A+++GD + F+++E   R    +PP+GR+A +I+SG       +    L ++  P
Sbjct: 606 HPVIRAILAGDEEGFWKAEAGERRQAGVPPYGRMAGIILSGPDVAAAFDAGNQLARQDGP 665

Query: 666 -RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFD 724
            R+    V+GPA +P+  VRGR+R RLL+   +++ LQ   ++ +   ++    LR+  D
Sbjct: 666 LRAVGAKVYGPAPAPIARVRGRHRVRLLVKADKSAPLQDALAK-WVGQLRLKGDLRIAVD 724

Query: 725 IDPQNF 730
           IDPQ+F
Sbjct: 725 IDPQSF 730


>gi|209965537|ref|YP_002298452.1| primosome assembly protein PriA [Rhodospirillum centenum SW]
 gi|209959003|gb|ACI99639.1| primosomal protein N' [Rhodospirillum centenum SW]
          Length = 748

 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 313/728 (42%), Positives = 432/728 (59%), Gaps = 12/728 (1%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYK--IDSLKL 72
           RV +LL      P+ Y  P  + +  GS V VPL  R V G+VW   +      +   KL
Sbjct: 22  RVRVLLPLPFPEPFDYGAPPGLDLPPGSYVEVPLGPRRVFGVVWGEGDPAAPGAVPDAKL 81

Query: 73  RPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGI 129
           +P+   FD PP+      FV WVA YT +P G V RM VS   AL     +    +  G 
Sbjct: 82  KPVLRRFDLPPMPEVSRRFVDWVAAYTMTPPGNVLRMAVSVSAALEGPRVLTAYGRADGD 141

Query: 130 FPRINTVA--RLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVV 187
            P    ++  R R+LD + DG      +L   +  +  V+  +   GV+  +     P  
Sbjct: 142 LPDGFKLSPQRRRILDLLADGPPRPAAELAAEAGCTPAVVRAMADAGVLLPVPLRSGPRF 201

Query: 188 DSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
             P+     P L   Q    E +      G ++ +L+ GVTGSGKTEVY E +AA L  G
Sbjct: 202 AVPDGALPGPTLSPPQAAAAETLREKVAAGAYSATLLDGVTGSGKTEVYFEAIAAALRAG 261

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           +Q L+LLPEI+L+   L+RF +RFG +PAEWHS L   +R   WR VA G + V+VG RS
Sbjct: 262 RQALVLLPEIALSPQSLDRFARRFGARPAEWHSDLPPPLRRNTWRAVASGEVRVVVGARS 321

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLP+  LGLI++DEEH+ ++KQEEG++Y+ARDM++ R  +   P+VLVSATPS+E+  
Sbjct: 322 ALFLPYPDLGLIIVDEEHEPAFKQEEGVVYHARDMAVARAHLGRIPIVLVSATPSLETLA 381

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLARNEQT 424
           N  + RY  + L  R+  + LP + +ID+R    A      LSP + D +  TLA  EQ 
Sbjct: 382 NAEAGRYGRIDLPDRHGGAELPEVTLIDLRRPDAAPPPRHWLSPVLRDALTETLAAGEQA 441

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           +LFLNRRGYAPLTLC+ CG+RL+C +C+ WLVEHR  ++L CH CG++A     C  CG+
Sbjct: 442 MLFLNRRGYAPLTLCRACGHRLQCPNCTAWLVEHRLSRRLQCHHCGYTARLPDECPQCGA 501

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
            G  +ACG G+ER+AEEV E FP AR+++L+SD   G   +Q  +  +   EID++IGTQ
Sbjct: 502 EGSFVACGPGVERVAEEVTELFPDARVAVLTSDTLLGPRAMQETVERVKAHEIDLLIGTQ 561

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+FP ++LVGVVD DLGL+  DLR+ ERTFQLL QV GRAGR        +Q + 
Sbjct: 562 VMAKGHHFPLLTLVGVVDADLGLSGGDLRAGERTFQLLHQVAGRAGRESRPGRVFLQTHM 621

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P  PVM+AL + D D+F   E  AR    +PP+GRLAA+I+SG   + VE  A  L   A
Sbjct: 622 PDTPVMRALAAHDRDAFLAHEAEARRQTEMPPYGRLAALIVSGEDERTVEQAALRLGRAA 681

Query: 665 PRS-SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQF 723
           P    ++ V GPA +PL ++RGR+R RLL+ G +   LQ   +  +   ++    +RVQ 
Sbjct: 682 PHDRPELTVLGPAPAPLAILRGRHRRRLLLRGPKGLALQPVVAD-WLAAVEIPAGVRVQV 740

Query: 724 DIDPQNFL 731
           DIDP +FL
Sbjct: 741 DIDPYSFL 748


>gi|89053524|ref|YP_508975.1| primosome assembly protein PriA [Jannaschia sp. CCS1]
 gi|88863073|gb|ABD53950.1| primosomal protein N' [Jannaschia sp. CCS1]
          Length = 732

 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 311/703 (44%), Positives = 431/703 (61%), Gaps = 18/703 (2%)

Query: 40  LGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYT 99
           LG+ V VPL  R VLG+VW      + I   K+R +  V D  P+  +M +F++    YT
Sbjct: 37  LGAFVEVPLGPRKVLGVVWGPGRGDWDI--AKVRSVNRVLDVAPMRAEMRKFLEKAGAYT 94

Query: 100 FSPMGLVARMV--VSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKD--GKIWEKRD 155
            +PM L+ R+   V  LS+   M +  +     P   T AR RV++ + +  G  +  ++
Sbjct: 95  LTPMSLMLRLATRVPGLSDPPSMRKVYRLGQGTPDRVTPARTRVIEALVEYGGLAFTLKE 154

Query: 156 LIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCT 215
           L   + V+S V+ GL  QGV++   E  +P  D+P L     +  K   +  E       
Sbjct: 155 LSELAGVTSTVVKGLAKQGVVE---EADTPR-DAPYLTLDPGLPGKELTEDQEIAADRLQ 210

Query: 216 KG-----FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRF 270
           +G     +   L+ GVTGSGKTEVYLE VA  L  G+Q L+LLPEI+LTS  L R + RF
Sbjct: 211 EGSRARRYGAVLLKGVTGSGKTEVYLEAVAECLRQGRQALVLLPEIALTSEFLTRVKARF 270

Query: 271 GVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQ 330
           G  PAEWHS ++ + R + WR V +G   ++VG RSALFLP++ LGLIV+DEEHD SYKQ
Sbjct: 271 GADPAEWHSGVTMTERRRCWRMVGQGEAQLVVGARSALFLPYRDLGLIVVDEEHDTSYKQ 330

Query: 331 EEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHL 390
           +EG  YNARDM+++R  +    VVL SATPS+E+  N  + +Y  + L +R+    LP +
Sbjct: 331 DEGASYNARDMAVLRASLNEAQVVLASATPSLETWSNAQAGKYTRLDLVSRFGPQDLPDM 390

Query: 391 QVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLH 450
             IDMR + +  G  LSP +   +   L   EQ LLFLNRRGYAP+TLC+ CG  + C H
Sbjct: 391 ASIDMRLEDLPGGSWLSPSLTSAVGARLQAGEQALLFLNRRGYAPVTLCRACGEMVGCDH 450

Query: 451 CSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLAR 510
           C   +VEHR +K+L CHQCG +    + C  CG+ GKM A G G+ERIAEE    FP A+
Sbjct: 451 CDARMVEHRFQKRLICHQCGETKPLPEVCPSCGAEGKMAAVGPGVERIAEEAAAAFPDAK 510

Query: 511 ISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNA 570
           ++ILSSDL G    L+ Q+  +A G+ D+IIGTQLVAKGHNFPR++LVGVVD DLGL  +
Sbjct: 511 LAILSSDLFGSARALKAQIEELANGDTDLIIGTQLVAKGHNFPRLTLVGVVDADLGLQGS 570

Query: 571 DLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARE 630
           DLR++ERTFQL+ QV GRAGR       L+Q +QP HPV++A++SGD + F+ +E   RE
Sbjct: 571 DLRAAERTFQLMRQVAGRAGRADKPGQALLQTFQPEHPVIRAILSGDEEGFWRTEAAERE 630

Query: 631 SVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP-RSSDIVVFGPAESPLFMVRGRYR 688
           +  +PP+GRLA +IIS T+     +   +L +   P R +  +V+GPA +P+  VRGR+R
Sbjct: 631 AAGMPPYGRLAGIIISSTEAAAAFDLGTHLARNDGPIREAGGIVYGPAPAPIARVRGRHR 690

Query: 689 FRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            RLL+   +   LQ   S+ + + +K    LR+  DIDPQNF 
Sbjct: 691 VRLLVKAPKGVALQPALSR-WTHGLKLPGHLRLAIDIDPQNFF 732


>gi|254462197|ref|ZP_05075613.1| primosomal protein N [Rhodobacterales bacterium HTCC2083]
 gi|206678786|gb|EDZ43273.1| primosomal protein N [Rhodobacteraceae bacterium HTCC2083]
          Length = 739

 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 307/706 (43%), Positives = 445/706 (63%), Gaps = 26/706 (3%)

Query: 40  LGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYT 99
           +G+ V VPL  R V+G+VW   +  +  D  K R +  V   PP+  ++ +F++    YT
Sbjct: 44  IGAFVEVPLGPRKVMGVVWGPGKGDW--DYAKTRKVIRVLYVPPMRAELRDFLEKAGAYT 101

Query: 100 FSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRINTVARLRVLDKIKD-GKI-WEKRD 155
            + M  + R+ V A  L +   M +  +   + P   T AR RVLD + + G + +  ++
Sbjct: 102 LTDMESMLRLGVRAPGLGDPPSMRKIYRKGDVEPDRMTEARGRVLDALDEYGDLSFTLKE 161

Query: 156 LIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP-NLYF-----SLP--ILDKNQQDVV 207
           L   + V+S V+ GL   G + +         D+P +L F     SLP   L  +Q +  
Sbjct: 162 LSETAGVTSSVVKGLVKLGAVSE--------QDTPRDLPFVRLDPSLPGKELAPDQAEAA 213

Query: 208 EQV-VPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERF 266
           EQ+   +C+  +  +L+ GVTGSGKTEVYLE VA  L  G+Q L+LLPEI+LT+A L R 
Sbjct: 214 EQLKAGVCSGAYGTTLLRGVTGSGKTEVYLEAVAECLRKGRQALVLLPEIALTAAFLTRV 273

Query: 267 QKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDI 326
            +RFG KPAEWHS ++ + R + W+ V +G   ++VG RSALFLPF+ LGLIV+DEEHD 
Sbjct: 274 LERFGAKPAEWHSGVTMTERRRTWKMVGQGGAQLVVGARSALFLPFRDLGLIVVDEEHDT 333

Query: 327 SYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSA 386
           SYKQE+G+LYNARDM+++R  I S  V+L SATPS+ES  N  + +Y  + L++R+ ++ 
Sbjct: 334 SYKQEDGVLYNARDMTVLRASICSAQVILASATPSLESWANAEAGKYTRIDLTSRFGDAV 393

Query: 387 LPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRL 446
           +P ++ IDMRG  +A  + +SP +   +   +A  EQ LLF+NRRGYAP+T+C+ CG+++
Sbjct: 394 MPDMRAIDMRGVKLAGNRWISPVLKAEVEARVASGEQALLFINRRGYAPVTICRACGHQI 453

Query: 447 KCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYF 506
            C HC   +VEHR +K+L CHQCG S    + C  C +  ++ A G G+ER+AEE  E F
Sbjct: 454 GCDHCDARMVEHRFQKRLVCHQCGESKALPEVCPSCEAEDRLAAVGPGVERLAEEAAELF 513

Query: 507 PLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLG 566
           P ARI+ LSSD+ G    L+ ++  IA+G  DIIIGTQLVAKGHNFP ++LVGV+D DLG
Sbjct: 514 PEARIATLSSDMYGSARALKAEIVGIAEGAADIIIGTQLVAKGHNFPLLTLVGVIDADLG 573

Query: 567 LTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEI 626
           L  +DLR++ERTFQL+ QV GR+GR   K   L+Q YQP HPV++A+++GD ++F+ +E 
Sbjct: 574 LQGSDLRAAERTFQLMRQVAGRSGRSEKKGTALMQTYQPEHPVIRAILAGDENAFWTAEA 633

Query: 627 RARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE-HAP-RSSDIVVFGPAESPLFMVR 684
             R    +PP+GRLA +I+S T  QEV +    L     P R     VFGPA +P+  VR
Sbjct: 634 GERRMAGVPPYGRLAGIILSSTDPQEVFDLGGELARLDGPLRQIGAQVFGPAPAPVARVR 693

Query: 685 GRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           GR+R RLL+  ++N+ LQ    + +   +K    +R+  DIDPQ+F
Sbjct: 694 GRHRVRLLVKAEKNAPLQRAL-KAWIKQVKVPTHMRLSIDIDPQSF 738


>gi|126733323|ref|ZP_01749070.1| primosomal protein N' [Roseobacter sp. CCS2]
 gi|126716189|gb|EBA13053.1| primosomal protein N' [Roseobacter sp. CCS2]
          Length = 730

 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 305/724 (42%), Positives = 441/724 (60%), Gaps = 15/724 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P      LG+ V VPL  R VLG+VW   +  Y I   K+R +
Sbjct: 12  VGVLTTQPLDRLLDYKAPEG-GCHLGAFVEVPLGPRKVLGVVWGPGKGDYDI--AKIRSV 68

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  +M  F+   A+YT +PM  + R+   A  L + + M +  +   + P  
Sbjct: 69  MRVLDVAPMRAEMRSFLTRAAEYTLTPMPAMLRLGTRAPGLGDAQSMRKVYRLGDVKPDR 128

Query: 134 NTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQ---IFEVISPVVD 188
            T AR +VL  ++D  G  +  R++   + V + V+ GL   G + +     +   P +D
Sbjct: 129 MTGAREKVLGVLRDYGGLSFTLREVAEMAGVGTSVVKGLVKLGAVSEEEAPRDTPYPQLD 188

Query: 189 SPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
            P+ Y    +              L T G+  +L+ GVTGSGKTEVYLE VA  L +G+Q
Sbjct: 189 -PD-YGGKELSADQAAGAKALRAALRTDGYGTTLLKGVTGSGKTEVYLEAVAECLRMGRQ 246

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
            L+LLPEI+L+   + R + RFG+KPAEWHS ++ + R + WR V +G   +IVG RSAL
Sbjct: 247 ALVLLPEIALSGEFINRVEARFGMKPAEWHSGVTMTERRRCWRMVGQGDAQLIVGARSAL 306

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLP++ LGLIV+DEEHD SYKQE+G+LYNARDM+++R  I    VVL SATPS+ES  N 
Sbjct: 307 FLPYQNLGLIVVDEEHDTSYKQEDGVLYNARDMAVLRAAINGAQVVLASATPSLESWANV 366

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
            + +Y  + L+ RY  + +P +  IDMR + +  G+ +SP +   I+  L + EQ+L+FL
Sbjct: 367 EAGKYQRLELTARYGAAVMPKMNAIDMRVEDLPGGRWVSPTLRSAIQQRLEKGEQSLIFL 426

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAP+TLC+ CG+++ C HC   +VEHR  K+L CHQCG +      C  C +  ++
Sbjct: 427 NRRGYAPITLCRACGHQIGCDHCDARMVEHRFLKRLMCHQCGETKPIPTRCPSCDAEDRL 486

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
            A G G+ER+ EEV E FP ARI++LSSDL G    ++  +  IA+G  DIIIGTQLVAK
Sbjct: 487 SAVGPGVERMGEEVAELFPDARIAVLSSDLYGSARAMKAHIEEIAQGGTDIIIGTQLVAK 546

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR       L+Q YQP H 
Sbjct: 547 GHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRADTPGEALLQTYQPEHA 606

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP-R 666
           V++A+++GD +SF+++E   R++  +PP+GR+A +I+S    QEV +    + +   P R
Sbjct: 607 VIRAILAGDEESFWKAEAEERKAAGVPPYGRMAGIILSSPNVQEVFDLGSEMARMDGPLR 666

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
                VFGPA +P+  VRGR+R RLL+  ++++ LQ   ++ +    +    LR+  DID
Sbjct: 667 QIGAQVFGPAPAPIARVRGRHRVRLLVKAEKSAPLQQALAK-WAGQFRLPTNLRMAIDID 725

Query: 727 PQNF 730
           PQ+F
Sbjct: 726 PQSF 729


>gi|332559006|ref|ZP_08413328.1| primosome assembly protein PriA [Rhodobacter sphaeroides WS8N]
 gi|332276718|gb|EGJ22033.1| primosome assembly protein PriA [Rhodobacter sphaeroides WS8N]
          Length = 720

 Score =  582 bits (1499), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 312/711 (43%), Positives = 436/711 (61%), Gaps = 14/711 (1%)

Query: 30  YSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMC 89
           Y  P     +LG  V VPL  R V+G+VW   E  +  D+ KLR IE V D  P+  +M 
Sbjct: 15  YRAPEG-GCDLGDYVVVPLGPRRVMGVVWGPGEGGF--DAAKLRGIERVLDAAPMREEMR 71

Query: 90  EFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRINTVARLRVLDKIK- 146
            F+   ADYT +P+  + R+   A  L E   +    + +G  P   T  R RVLD +  
Sbjct: 72  LFLARAADYTLTPLPAMLRLASRAPGLGEPPAVRRVYRASGHEPARLTEPRQRVLDALAA 131

Query: 147 -DGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPI-LDKNQQ 204
             G      +L   + V+  V+ GL   G I +  E    +   P    + P+ L+ +Q 
Sbjct: 132 YGGAPVTLAELSAEAGVTGSVVKGLVKAGAILE-EEAPRDLPYPPLDPGAAPVRLEGDQV 190

Query: 205 DVVEQVVPLCT-KGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAIL 263
              E +V       ++ +L+ GVTGSGKTEVYLE VA  L  G+Q L+LLPEI+LTS  L
Sbjct: 191 AAAEALVAAVAADSYSTTLLKGVTGSGKTEVYLEAVAECLRRGRQALVLLPEIALTSEFL 250

Query: 264 ERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEE 323
            R + RFG +PAEWHS ++ + R ++WR V+ G    + G RSALFLPF+ LGL+V+DEE
Sbjct: 251 ARVEARFGARPAEWHSGVTATERRRLWRMVSEGQAQFVAGARSALFLPFRDLGLVVVDEE 310

Query: 324 HDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYR 383
           HD SYKQEEG LYNARDM+++R  I   P VL SATPS+ES VN    RY  + L  R+ 
Sbjct: 311 HDTSYKQEEGALYNARDMAVLRASICGCPAVLASATPSLESWVNAAQGRYARLDLGARFG 370

Query: 384 NSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCG 443
            + LP +  ID+R + +   + +S  +   +   +AR EQ+LLFLNRRGYAP+T+C+ CG
Sbjct: 371 AAELPEMHAIDLRPEKLPANRWISEALARSVEARMARGEQSLLFLNRRGYAPVTICRACG 430

Query: 444 NRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVC 503
           +++ C HC   +VEHR +K+L CHQCG +    ++C  CG  G+M   G G+ER+AEEV 
Sbjct: 431 HQIGCDHCDARMVEHRFQKRLVCHQCGATKPMPEACPSCGVEGRMAPVGPGVERLAEEVA 490

Query: 504 EYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDG 563
           E FP AR+++LSSDL G    L+ Q++AIA+G  +IIIGTQ+VAKGHNFP ++LVGV+D 
Sbjct: 491 ERFPQARVAVLSSDLFGSARALKEQIAAIAEGGAEIIIGTQIVAKGHNFPLLTLVGVIDA 550

Query: 564 DLGLTNADLRSSERTFQLLSQVTGRAGR-FGLKSLGLIQAYQPTHPVMQALVSGDADSFY 622
           DLGL  +DLR++ERTFQL+ QV GRAGR  G + + L+Q  QP HPV++A++ GD ++F+
Sbjct: 551 DLGLQGSDLRAAERTFQLVRQVAGRAGRSAGRRGVALVQTCQPEHPVIRAILGGDEEAFW 610

Query: 623 ESEIRARESVNLPPFGRLAAVIISGTKYQEV-ENYAYNLKEHAP-RSSDIVVFGPAESPL 680
           ++E   R    +PP+GRLA +I+S     +V E  A   +   P R     VFGPA +P+
Sbjct: 611 KAEAEERRVAGMPPYGRLAGIILSSPDVAQVFETGAELARADGPLRRIGAQVFGPAPAPI 670

Query: 681 FMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
             VRGR+R RLL+   + + LQ   ++ +   +K    LR+  DIDPQ+FL
Sbjct: 671 ARVRGRHRVRLLVKAGKGAPLQAALAE-WIAQVKLPANLRLAVDIDPQSFL 720


>gi|83943905|ref|ZP_00956362.1| primosomal protein N' [Sulfitobacter sp. EE-36]
 gi|83845152|gb|EAP83032.1| primosomal protein N' [Sulfitobacter sp. EE-36]
          Length = 716

 Score =  581 bits (1498), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 305/712 (42%), Positives = 436/712 (61%), Gaps = 19/712 (2%)

Query: 30  YSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMC 89
           Y  P      +G+ V VPL  R V+G+VW   +  Y++   K+R +  V D  P+ +++ 
Sbjct: 12  YKAPEG-GCHMGAFVEVPLGPRKVIGVVWGAGQGDYELS--KIRSVIRVLDAAPMRKELR 68

Query: 90  EFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRINTVARLRVLDKIKD 147
            F+   A YT +PM  + R+   A  L +   M +  +     P   T AR RVLD + +
Sbjct: 69  SFLTRAAAYTLTPMPAMLRLATRAPGLGDPPSMRKIYRRGEGEPDRMTDARRRVLDTLAE 128

Query: 148 -GKI-WEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF--SLP---ILD 200
            G + +  ++L   S V++ VI GL  QG +    E  SP  D P +    SLP   + D
Sbjct: 129 YGDLSFTLKELAEMSGVTASVIKGLVTQGAV---LEQDSPR-DLPFMRMDPSLPSKELTD 184

Query: 201 KNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTS 260
                       + +  +  +L+ GVTGSGKTEVYLE VAA L  G+Q L+LLPEI+LT 
Sbjct: 185 DQASASALLAAGVASGTYGTTLLRGVTGSGKTEVYLEAVAAALKSGRQALVLLPEIALTE 244

Query: 261 AILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVI 320
             L R Q RFG KPAEWHS  + + R +IW+ V +G   V++G RSALFLPF+ LGLIV+
Sbjct: 245 QFLHRVQARFGAKPAEWHSGATMTERRRIWKMVGQGQAQVVIGARSALFLPFQNLGLIVV 304

Query: 321 DEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLST 380
           DEEHD SYKQEEG+LYNARDM+++R  I    VVL SATPS+ES  N  + +Y  V L++
Sbjct: 305 DEEHDTSYKQEEGVLYNARDMAVLRASICGAQVVLASATPSLESWANAEAGKYTRVELTS 364

Query: 381 RYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQ 440
           R+  + +P +  IDMR + +   K +SP +   +   L R EQ +LF+NRRGYAP+TLC+
Sbjct: 365 RFGPAVMPTMGAIDMRSEGLPSDKWVSPTLKVEVDKRLERGEQAMLFINRRGYAPVTLCR 424

Query: 441 VCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAE 500
            CG+++ C HC   +VEHR  K+L CHQCG S    + C  C   GK+ A G G+ER+ E
Sbjct: 425 ACGHQIGCDHCDARMVEHRYLKRLVCHQCGESKPMPEVCPSCEVEGKLAAVGPGVERLGE 484

Query: 501 EVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGV 560
           E    +P AR++ LSSD+ G    L+ +++ IA G  DIIIGTQLVAKGHNFP ++LVGV
Sbjct: 485 EAAALWPEARVATLSSDMYGSARALKAEIAGIADGAADIIIGTQLVAKGHNFPNLTLVGV 544

Query: 561 VDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADS 620
           +D DLGL  +DLR++ERT+QL+ QV GRAGR       L+Q +QP HPV++A+++GD + 
Sbjct: 545 IDADLGLMGSDLRAAERTYQLMRQVAGRAGRAEAPGTALLQTFQPDHPVIRAILAGDEEG 604

Query: 621 FYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP-RSSDIVVFGPAES 678
           F+++E   R    +PP+GR+A +I+SG     + +    L ++ AP R+    V+GPA +
Sbjct: 605 FWKAEAGERRHAGVPPYGRMAGIILSGPDVAALFDAGNQLARQDAPLRAVGAQVYGPAPA 664

Query: 679 PLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           P+  VRGR+R RLLI  ++ + LQ   ++ +   ++  N +R+  DIDPQ+F
Sbjct: 665 PIARVRGRHRVRLLIKAEKAAPLQEALAK-WVAQLRLKNDVRIAVDIDPQSF 715


>gi|99082218|ref|YP_614372.1| primosome assembly protein PriA [Ruegeria sp. TM1040]
 gi|99038498|gb|ABF65110.1| primosomal protein N' [Ruegeria sp. TM1040]
          Length = 735

 Score =  581 bits (1498), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 308/739 (41%), Positives = 448/739 (60%), Gaps = 12/739 (1%)

Query: 1   MASSGSSVEGVV-CSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWY 59
           M+ +G S E      RV +L  Q +     Y  P      LG+ V VPL  R V+G+VW 
Sbjct: 1   MSKAGDSPEFFAQGERVGVLTAQPLDRLLDYRAPEG-GCFLGAFVEVPLGPRKVIGVVWG 59

Query: 60  NSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSET 117
                +  D+ KLR +  V D  P+  +M  F++    YT +PM ++ R+   A  L++ 
Sbjct: 60  PGAGDF--DAAKLRSVIRVLDLAPMRAEMRGFLERAGQYTLTPMSMMLRLATRAPGLADP 117

Query: 118 EKMEEKIQFTGIFPRINTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGV 175
             M + ++     P   T AR +VLD +++  G  +   +L   + V++ VI GL  QG 
Sbjct: 118 PSMRKILRRGDREPDRITDARAKVLDVMQEYEGGAFTPSELSELAGVTTSVIKGLIKQGA 177

Query: 176 IKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEV 234
           I++            +       L ++Q      +      G +  +L+ GVTGSGKTEV
Sbjct: 178 IREEEAPRDLPFPPLDPDLPGKTLSEDQAAAAAALEAGVESGRYGTTLLKGVTGSGKTEV 237

Query: 235 YLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVA 294
           YLE VAA L  G+Q L+LLPEI+LT+  L+R + RFG  PAEWHS ++ + R ++WR V 
Sbjct: 238 YLEAVAACLRKGRQALVLLPEIALTAEFLKRVEARFGAVPAEWHSGVTMTERRRVWRMVG 297

Query: 295 RGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVV 354
           +GA  +++G RS+L+LPF+ LGLI++DEEHD SYKQEEG+LYNARD+++ R  +    VV
Sbjct: 298 QGAAQLVIGARSSLYLPFRDLGLIIVDEEHDTSYKQEEGVLYNARDLAVWRASLCQAQVV 357

Query: 355 LVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGI 414
           L SATPS+E+  N  + +Y  + L++R+ +S LP ++ IDMR + +     +SP +   +
Sbjct: 358 LASATPSLETWANAEAGKYQRLDLTSRFGDSVLPEMRAIDMRNEELLPSTWISPTLKQAM 417

Query: 415 RHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAI 474
           +  L R EQ+LLFLNRRG+AP+T+C+ CG ++ C +C   +VEHR  K+L CHQCG +  
Sbjct: 418 KLRLERGEQSLLFLNRRGFAPVTICRACGAQVACDNCDARMVEHRFMKRLMCHQCGETKP 477

Query: 475 YSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAK 534
               C  C   GKM   G GIER+ EE    FP ARI++LSSDL G    L+ ++  IA 
Sbjct: 478 VPTECPSCKVEGKMAPVGPGIERLGEEAAALFPEARIAVLSSDLFGSARALKQRIEDIAA 537

Query: 535 GEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGL 594
           GE DII+GTQLVAKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR   
Sbjct: 538 GEADIILGTQLVAKGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAER 597

Query: 595 KSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVE 654
           +   L+Q++QP HPV++A++SGD +SF+ +E   R++  +PP+GR+A VI+SGT   +V 
Sbjct: 598 RGEALMQSFQPEHPVIRAILSGDEESFWRAEAEQRQAAGVPPYGRMAGVILSGTDLAQVF 657

Query: 655 NYAYNL-KEHAP-RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNT 712
           +    L +   P R     +FGPA +P+  VRGR+R RLL+   + + LQ   ++ +   
Sbjct: 658 DLGGALARNDGPLRQVGAQLFGPAPAPIARVRGRHRVRLLVKADKGAPLQDAITR-WIAP 716

Query: 713 IKRSNALRVQFDIDPQNFL 731
            K    LR+  DIDPQ+FL
Sbjct: 717 FKLKGDLRLNVDIDPQSFL 735


>gi|221639997|ref|YP_002526259.1| primosome assembly protein PriA [Rhodobacter sphaeroides KD131]
 gi|221160778|gb|ACM01758.1| Primosomal protein N' [Rhodobacter sphaeroides KD131]
          Length = 720

 Score =  581 bits (1498), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 310/700 (44%), Positives = 432/700 (61%), Gaps = 13/700 (1%)

Query: 41  GSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTF 100
           G  V VPL  R V+G+VW   E  +  D+ KLR IE V D  P+  +M  F+   ADYT 
Sbjct: 25  GDYVVVPLGPRRVMGVVWGPGEGGF--DAAKLRGIERVLDAAPMREEMRLFLARAADYTL 82

Query: 101 SPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRINTVARLRVLDKIK--DGKIWEKRDL 156
           +P+  + R+   A  L E   +    + +G  P   T  R RVLD +    G      +L
Sbjct: 83  TPLPAMLRLASRAPGLGEPPAVRRVYRASGHEPARLTEPRQRVLDALAAYGGAPVTLAEL 142

Query: 157 IRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPI-LDKNQQDVVEQVVPLCT 215
              + V+  V+ GL   G I +  E    +   P    + P+ L+ +Q    E +V    
Sbjct: 143 SAEAGVTGSVVKGLVKAGAILE-EEAPRDLPYPPLDPGAAPVRLEGDQVAAAEALVAAVA 201

Query: 216 -KGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKP 274
              ++ +L+ GVTGSGKTEVYLE VA  L  G+Q L+LLPEI+LTS  L R + RFG +P
Sbjct: 202 ADSYSTTLLKGVTGSGKTEVYLEAVAECLRRGRQALVLLPEIALTSEFLARVEARFGARP 261

Query: 275 AEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGI 334
           AEWHS ++ + R ++WR V+ G    + G RSALFLPF+ LGL+V+DEEHD SYKQEEG 
Sbjct: 262 AEWHSGVTATERRRLWRMVSEGQAQFVAGARSALFLPFRDLGLVVVDEEHDTSYKQEEGA 321

Query: 335 LYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVID 394
           LYNARDM+++R  I   P VL SATPS+ES VN    RY  + L  R+  + LP +  ID
Sbjct: 322 LYNARDMAVLRASICGCPAVLASATPSLESWVNAAQGRYARLDLGARFGAAELPEMHAID 381

Query: 395 MRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCW 454
           +R + +   + +S  +   +   +AR EQ+LLFLNRRGYAP+T+C+ CG+++ C HC   
Sbjct: 382 LRPEKLPANRWISEALARSVEARIARGEQSLLFLNRRGYAPVTICRACGHQIGCDHCDAR 441

Query: 455 LVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISIL 514
           +VEHR +K+L CHQCG +    ++C  CG  G+M   G G+ER+AEEV E FP AR+++L
Sbjct: 442 MVEHRFQKRLVCHQCGATKPMPEACPSCGVEGRMAPVGPGVERLAEEVAERFPQARVAVL 501

Query: 515 SSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRS 574
           SSDL G    L+ Q++AIA+G  DIIIGTQ+VAKGHNFP ++LVGV+D DLGL  +DLR+
Sbjct: 502 SSDLFGSARALKEQIAAIAEGGADIIIGTQIVAKGHNFPLLTLVGVIDADLGLQGSDLRA 561

Query: 575 SERTFQLLSQVTGRAGR-FGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVN 633
           +ERTFQL+ QV GRAGR  G + + L+Q  QP HPV++A++ GD ++F+++E   R    
Sbjct: 562 AERTFQLVRQVAGRAGRSAGRRGVALVQTCQPEHPVIRAILGGDEEAFWKAEAEERRVAG 621

Query: 634 LPPFGRLAAVIISGTKYQEV-ENYAYNLKEHAP-RSSDIVVFGPAESPLFMVRGRYRFRL 691
           +PP+GRLA +I+S     +V E  A   +   P R     VFGPA +P+  VRGR+R RL
Sbjct: 622 MPPYGRLAGIILSSPDVAQVFETGAELARADGPLRRIGAQVFGPAPAPIARVRGRHRVRL 681

Query: 692 LIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           L+   + + LQ   ++ +   +K    LR+  DIDPQ+FL
Sbjct: 682 LVKAGKGAPLQAALAE-WIAQVKLPTNLRLAVDIDPQSFL 720


>gi|77464130|ref|YP_353634.1| primosome assembly protein PriA [Rhodobacter sphaeroides 2.4.1]
 gi|77388548|gb|ABA79733.1| Probable pimosomal protein N' [Rhodobacter sphaeroides 2.4.1]
          Length = 730

 Score =  581 bits (1497), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 317/737 (43%), Positives = 445/737 (60%), Gaps = 17/737 (2%)

Query: 4   SGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE 63
           +G   EG   +RV +L  + +     Y  P     +LG  V VPL  R V+G+VW   E 
Sbjct: 2   TGRFAEG---ARVGVLTTEPLGRVLDYRAPEG-GCDLGDYVVVPLGPRRVMGVVWGPGEG 57

Query: 64  KYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKME 121
            +  D+ KLR IE V D  P+  +M  F+   ADYT +P+  + R+   A  L E   + 
Sbjct: 58  GF--DAAKLRGIERVLDAAPMREEMRLFLARAADYTLTPLPAMLRLASRAPGLGEPPAVR 115

Query: 122 EKIQFTGIFPRINTVARLRVLDKIK--DGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQI 179
              + +G  P   T  R RVLD +    G      +L   + V+  V+ GL   G I + 
Sbjct: 116 RVYRASGHEPARLTEPRQRVLDALAAYGGAPVTLAELSAEAGVTGSVVKGLVKAGAILE- 174

Query: 180 FEVISPVVDSPNLYFSLPI-LDKNQQDVVEQVVPLCT-KGFAVSLISGVTGSGKTEVYLE 237
            E    +   P    + P+ L+ +Q    E +V       ++ +L+ GVTGSGKTEVYLE
Sbjct: 175 EEAPRDLPYPPLDPGAAPVRLEGDQVAAAEALVAAVAADSYSTTLLKGVTGSGKTEVYLE 234

Query: 238 IVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGA 297
            VA  L  G+Q L+LLPEI+LTS  L R + RFG +PAEWHS ++ + R ++WR V+ G 
Sbjct: 235 AVAECLRRGRQALVLLPEIALTSEFLARVEARFGARPAEWHSGVTATERRRLWRMVSEGQ 294

Query: 298 ISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVS 357
              + G RSALFLPF+ LGL+V+DEEHD SYKQEEG LYNARDM+++R  I   P VL S
Sbjct: 295 AQFVAGARSALFLPFRDLGLVVVDEEHDTSYKQEEGALYNARDMAVLRASICGCPAVLAS 354

Query: 358 ATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHT 417
           ATPS+ES VN    RY  + L  R+  + LP +  ID+R + +   + +S  +   +   
Sbjct: 355 ATPSLESWVNAAQGRYARLDLGARFGAAELPEMHAIDLRPEKLPANRWISEALARSVEAR 414

Query: 418 LARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQ 477
           +AR EQ+LLFLNRRGYAP+T+C+ CG+++ C HC   +VEHR +K+L CHQCG +    +
Sbjct: 415 IARGEQSLLFLNRRGYAPVTICRACGHQIGCDHCDARMVEHRFQKRLVCHQCGATKPMPE 474

Query: 478 SCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEI 537
           +C  CG  G+M   G G+ER+AEEV E FP AR+++LSSDL G    ++ Q++AIA+G  
Sbjct: 475 ACPSCGVEGRMAPVGPGVERLAEEVAERFPQARVAVLSSDLFGSARAVKEQIAAIAEGGA 534

Query: 538 DIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFG-LKS 596
           DIIIGTQ+VAKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR    + 
Sbjct: 535 DIIIGTQIVAKGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLVRQVAGRAGRSASRRG 594

Query: 597 LGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEV-EN 655
           + L+Q  QP HPV++A++ GD ++F+ +E   R    +PP+GRLA +I+S     +V E 
Sbjct: 595 VALVQTCQPEHPVIRAILGGDEEAFWRAEAEERRVAGMPPYGRLAGIILSSPDVAQVFET 654

Query: 656 YAYNLKEHAP-RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIK 714
            A   +   P R     VFGPA +P+  VRGR+R RLL+   + + LQ   ++ +   +K
Sbjct: 655 GAELARADGPLRRIGAQVFGPAPAPIARVRGRHRVRLLVKAGKGAPLQAALAE-WIAQVK 713

Query: 715 RSNALRVQFDIDPQNFL 731
               LR+  DIDPQ+FL
Sbjct: 714 LPANLRLAVDIDPQSFL 730


>gi|146277272|ref|YP_001167431.1| primosome assembly protein PriA [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555513|gb|ABP70126.1| primosomal protein N' [Rhodobacter sphaeroides ATCC 17025]
          Length = 730

 Score =  580 bits (1496), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 310/708 (43%), Positives = 430/708 (60%), Gaps = 29/708 (4%)

Query: 41  GSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTF 100
           G  V VPL  R V+G+VW   E  +  D+ KLR +E V D  P+  +M  F+   ADYT 
Sbjct: 35  GDYVVVPLGPRHVMGVVWGPGEGGF--DAAKLRGVERVLDAAPMREEMRLFLARAADYTL 92

Query: 101 SPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRINTVARLRVLDKIK--DGKIWEKRDL 156
           +P+  + R+   A  L +   +    + +G  P   T  R RVLD ++   G      +L
Sbjct: 93  TPLPAMLRLATRAPGLGDPPTVRRVYRASGHEPARLTGPRQRVLDALEAFGGAPVTLAEL 152

Query: 157 IRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDV---------- 206
              + V+  V+ GL   G I    E  +P  D P      P LD     V          
Sbjct: 153 SAEAGVTGSVVKGLVKAGAI---LEEEAPR-DLP-----YPPLDPGAAAVRLEGDQVAAA 203

Query: 207 VEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERF 266
              V  +    ++ +L+ GVTGSGKTEVYLE VA  L  G+Q L+LLPEI+LTS  L R 
Sbjct: 204 EALVAAVAADSYSTTLLKGVTGSGKTEVYLEAVAECLRRGRQALVLLPEIALTSEFLARV 263

Query: 267 QKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDI 326
           + RFG +PAEWHS ++ + R ++WR V+ G    + G RSALFLPF+ LGLIV+DEEHD 
Sbjct: 264 EARFGARPAEWHSGVTATERRRLWRMVSEGGAQFVAGARSALFLPFRDLGLIVVDEEHDT 323

Query: 327 SYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSA 386
           SYKQEEG LYNARDM+++R  I   P VL SATPS+ES VN    RY  + L  R+  + 
Sbjct: 324 SYKQEEGALYNARDMAVLRASICGCPAVLASATPSLESWVNAAQGRYGRLDLGARFGAAE 383

Query: 387 LPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRL 446
           LP +  +DMR + +   + +S  +   +   +AR EQ+LLFLNRRGYAP+T+C+ CG+++
Sbjct: 384 LPEMHALDMRPEKLPANRWISEPLARSVEARIARGEQSLLFLNRRGYAPVTICRACGHQI 443

Query: 447 KCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYF 506
            C HC   +VEHR +K+L CHQCG +    ++C  CG  G+M   G G+ER+AEEV   F
Sbjct: 444 GCDHCDARMVEHRFQKRLVCHQCGATKPMPEACPSCGVEGRMAPVGPGVERLAEEVAGRF 503

Query: 507 PLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLG 566
           P AR+++LSSDL G    L+ Q++AIA+G  +IIIGTQ+VAKGHNFP ++LVGV+D DLG
Sbjct: 504 PQARVAVLSSDLFGSARALKEQIAAIAEGGAEIIIGTQIVAKGHNFPLLTLVGVIDADLG 563

Query: 567 LTNADLRSSERTFQLLSQVTGRAGR-FGLKSLGLIQAYQPTHPVMQALVSGDADSFYESE 625
           L  +DLR++ERTFQL+ QV GRAGR  G + + L+Q YQP HPV++A++ GD ++F+ +E
Sbjct: 564 LQGSDLRAAERTFQLVRQVAGRAGRAAGKRGVALVQTYQPEHPVIRAILGGDEEAFWRAE 623

Query: 626 IRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP-RSSDIVVFGPAESPLFMV 683
              R    +PP+GRLA +I+S     +V      L +  AP R     VFGPA +P+  V
Sbjct: 624 AEERRVAGMPPYGRLAGIILSSPDVGQVFEIGAELARADAPLRRIGAQVFGPAPAPIARV 683

Query: 684 RGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           RGR+R RLL+  ++ + LQ   ++ +   +K    LR+  DIDPQ+FL
Sbjct: 684 RGRHRVRLLVKAQKGAPLQAALAE-WIAQVKLPANLRLAVDIDPQSFL 730


>gi|86139166|ref|ZP_01057736.1| primosomal protein N' [Roseobacter sp. MED193]
 gi|85824010|gb|EAQ44215.1| primosomal protein N' [Roseobacter sp. MED193]
          Length = 736

 Score =  580 bits (1494), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 304/731 (41%), Positives = 435/731 (59%), Gaps = 23/731 (3%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR 73
            RV +L  Q +     Y  P       G+ V VPL  R VLG++W      +  DS KLR
Sbjct: 16  DRVAVLTAQPLDRLLDYRAPEGGCFR-GAYVEVPLGPRKVLGVIWGAGSGNF--DSAKLR 72

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFP 131
            +  V D  P+  +M +F+    DYT +PM L+ R+   A  LS+   M + ++     P
Sbjct: 73  SVIRVLDVAPMRDEMRQFLSKAGDYTLTPMSLMLRLATRAPGLSDPPSMRKVLRLGEREP 132

Query: 132 RINTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIK-------QIFEV 182
              T AR +VL  + +     +  ++L   + V+  VI GL  QG ++       Q + V
Sbjct: 133 DRMTPARSKVLAVMDEFSSMAFTPKELADMAGVTPSVIKGLVGQGALREEETPRDQPYPV 192

Query: 183 ISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAV 242
           + P+     L              VE      +  +  +L+ GVTGSGKTEVYLE VA+ 
Sbjct: 193 LDPLRPGKTLTADQATAAAALAAGVE------SGSYGTTLLKGVTGSGKTEVYLEAVASC 246

Query: 243 LHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIV 302
           L  G+Q L+LLPEI+LT+  L+R ++RFG  PAEWHS  + + R ++WR + +G   +++
Sbjct: 247 LRKGRQALVLLPEIALTAEFLKRVEQRFGATPAEWHSGATMTERRRVWRMLGQGNAQLVI 306

Query: 303 GVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSI 362
           G RSALFLPF+ LGLI++DEEHD +YKQEEG+LYNARDM+++R  + S  VVL SATPS+
Sbjct: 307 GARSALFLPFRDLGLIIVDEEHDSAYKQEEGVLYNARDMAVLRAAMCSAQVVLASATPSL 366

Query: 363 ESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNE 422
           E+  N  + +Y  V+L+ R+  + LP ++ +DMRG+ +A    +SP +   +   + R E
Sbjct: 367 ETWSNAEAGKYKRVNLTARFGTAVLPVMKAVDMRGEDLAPATWISPTLKQAMALRMERGE 426

Query: 423 QTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVC 482
           Q+LLFLNRRG+AP+T+C+ CG ++ C +C   +VEHR  K+L CHQCG +    + C  C
Sbjct: 427 QSLLFLNRRGFAPVTICRACGAQVACDNCDARMVEHRFMKRLMCHQCGETKPVPEVCPSC 486

Query: 483 GSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIG 542
              GKM   G GIER+ EE    FP ARI++LSSDL G    L+ ++  IA GE DII+G
Sbjct: 487 QVEGKMAPVGPGIERLGEEAAALFPEARIAVLSSDLFGSARALKARIEEIAAGEADIILG 546

Query: 543 TQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQA 602
           TQLVAKGHNFP ++LVGV+D DLGL  +DLR+ ERTFQL+ QV GRAGR       L+Q 
Sbjct: 547 TQLVAKGHNFPLLTLVGVIDADLGLQGSDLRAGERTFQLMRQVAGRAGRAERPGEALLQT 606

Query: 603 YQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-K 661
           +QP HPV++A+++GD + F+ +E   R    +PPFGR+A +I+SG+   +V +    L +
Sbjct: 607 FQPEHPVIRAILTGDEEEFWRAEAAQRREAGVPPFGRMAGIILSGSDLAQVFDLGNALAR 666

Query: 662 EHAP-RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
              P R     +FGPA +P+  VRGR+R RLL+   +   LQ   S+ +    +    LR
Sbjct: 667 NDGPLRQVGAQLFGPAPAPIARVRGRHRVRLLVKAAKGVALQDALSR-WVQPFRMKGDLR 725

Query: 721 VQFDIDPQNFL 731
           +  DIDPQNF 
Sbjct: 726 LSIDIDPQNFF 736


>gi|288959338|ref|YP_003449679.1| primosomal protein N' [Azospirillum sp. B510]
 gi|288911646|dbj|BAI73135.1| primosomal protein N' [Azospirillum sp. B510]
          Length = 721

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 313/718 (43%), Positives = 436/718 (60%), Gaps = 21/718 (2%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQ 87
           Y Y VP  M +  G  V VPL  R ++G+V         +D+ +L+ +   FD P ++  
Sbjct: 11  YDYRVPDGMDLVPGDFVEVPLGPRRMVGVV--WGPGGGMLDAGRLKAVVRRFDVPAMTEV 68

Query: 88  MCEFVKWVADYTFSPMGLVARMVVS---ALSETEKM---------EEKIQFTGIFPRINT 135
              FV WVA YT +P G V RM VS   AL   + M         E    F    PR   
Sbjct: 69  GRRFVDWVAAYTMTPPGFVLRMAVSVPAALEPPKPMLAYLRRHDAEPPPGFKMTDPRRRV 128

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPV-VDSPNLYF 194
           +A L   D +  G      +L   +     V+ GL   G+++ +  ++ P  +  P+   
Sbjct: 129 LALLE--DTLSGGPPRTPAELADEAGCGVTVVRGLAEAGLLEPV--MLQPTRLGRPDCRR 184

Query: 195 SLPILDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
             P L  +Q+     +   +   G++  L+ GVTGSGKTEVY E ++A L  GKQ L+LL
Sbjct: 185 PGPALSPDQRAAAGDLRGRVAAGGYSTVLLDGVTGSGKTEVYYEAISAALEQGKQALVLL 244

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI+L++  L+RF +RFG  PAEWHS L+ + R   WR V++G + V+VG RSALFLP+ 
Sbjct: 245 PEIALSAQWLDRFARRFGAPPAEWHSELTGAQRRDTWRAVSKGEVPVVVGARSALFLPYP 304

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LG+I++DEEHD +YKQEEG +Y+ARDM++ R  +   P+VLVSATPS+E++VN  S+RY
Sbjct: 305 DLGVIIVDEEHDSAYKQEEGAIYHARDMAVARAHLGGLPIVLVSATPSLETKVNADSQRY 364

Query: 374 HSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGY 433
             + L  R+  + LP ++++D+R         L+P +   +  TLA  EQ +LFLNRRGY
Sbjct: 365 ARIELPARHGGAVLPDVELVDLRRDRPPARHWLAPSLRKALTDTLAGGEQAMLFLNRRGY 424

Query: 434 APLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGF 493
           APLTLC+ CG+R++C +C+ WLVEHR  +KL CH CG      Q+C  CG  G M ACG 
Sbjct: 425 APLTLCRACGHRMQCPNCTAWLVEHRLARKLQCHHCGLQQPLPQACPECGEEGTMAACGP 484

Query: 494 GIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFP 553
           G+ERIAEEV E FP AR +I++SD   G   +Q  + +I + E+DIIIGTQ++AKGH+FP
Sbjct: 485 GVERIAEEVAELFPDARAAIMASDTLHGPRAIQEMVESIGRHELDIIIGTQVMAKGHHFP 544

Query: 554 RMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQAL 613
            ++LVGVVD DLGL   DLR++ERT+QLL QV GRAGR       ++Q + P HPVMQAL
Sbjct: 545 MLTLVGVVDADLGLNGGDLRAAERTYQLLHQVAGRAGRGERPGRVMLQTFMPEHPVMQAL 604

Query: 614 VSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVF 673
            +GD D FY+ E   R    +PPFGRLAA+I+SG     VE  A  L   APR   + V 
Sbjct: 605 AAGDRDGFYQLEAEMRLEAGMPPFGRLAALIVSGEDPTLVERVAMALGRAAPRGETVHVL 664

Query: 674 GPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           GPA +PL ++RGR+R RLL+   R++ +Q   ++  D  ++   A+RVQ D+DP +FL
Sbjct: 665 GPAPAPLALLRGRHRRRLLLKAPRSTQVQPLIAEWLDR-VEIPPAVRVQIDVDPYSFL 721


>gi|326387000|ref|ZP_08208610.1| primosome assembly protein PriA [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326208181|gb|EGD58988.1| primosome assembly protein PriA [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 721

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 299/722 (41%), Positives = 436/722 (60%), Gaps = 6/722 (0%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSE-EKYKIDSLKL 72
           +R   L+L A  GP  Y VP  M VE GS+V  PL  R V+ +VW        ++ + KL
Sbjct: 2   NRCRCLVLNAALGPLDYRVPDGMHVEPGSVVVAPLGPRQVMAVVWDEGRLPGTEVPAGKL 61

Query: 73  RPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEK--MEEKIQFTGIF 130
           RP+  V   PPL+  +   ++W ADY  +P+  V RM +S+ +  +   M  + + TG  
Sbjct: 62  RPLLSVLPVPPLAAPLRRLIEWTADYYLAPLASVVRMALSSSAALQGGGMVTEYRLTGAE 121

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
           P   T  R + L+++ +G+    R+L   + VS  V+ G+   G+++ +          P
Sbjct: 122 PGRLTAQRTQALERL-EGQQATIRELAEIAGVSDSVLRGMVGAGLLEAVRVDSDRPYPEP 180

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
           + + ++P L   Q ++  ++V +  +  F   L+ GVTGSGKTE Y E +AA +  G+QV
Sbjct: 181 DPHHAVPDLSPAQAEIAARLVAVVEEHRFQPFLLDGVTGSGKTETYSEAIAAAIEAGRQV 240

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           LILLPEI+LT   L RF+ RFG  P  WHSSL +S R + WRQVA G   V+VG RSALF
Sbjct: 241 LILLPEIALTQNFLTRFEARFGCPPVAWHSSLKSSERRRAWRQVAFGGAKVVVGARSALF 300

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPF  LGLI++DE H+I++KQE+G+ YNARD++++R + E  PVVL SATP++ES     
Sbjct: 301 LPFAALGLIIVDEAHEIAFKQEDGVRYNARDVAVMRARFEQIPVVLASATPALESLQMAE 360

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
           + RY  + L  R+  + +P ++++D+R +   +G  L+P ++  +     R EQ+LLFLN
Sbjct: 361 AGRYERLILPDRFGGAQMPDIKIVDLRTEQPERGHWLAPTLVRALVERAERGEQSLLFLN 420

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPLTLC+ CG R +C +CS WLVEHR  ++L CH CGH     + C  CG    ++
Sbjct: 421 RRGYAPLTLCRTCGYRFQCPNCSAWLVEHRLSRRLACHHCGHEVPTPERCPECGEPDCLV 480

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
           ACG G+ERIA+E+ E  P AR+++++SD      +    +     G ID+I+GTQLV KG
Sbjct: 481 ACGPGVERIADEMAEILPDARVAVVTSDTLTSPAKAAEFVDLATHGGIDVIVGTQLVTKG 540

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
            +FP ++LVGVVD D+GL   DLR++ERT+Q ++QV GRAGR       L+Q   P  PV
Sbjct: 541 FHFPELTLVGVVDADMGLEGGDLRAAERTYQQIAQVAGRAGRGEKPGEVLLQTRHPEAPV 600

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           + AL  GD D+FY +E  AR S   PPFGR AA+I+S     E    A  +    P   D
Sbjct: 601 IAALACGDRDAFYAAETEARRSAGAPPFGRWAAIIVSSEDEAEAREAARAIGGTRPALDD 660

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
           +++ GP  +PL ++RGRYR+RLLI+ +R+S LQ    +  +  +K    +RV  DIDP +
Sbjct: 661 VMILGPTPAPLALLRGRYRYRLLINARRSSGLQTILREWLE-PLKFPPGVRVAVDIDPYS 719

Query: 730 FL 731
           F+
Sbjct: 720 FV 721


>gi|110679362|ref|YP_682369.1| primosome assembly protein PriA [Roseobacter denitrificans OCh 114]
 gi|109455478|gb|ABG31683.1| primosomal protein N' [Roseobacter denitrificans OCh 114]
          Length = 720

 Score =  578 bits (1490), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 310/725 (42%), Positives = 453/725 (62%), Gaps = 17/725 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           + +L  Q +     Y  P      LG+ V VPL  R VLG+VW   +  Y  +  K+R  
Sbjct: 2   IAVLTTQPLGRTLDYRAPEG-GCHLGAFVEVPLGPRKVLGVVWGPGQGDY--ERSKIRQA 58

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  +MC F+K  A+YT +P+  + R+   A  L +   M +  +     P  
Sbjct: 59  YRVLDAAPMREEMCLFLKRAAEYTLTPLPAMLRLATRAPGLGDPPSMRKIYRRGTGEPDK 118

Query: 134 NTVARLRVLDKIKD-GKI-WEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPV-VDSP 190
            T AR +VL  + + G + +  ++L   + V + V+ GL AQG +    E  SP  +  P
Sbjct: 119 MTAARRKVLAALAEYGDLAFTLKELAEMADVGTSVVKGLVAQGAV---VEEDSPRDLPFP 175

Query: 191 NLYFSLP--ILDKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
            L  S P   L  +Q     Q+   + ++ +  +L+ GVTGSGKTEVYLE VAA L  G+
Sbjct: 176 RLDPSRPGKALTADQAAGAAQLTQAVRSERYGTTLLRGVTGSGKTEVYLEAVAAALTAGR 235

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           Q L+LLPEI+LT+  L R Q+RFG +PAEWHS  + + R +I+R V +G   +++G RSA
Sbjct: 236 QALVLLPEIALTAEFLTRVQERFGARPAEWHSGATMTERRRIFRMVGQGEAQLVIGARSA 295

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LFLP++ LGLIV+DEEHD SYKQEEG+LYNARDM+++R  I    VVL SATPS+ES  N
Sbjct: 296 LFLPYQNLGLIVVDEEHDTSYKQEEGVLYNARDMAVLRASICGAQVVLASATPSLESWAN 355

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + +Y  + L++R+  + +P ++ IDMR +++   + +S  +   +   +AR EQ++LF
Sbjct: 356 AQAGKYAKLELTSRFGAAVMPQMRAIDMRVESLPSNRWVSDVLHKEVEARMARGEQSMLF 415

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           +NRRGYAP+TLC+ CG+++ C HC   +VEHR  K+L CHQCG S      C  C +  +
Sbjct: 416 INRRGYAPITLCRACGHQIGCDHCDARMVEHRFLKRLVCHQCGESKPMPTVCPSCNAEDR 475

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           + A G G+ER+AEE  E FP ARI+ LSSD+ G    L+ ++  IA G  DIIIGTQLVA
Sbjct: 476 LAAVGPGVERLAEEATELFPDARIAALSSDMYGSARALKAEIEDIAAGGADIIIGTQLVA 535

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR     + L+Q+YQP H
Sbjct: 536 KGHNFPNLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAEKAGVALLQSYQPEH 595

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP- 665
           PV++A+++GD D F+ +E R R++  +PP+GR+A +I+SG+    V +    L ++ AP 
Sbjct: 596 PVIRAILAGDEDEFWAAEARERKAAGVPPYGRMAGIILSGSDVAMVFDAGNQLARQDAPL 655

Query: 666 RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDI 725
           R+    VFGPA +P+  VRGR+R R+L+  ++++ LQ   ++ +   ++    LRV  DI
Sbjct: 656 RAIGAQVFGPAPAPIARVRGRHRVRMLVKAEKSAPLQEALAR-WVAQLRIKGDLRVAVDI 714

Query: 726 DPQNF 730
           DPQ+F
Sbjct: 715 DPQSF 719


>gi|114769431|ref|ZP_01447057.1| primosomal protein N' [alpha proteobacterium HTCC2255]
 gi|114550348|gb|EAU53229.1| primosomal protein N' [alpha proteobacterium HTCC2255]
          Length = 737

 Score =  578 bits (1489), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 306/729 (41%), Positives = 448/729 (61%), Gaps = 25/729 (3%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P    V+LGS V VPL  R V+G+VW   +  Y  D  K+R I
Sbjct: 19  VSVLTTQPIDRFLDYKAPKE-GVKLGSYVEVPLGPRKVIGVVWCAGKGDY--DQNKIRTI 75

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRIN- 134
               D P +  +M EF+     YT +P+  + ++   A   T+    KI +      ++ 
Sbjct: 76  SNRLDVPEMRPEMMEFLSRAGRYTLTPLNGMLKLATRAPGLTDPPSMKIVYAKGDRDVDR 135

Query: 135 -TVARLRVLDKIKDGKIWE--KRDLIRASQVSSHVIDGLKAQGVIKQI-------FEVIS 184
            T AR RVL  +KD    +   ++L  A+ V+  VI GL +QG + ++       +  + 
Sbjct: 136 MTPARERVLKILKDTADMQFTGKELKEAANVTISVIKGLVSQGAVTELESPRDIPYAELD 195

Query: 185 PVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
           P + S  L  +     K+  D + + + + T  +  +L+ G+TGSGKTEVYLE VA  L 
Sbjct: 196 PCLPSKKLTSA----QKDAGDRLRKNIRMNT--YNTTLLRGITGSGKTEVYLEAVAECLL 249

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
           LGKQ LIL+PEI+LT   L+R +KRFG KPA+WHS ++ + + + WR VA     V+VG 
Sbjct: 250 LGKQALILIPEIALTVEFLDRLKKRFGQKPAQWHSGVTMTEKRRCWRMVAEAKAQVVVGA 309

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RS+L+LPFK LGLIV+DEEHD SYKQE+G+LY+ARDM+++R  IE   V+L SATPS+E+
Sbjct: 310 RSSLYLPFKNLGLIVVDEEHDTSYKQEDGVLYSARDMAVMRASIEQGSVILASATPSLET 369

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
            VN  + +Y+ V L+ R+ ++ +P +  IDMR Q + +   +SP++ + +   L R+EQ+
Sbjct: 370 WVNADTGKYNRVDLTERFGDARIPEIFTIDMRDQPMERNSWISPQLKEEVELRLERSEQS 429

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           LLFLNRRGYAP+T+C+ CG++L C  C   +VEHR    L CHQCG +     +C  CG 
Sbjct: 430 LLFLNRRGYAPITVCRKCGDQLGCEQCDARMVEHRFHGHLMCHQCGETKEMPNTCPSCGE 489

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
              + A G G+ER+AEE    FP A+IS+LSSD+      L+ ++  IA G+ DIIIGTQ
Sbjct: 490 VDCLTAVGPGVERLAEEAQVKFPNAKISVLSSDMLISAQALKERIKGIASGDADIIIGTQ 549

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           LVAKGHNFP ++LVGV+D DL L   DLR++ERTFQL+ QV GRAGR   K +  +Q +Q
Sbjct: 550 LVAKGHNFPLLTLVGVIDSDLALMGGDLRAAERTFQLMRQVAGRAGRADKKGIAFLQTHQ 609

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P HPV++A++ GD + F++SE + R    +PPFGRLA +I+ G     V N A ++ ++A
Sbjct: 610 PEHPVVKAILKGDEEEFWQSEAQQRRLAGMPPFGRLAGIILKGPNLNNVFNVANHMVKNA 669

Query: 665 PRSSDIV---VFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRV 721
            ++ DI+   VFGPA +P+  VRG +R R+L+   + + LQ    + + N+ K    +++
Sbjct: 670 -QTLDIINAQVFGPAPAPIARVRGNHRVRILVKSSKETMLQSSLMK-WRNSFKIPKDIQI 727

Query: 722 QFDIDPQNF 730
             DIDPQ+F
Sbjct: 728 SIDIDPQSF 736


>gi|83954478|ref|ZP_00963189.1| primosomal protein N' [Sulfitobacter sp. NAS-14.1]
 gi|83840762|gb|EAP79933.1| primosomal protein N' [Sulfitobacter sp. NAS-14.1]
          Length = 732

 Score =  577 bits (1488), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 305/726 (42%), Positives = 439/726 (60%), Gaps = 19/726 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V ++  Q +     Y  P      +G+ V VPL  R V+G+VW   +  Y  +  K+R +
Sbjct: 14  VAVMTTQPLGRALDYKAPEG-GCHMGAFVEVPLGPRKVIGVVWGAGQGDY--EPSKIRSV 70

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  ++  F+   A YT +PM  + R+   A  L +   M +  +     P  
Sbjct: 71  IRVLDAAPMREELRSFLTRAAAYTLTPMPAMLRLATRAPGLGDPPSMRKIYRRGEGEPDR 130

Query: 134 NTVARLRVLDKIKD-GKI-WEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPN 191
            T AR RVLD + + G + +  ++L   S V++ VI GL  QG +    E  SP  D P 
Sbjct: 131 MTDARRRVLDTLAEYGDLSFTLKELAEMSGVTASVIKGLVTQGAV---LEQDSPR-DLPF 186

Query: 192 LYF--SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
           +    SLP   + +            + +  +  +L+ GVTGSGKTEVYLE VAA L  G
Sbjct: 187 MRMDPSLPSKELTEDQASASALLAAGVASGTYGTTLLRGVTGSGKTEVYLEAVAAALKSG 246

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           +Q L+LLPEI+LT   L R Q RFG KPAEWHS  + + R +IW+ V +G   V++G RS
Sbjct: 247 RQALVLLPEIALTEQFLHRVQARFGAKPAEWHSGATMTERRRIWKMVGQGQAQVVIGARS 306

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLPF+ LGLIV+DEEHD SYKQEEG+LYNARDM+++R  I    VVL SATPS+ES  
Sbjct: 307 ALFLPFQNLGLIVVDEEHDTSYKQEEGVLYNARDMAVLRASICGAQVVLASATPSLESWA 366

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N  + +Y  V L++R+  + +P +  IDMR + +   K +SP +   +   L R EQ +L
Sbjct: 367 NAEAGKYTRVELTSRFGPAVMPTMGAIDMRSEGLPSDKWVSPTLKVEVDKRLERGEQAML 426

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           F+NRRGYAP+TLC+ CG+++ C HC   +VEHR  K+L CHQCG S    + C  C   G
Sbjct: 427 FINRRGYAPVTLCRACGHQIGCDHCDARMVEHRYLKRLVCHQCGESKPMPEVCPSCEVEG 486

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
           K+ A G G+ER+ EE    +P AR++ LSSD+ G    L+ +++ IA G  DIIIGTQLV
Sbjct: 487 KLAAVGPGVERLGEEAAALWPEARVATLSSDMYGSARALKAEIAGIADGAADIIIGTQLV 546

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGHNFP ++LVGV+D DLGL  +DLR++ERT+QL+ QV GRAGR       L+Q +QP 
Sbjct: 547 AKGHNFPNLTLVGVIDADLGLMGSDLRAAERTYQLMRQVAGRAGRAEAPGTALLQTFQPD 606

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP 665
           HPV++A+++GD + F+++E   R    +PP+GR+A +I+SG     + +    L ++ AP
Sbjct: 607 HPVIRAILAGDEEGFWKAEAGERRHAGVPPYGRMAGIILSGPDVAALFDAGNQLARQDAP 666

Query: 666 -RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFD 724
            R+    V+GPA +P+  VRGR+R RLL+  ++ + LQ   ++ +   ++  N +R+  D
Sbjct: 667 LRAVGAQVYGPAPAPIARVRGRHRVRLLVKAEKAAPLQEALAK-WVAQLRLKNDVRIAVD 725

Query: 725 IDPQNF 730
           IDPQ+F
Sbjct: 726 IDPQSF 731


>gi|83950123|ref|ZP_00958856.1| primosomal protein N' [Roseovarius nubinhibens ISM]
 gi|83838022|gb|EAP77318.1| primosomal protein N' [Roseovarius nubinhibens ISM]
          Length = 762

 Score =  577 bits (1488), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 309/724 (42%), Positives = 440/724 (60%), Gaps = 15/724 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           + +L  Q +     Y  P      LG+ V VPL  R VLG+VW      + +   K+R +
Sbjct: 44  IAVLTTQPLDRTLDYRAPEG-GCHLGAFVEVPLGPRKVLGVVWGRGRGDFDLS--KVRAV 100

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  +M EF+   ADYT +PM  + R+   A  LS+   M +  +     P  
Sbjct: 101 LRVLDVAPMRAEMQEFLTRAADYTLTPMPAMLRLAARAPGLSDPPSMRKVYRLGDATPDR 160

Query: 134 NTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPN 191
            T AR RVL+ ++D  G  +  ++L   + V+S V+ GL   G + +  E     +  P 
Sbjct: 161 MTDARTRVLEVLRDYGGLAFTLKELSDQAGVTSSVVKGLVKLGAVAE--EDTPRDLPFPR 218

Query: 192 LYFSLPI--LDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           L   LP   L ++Q      +      G +  +L+ GVTGSGKTEVYLE VA  L   +Q
Sbjct: 219 LDPGLPAAQLTEDQSRAAAHLAQGLRAGRYGTTLLRGVTGSGKTEVYLEAVAECLRQNRQ 278

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
            L+LLPEI+LT   L R   RFG +PAEWHS ++ + R +IW+ V +G   V+VG RSAL
Sbjct: 279 ALVLLPEIALTEEFLRRIGARFGAQPAEWHSGVTMTERRRIWKMVGQGGCQVVVGARSAL 338

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           FLPF+ LGLIV+DEEHD SYKQE+G+LYNARDM+++R  I    VVL SATPS+ES  N 
Sbjct: 339 FLPFRDLGLIVVDEEHDSSYKQEDGVLYNARDMAVLRASICDAQVVLASATPSLESWANA 398

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFL 428
            + +Y  + L+ R+  + +P L+ IDMR +T+   + +SP +   +   +   EQ+LLFL
Sbjct: 399 EAGKYARLDLTARFGPAVMPELRAIDMRAETLPSNRWISPSLQSAVLRRIEAGEQSLLFL 458

Query: 429 NRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKM 488
           NRRGYAP+T+C+ CG+++ C  C   +VEHR  K+L CHQCG +A   ++C  C   GK+
Sbjct: 459 NRRGYAPVTICRACGHQIACPDCDARMVEHRFLKRLMCHQCGETAPIPEACPSCEVEGKL 518

Query: 489 IACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
              G G+ER+ EE    FP AR++ LSSDL G    L+ Q++AI +G  DI+IGTQLVAK
Sbjct: 519 AVVGPGVERLTEEAQALFPNARVATLSSDLFGSARALKEQIAAIGQGGADIVIGTQLVAK 578

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           GHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR       L+Q +QP HP
Sbjct: 579 GHNFPNLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAEKPGTALLQTFQPEHP 638

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP-R 666
           V++A++SGD + F+ +E R RE+  +PP+GR+A +++S    QE  +    L +  AP R
Sbjct: 639 VIRAILSGDEEGFWRAEAREREAAGVPPYGRMAGIVLSSPDPQEAFDAGLALARGDAPIR 698

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
           +    V+GPA +P+  VRGR+R RLL+   + + LQG  ++ +   I+    LR+  DID
Sbjct: 699 AIGAQVYGPAPAPIARVRGRHRVRLLVKAPKGAALQGAVAR-WVAQIRPGPNLRMSVDID 757

Query: 727 PQNF 730
           PQ+F
Sbjct: 758 PQSF 761


>gi|163745812|ref|ZP_02153171.1| primosome assembly protein PriA [Oceanibulbus indolifex HEL-45]
 gi|161380557|gb|EDQ04967.1| primosome assembly protein PriA [Oceanibulbus indolifex HEL-45]
          Length = 745

 Score =  575 bits (1482), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 303/701 (43%), Positives = 437/701 (62%), Gaps = 18/701 (2%)

Query: 41  GSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTF 100
           G+ V VPL  R V+G+VW      Y I+  K+R +  V D PP+  +M EF+   A YT 
Sbjct: 51  GAFVEVPLGPRKVMGVVWGPGAGDYDIN--KVRHVIRVLDAPPMRDEMREFLLRSAAYTL 108

Query: 101 SPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRINTVARLRVLDKIKD-GKI-WEKRDL 156
           +P+  + R+   A  L +   M +  +     P   T AR RV+  +++ G + +  ++L
Sbjct: 109 TPLPAMLRLATRAPGLGDPPSMRKIYRAGDGVPTRMTDARQRVMAVLEEYGDLAFTLKEL 168

Query: 157 IRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP--NLYFSLP--ILDKNQQDVVEQVVP 212
              + V+S V+ GL  QG ++   E  SP  D P   L  SLP   L ++Q      +  
Sbjct: 169 SEMAGVTSSVVKGLVEQGAVR---EEESPR-DLPFRRLDPSLPGKALTEDQASAAAVLRE 224

Query: 213 -LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFG 271
            +  + +  +L+ GVTGSGKTEVYLE VAA +  G+Q L+LLPEI+LT   L+R ++RFG
Sbjct: 225 GIKAETYGTTLLRGVTGSGKTEVYLEAVAAAIESGRQALVLLPEIALTEQFLDRVEERFG 284

Query: 272 VKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQE 331
            KPAEWHS ++ + R +IWR V  G   +++G RSALFLPF+ LGLIV+DEEHD SYKQE
Sbjct: 285 AKPAEWHSGVTMTERRRIWRMVGEGNAQLVIGARSALFLPFQSLGLIVVDEEHDTSYKQE 344

Query: 332 EGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQ 391
           +G+LYNARDM+++R  I    VVL SATPS+E+  N  + +Y  + L++R+  + +P + 
Sbjct: 345 DGVLYNARDMAVLRASICGAQVVLASATPSLETWANAEAGKYRRLELTSRFGPAVMPQMG 404

Query: 392 VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHC 451
            IDMR   +   K +S EM   +   L R EQ +LF+NRRGYAP+TLC+ CG ++ C  C
Sbjct: 405 AIDMRQAGLPGDKWISAEMKREVDARLERGEQAMLFINRRGYAPITLCRACGEQIGCDQC 464

Query: 452 SCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARI 511
              +VEHR  K+L CHQCG +    ++C  C   GK+   G G+ER+ EE    +P ARI
Sbjct: 465 DARMVEHRFLKRLVCHQCGETKPMPEACPSCEVEGKLAPIGPGVERLGEEATALWPEARI 524

Query: 512 SILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNAD 571
           + LSSD+ G    L+ +++ IA+G  DIIIGTQLVAKGHNFP+++LVGV+D DLGLT +D
Sbjct: 525 ATLSSDMYGSARALKAEIAGIAEGTADIIIGTQLVAKGHNFPKLTLVGVIDADLGLTGSD 584

Query: 572 LRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARES 631
           LR++ERTFQL+ QV GRAGR       L+Q YQP HPV++A+++G+ + F+ +E   R  
Sbjct: 585 LRAAERTFQLMRQVAGRAGRAEAPGAALLQTYQPEHPVIRAILAGEEEKFWAAEAGERRQ 644

Query: 632 VNLPPFGRLAAVIISGTKYQEVENYAYNLKEH-AP-RSSDIVVFGPAESPLFMVRGRYRF 689
             +PP+GR+A +I+SG+    V +   +L  H  P R+    VFGPA +P+  VRGR+R 
Sbjct: 645 AGVPPYGRMAGIILSGSDAAAVFDLGNHLARHDGPLRAVGAQVFGPAPAPIARVRGRHRV 704

Query: 690 RLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           RLL+   ++  LQ   S+ +  +++    LR+  DIDPQ+F
Sbjct: 705 RLLVKADKSVALQEALSR-WVGSVRLKGDLRLAVDIDPQSF 744


>gi|163733504|ref|ZP_02140947.1| primosome assembly protein PriA [Roseobacter litoralis Och 149]
 gi|161393292|gb|EDQ17618.1| primosome assembly protein PriA [Roseobacter litoralis Och 149]
          Length = 745

 Score =  574 bits (1480), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 308/731 (42%), Positives = 447/731 (61%), Gaps = 29/731 (3%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           + +L  Q +     Y  P      LG+ V VPL  R VLG+VW   +  Y  +  K+R  
Sbjct: 27  IAVLTTQPLGRTLDYRAPEG-GCHLGAFVEVPLGPRKVLGVVWGPGQGDY--ERSKIRQA 83

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  +MC F+K  ADYT +P+  + R+   A  L +   M +  +     P  
Sbjct: 84  YRVLDAAPMREEMCLFLKRAADYTLTPLPAMLRLATRAPGLGDPPSMRKIYRRGSGEPDK 143

Query: 134 NTVARLRVLDKIKD-GKI-WEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPN 191
            T AR +VL  + + G + +  ++L   + V + V+ GL AQG + +         DSP 
Sbjct: 144 MTAARRKVLAALAEYGDLAFTLKELAEMADVGTSVVKGLVAQGAVVE--------EDSPR 195

Query: 192 LYFSLPILDKNQQD----------VVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAA 241
                P LD ++              +    + ++ +  +L+ GVTGSGKTEVYLE VAA
Sbjct: 196 -DLPFPRLDPSRPGKALTADQAAGAAQLAQAVRSERYGTTLLRGVTGSGKTEVYLEAVAA 254

Query: 242 VLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVI 301
            L  G+Q L+LLPEI+LT+  L R Q+RFG +PAEWHS  + + R +I+R V +G   ++
Sbjct: 255 ALTAGRQALVLLPEIALTAEFLTRVQERFGARPAEWHSGATMTERRRIFRMVGQGEAQLV 314

Query: 302 VGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPS 361
           +G RSALFLP++ LGLIV+DEEHD SYKQEEG+LYNARDM+++R  I    VVL SATPS
Sbjct: 315 IGARSALFLPYQNLGLIVVDEEHDTSYKQEEGVLYNARDMAVLRASICGAQVVLASATPS 374

Query: 362 IESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARN 421
           +ES  N  + +Y  + L++R+  + +P ++ IDMR +++   + +S  +   +   +AR 
Sbjct: 375 LESWANAQAGKYAKLELTSRFGAAVMPEMRAIDMRVESLPSNRWVSDVLRKEVEARMARG 434

Query: 422 EQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVV 481
           EQ++LF+NRRGYAP+TLC+ CG+++ C HC   +VEHR  K+L CHQCG S      C  
Sbjct: 435 EQSMLFINRRGYAPITLCRACGHQIGCDHCDARMVEHRFLKRLVCHQCGESKPMPTVCPS 494

Query: 482 CGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIII 541
           C +  ++ A G G+ER+AEE  E FP ARI+ LSSD+ G    L+ ++  IA G  DIII
Sbjct: 495 CNAEDRLAAVGPGVERLAEEATELFPDARIAALSSDMYGSARALKAEIEDIAAGGADIII 554

Query: 542 GTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQ 601
           GTQLVAKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR       L+Q
Sbjct: 555 GTQLVAKGHNFPNLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAEKAGAALLQ 614

Query: 602 AYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL- 660
            YQP HPV++A+++GD D F+ +E R R++  +PP+GR+A +I+SG     V +    L 
Sbjct: 615 TYQPEHPVIRAILAGDEDEFWAAEARERKAAGVPPYGRMAGIILSGPDVAMVFDAGNQLA 674

Query: 661 KEHAP-RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNAL 719
           ++ AP R+    VFGPA +P+  VRGR+R RLL+  ++++ LQ   ++ +   ++    L
Sbjct: 675 RQDAPLRAIGAQVFGPAPAPIARVRGRHRVRLLVKAEKSAPLQEALAR-WVAQLRIKGDL 733

Query: 720 RVQFDIDPQNF 730
           RV  DIDPQ+F
Sbjct: 734 RVAVDIDPQSF 744


>gi|294012664|ref|YP_003546124.1| primosomal protein N' [Sphingobium japonicum UT26S]
 gi|292675994|dbj|BAI97512.1| primosomal protein N' [Sphingobium japonicum UT26S]
          Length = 723

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 308/731 (42%), Positives = 438/731 (59%), Gaps = 19/731 (2%)

Query: 12  VCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSE--EKYKIDS 69
           + SR  ++LL A  GP  Y V   M V+ GSIV  PL  R ++G+VW      E   +  
Sbjct: 1   MSSRARVILLNAALGPLDYRVSHGMSVQPGSIVVAPLGPRQIVGVVWDEDSFPEIETVGD 60

Query: 70  LKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF--T 127
            +LR I    D PP+   +   ++W ADY  +P+  V RM +++++  E     I++  T
Sbjct: 61  NRLRNIVGPVDAPPVPETLRRLIEWTADYYLAPIAAVLRMTLASMAALEGARTVIEYRAT 120

Query: 128 GIFPRINTVARLRVLDKI--KDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISP 185
           G  P   T  R + +++I  + G I   R+L     VS  VI GL   G     FE +  
Sbjct: 121 GDLPDRITEQRAQAMERIGERQGLI---RELALIGGVSDAVIRGLVKAGA----FEAVEV 173

Query: 186 VVDSP----NLYFSLPILDKNQQDVVEQ-VVPLCTKGFAVSLISGVTGSGKTEVYLEIVA 240
            VD+P    N   + P+L   Q    +Q +  +  + FA  L+ GVTGSGKTEVY E +A
Sbjct: 174 SVDTPFPMPNPDHAPPLLSDKQGAAADQFIAAVRERTFAPFLLDGVTGSGKTEVYFEAIA 233

Query: 241 AVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISV 300
           A +  G+QVL+LLPEI+LT   LERF+KRFG  P  WHS L  S R + WR +A G  SV
Sbjct: 234 AAVREGRQVLVLLPEIALTEPFLERFEKRFGTVPVNWHSGLRQSERRRAWRAIAAGEASV 293

Query: 301 IVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATP 360
           +VG RSALFLP+  LGLIV+DE H+ S+KQE+G+ Y+ARD++++RG IE FP++L SATP
Sbjct: 294 VVGARSALFLPYPNLGLIVVDEAHEASFKQEDGVHYHARDVAVMRGLIEKFPIILASATP 353

Query: 361 SIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLAR 420
           +IE+R      RY  + L +R+  + +P ++ I++      +G+ ++P ++  I  T+ +
Sbjct: 354 AIETRHQVELGRYKEIKLPSRFGGATMPEIKGINLLTDPPERGRWIAPPLVRAIDETMGK 413

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
            EQ+LLFLNRRGYAPLTLC+ CG R +C +C+ W+VEHR   +L CH CGH     + C 
Sbjct: 414 GEQSLLFLNRRGYAPLTLCRHCGYRFQCPNCTAWMVEHRLTHRLACHHCGHVVPAPRFCP 473

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
            C     ++ACG G+ERIA+EV   +P AR +I++SD      ++   + ++  G +DII
Sbjct: 474 ECKEEDSLVACGPGVERIADEVKALWPQARTAIVTSDTLWSPAKVAEFVKSVEAGAVDII 533

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQLV KG++FP ++LVGV+D DLGL   DLR+SERTFQ + QV GRAGR        I
Sbjct: 534 IGTQLVTKGYHFPNLTLVGVIDADLGLEGGDLRASERTFQQIVQVAGRAGRGQKPGRVFI 593

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           Q   P   V+QAL++GD++ FYE E   R   N+PPFGR AA+I+S     E    A  +
Sbjct: 594 QTRMPEAEVIQALIAGDSERFYEVETENRRRANVPPFGRFAAIIVSSEDADEAAEVARLI 653

Query: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
            + AP    + V+GPA +PL ++RGR+R RLLIH  R  ++Q   S+   N   +S   R
Sbjct: 654 GKSAPSIDGMRVYGPAPAPLSVLRGRHRHRLLIHAARQVDVQRAISEWLGNLTWKSGT-R 712

Query: 721 VQFDIDPQNFL 731
           V  D+DP +F+
Sbjct: 713 VAVDVDPYSFM 723


>gi|310815281|ref|YP_003963245.1| primosomal protein N', putative [Ketogulonicigenium vulgare Y25]
 gi|308754016|gb|ADO41945.1| primosomal protein N', putative [Ketogulonicigenium vulgare Y25]
          Length = 738

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 312/735 (42%), Positives = 444/735 (60%), Gaps = 26/735 (3%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P     ++G++V VPL  R VLG+VW   +  +  D  K R I
Sbjct: 11  VAVLTAQPIDRMLDYRAPEG-GCDIGALVEVPLGPRKVLGVVWGPGQGGF--DPAKARSI 67

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--------LSETEKMEEKIQF- 126
             + D PPL  +M  F++ VADYT +PM  + RM V A        L     +E+ ++  
Sbjct: 68  LRLHDVPPLRDEMRRFLEKVADYTLTPMFQMLRMTVRAPALEDAVRLGYPPALEDAVRLV 127

Query: 127 ---TGIFPRINTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFE 181
              TG  P   T AR +VL  ++D  G  +   +L  A+ V+  VI GL   G I +  E
Sbjct: 128 YRATGAVPDRMTPAREKVLQVMRDFGGLSFTLGELAGAADVTPSVIKGLVKAGAISE--E 185

Query: 182 VISPVVDSPNLYFSLP--ILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEI 238
           V    +    L  + P   L   Q    + +      G +  +L+ GVTGSGKTEVYLE 
Sbjct: 186 VAPKDLPFQRLNPAHPGKALTDEQTAAADALRTSVRSGQYGTTLLKGVTGSGKTEVYLEA 245

Query: 239 VAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAI 298
           VA  L  G+Q L+LLPEI+L+   L R ++RFG +PAEWHS ++ + R ++W+ +  G  
Sbjct: 246 VAETLRAGRQALVLLPEIALSGEFLRRVEERFGARPAEWHSGITMTERRRVWKMIGTGDA 305

Query: 299 SVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSA 358
            V+VG RSALFLPF+ LGLIV+DEEHD SYKQ +G+LYNARDM+++R  + +  VVL SA
Sbjct: 306 QVVVGARSALFLPFQDLGLIVVDEEHDGSYKQGDGVLYNARDMAVLRASLNAAQVVLASA 365

Query: 359 TPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTL 418
           TPS+E+ VN  + +Y  + L  R+  + +P ++ IDMR + +  G+ +SP +   I + +
Sbjct: 366 TPSLETWVNADTGKYARITLDARFGVAVMPDMRPIDMRAEKLPGGRWISPTLQGAILNRM 425

Query: 419 ARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQS 478
            + EQ+LLFLNRRG+AP+TLC+ CG ++ C HC   +VEHR + +L CHQCG +     +
Sbjct: 426 KKGEQSLLFLNRRGFAPVTLCRACGQQVACDHCDARMVEHRFQNRLVCHQCGANRPVPDA 485

Query: 479 CVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEID 538
           C  CG  GKM+  G G+ER+ EEV   FP AR ++LSSDL G    L+ +++ IA G  D
Sbjct: 486 CPSCGVEGKMVPVGPGVERLEEEVKAVFPEARATVLSSDLFGTARALKDRIAEIAAGGAD 545

Query: 539 IIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLG 598
           IIIGTQ+VAKGHNFP+++LVGV+D DLGL  +DLR++E+TFQL+ QV GRAGR     + 
Sbjct: 546 IIIGTQIVAKGHNFPKLTLVGVIDADLGLQGSDLRAAEKTFQLMRQVAGRAGRAEAPGVA 605

Query: 599 LIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY 658
           L+Q YQP HPV++A++SGD + F+++E   R +  +PPFGR+A VIIS    Q   +   
Sbjct: 606 LLQTYQPEHPVLRAIMSGDDEGFWQAEADQRHAAGVPPFGRMAGVIISSPDLQAAFDVGN 665

Query: 659 NLKEHAPRSSDI--VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRS 716
            L  +A     +   V+GPA +P+  VRGR+R RLL+   + + LQ   +Q     I   
Sbjct: 666 RLARNAGPLLQVGAEVYGPAPAPIARVRGRHRVRLLVKAAKGAALQAALAQWI--AIPLP 723

Query: 717 NALRVQFDIDPQNFL 731
             LR+  DIDPQ+FL
Sbjct: 724 PDLRLTIDIDPQSFL 738


>gi|103487760|ref|YP_617321.1| primosome assembly protein PriA [Sphingopyxis alaskensis RB2256]
 gi|98977837|gb|ABF53988.1| primosomal protein N' [Sphingopyxis alaskensis RB2256]
          Length = 722

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 300/725 (41%), Positives = 429/725 (59%), Gaps = 11/725 (1%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSE--EKYKIDSLK 71
           +R  +LLL A  GP  Y VP   +  LGS+V  PL  R + G+VW +        +   +
Sbjct: 2   TRARVLLLTAALGPLDYRVPQGSEAPLGSVVIAPLGPRRIGGVVWEDESFGAPDPVGDNR 61

Query: 72  LRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF--TGI 129
           LR +  +   PP++  +   V+W +DY  SP G V RM++  ++  +     +++  TG 
Sbjct: 62  LRNLYEIVPVPPIAAPLRRLVEWTSDYYLSPPGSVLRMLLPGVAFADARRPIVEYRATGE 121

Query: 130 FPRINTVARLRVLDKI--KDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVV 187
            P   T  R   L KI  + G +   R+L + + VS  VI GL   G ++ +        
Sbjct: 122 LPARMTPQRTVALGKIGARQGTV---RELAKLADVSEAVIRGLVHVGALEAVSASADQPC 178

Query: 188 DSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
             P+  F+ P L   Q     Q+        F   L+ GVTGSGKTEVY+E +AA +  G
Sbjct: 179 PEPDPAFAPPDLSAEQTAAAAQLRAAVAAARFETLLLDGVTGSGKTEVYMEAIAAAVDAG 238

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           +Q L+LLPEI+LT  +L RF  RFG +P  WHS L ++ R + W  +A G   ++VG RS
Sbjct: 239 RQALVLLPEIALTEPMLTRFAARFGCEPVAWHSGLRSTERRRAWHAIASGEARIVVGARS 298

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLP+ +LG+IV+DE H+ S+KQE+G+ Y+ARD++++RG  E  PV+L SATP++ES  
Sbjct: 299 ALFLPYARLGVIVVDEAHETSFKQEDGVHYHARDVAVMRGYFEGLPVILASATPALESLA 358

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
              + RY  + L  R+  + LP L  IDMR     +G+ L+P ++D +   L + EQ+LL
Sbjct: 359 QVEAGRYRHIQLPARFGGATLPDLAAIDMRQDPPDRGRWLAPPLVDALADRLEKGEQSLL 418

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRG+APLTLC+ CG+R++C +C+ W+VEHR   +L CH CGH     + C  C    
Sbjct: 419 FLNRRGFAPLTLCRTCGHRIQCPNCTAWMVEHRLVHRLACHHCGHVMPPPRLCPECEDED 478

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
            ++ACG G+ER+A+EV   FP AR +I++SD      R    ++ + +G +DIIIGTQLV
Sbjct: 479 SLVACGPGVERVADEVALRFPEARTAIVTSDTLWSPARAAEFVANVEQGLVDIIIGTQLV 538

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
            KG++FP ++LVGVVD DLGL   DLR+SERTFQ ++QV GRAGR       LIQ   P 
Sbjct: 539 TKGYHFPNLTLVGVVDADLGLDGGDLRASERTFQQIAQVAGRAGRGVKPGEVLIQTRVPD 598

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR 666
            PVM ALV+GD D FY +E  AR +   PP+GR AA++IS    +     A  L   AP 
Sbjct: 599 APVMAALVAGDRDGFYAAEAAARRAAGAPPYGRFAALVISSEDIEVARGVAQRLGAKAPV 658

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
           +  + V+GPA +PL M+RGR+RFRLL+H  R+ +LQG      D +I      R+  D+D
Sbjct: 659 ADGLAVYGPAPAPLAMLRGRHRFRLLLHAPRSFDLQGTIRAWVD-SIDWPAKARLAIDVD 717

Query: 727 PQNFL 731
           P +F+
Sbjct: 718 PYSFV 722


>gi|304320350|ref|YP_003853993.1| primosomal protein N' [Parvularcula bermudensis HTCC2503]
 gi|303299252|gb|ADM08851.1| primosomal protein N' [Parvularcula bermudensis HTCC2503]
          Length = 738

 Score =  571 bits (1471), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 310/726 (42%), Positives = 427/726 (58%), Gaps = 13/726 (1%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           RV +LL   V   Y Y+VP+ M++  G+ VRVPL  R V G+VW         D  KL+P
Sbjct: 15  RVRVLLPLPVGDGYDYTVPAGMRLVPGAFVRVPLGPRQVAGVVWALDPAGEVADD-KLKP 73

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF---TGIFP 131
           I   +D PPL+     FV WVA YT SP G V R+V+ A  +    + ++ +     + P
Sbjct: 74  ITAQYDTPPLAEATRRFVDWVAGYTLSPRGTVLRLVMRAGQQLTPPKARLAYRLPDPVPP 133

Query: 132 RIN-TVARLRVLDKIK--DGKIWEKRDLIRASQVSSHVIDGLKA-QGVIKQIFEVISPVV 187
            +  T AR RV++ ++   G      DL + + V+  V+ GL A +G+I +     +P  
Sbjct: 134 GLRMTEARARVIEILRRQGGGPLVAADLAKDADVTPGVLKGLAAAEGLIPEEVARDAPF- 192

Query: 188 DSPNLYFSLPILDKNQQDVVEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVL--H 244
             P+ +     L ++Q    E +       G+   L+ GVTGSGKTEVYLE  AA L   
Sbjct: 193 GRPDPHLPGRALSEHQAAAAESLSAAVHAGGYRAFLLDGVTGSGKTEVYLEAAAAALKKD 252

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
              Q+ ILLPEI LT   LER  +RFG  PA WHS LS   R ++WR VA G+  V+VG 
Sbjct: 253 PDAQICILLPEIGLTLPFLERIHRRFGTAPAHWHSDLSQGTRRRVWRGVADGSAKVVVGA 312

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALFLPF++L LIV+DEEH+ +YKQ +G+LY ARDM++ R   + FPV+LVSATPS+E+
Sbjct: 313 RSALFLPFRRLALIVVDEEHEPAYKQHDGVLYQARDMAVARAAQDGFPVLLVSATPSLET 372

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
             N    RY  V L+ RY  + LP   ++DMR     +G+ LSP  ID +   LA  EQ 
Sbjct: 373 LANVEEGRYDRVALAVRYGPARLPETAIVDMRADPPERGQWLSPIAIDAVTTCLAAGEQV 432

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           LL+LNRRGYAP+TLC+ CG R+       WLVEHR   +L CH  G+S      C  CG+
Sbjct: 433 LLYLNRRGYAPVTLCRTCGERMTAPGSDTWLVEHRYSGRLVCHHTGYSIPKPDHCPHCGA 492

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
              +  CG G+ERIAEE    +P AR++ILSSD     G ++  L  +  GEIDI++ TQ
Sbjct: 493 PDSLTPCGPGVERIAEEAAARWPDARLAILSSDTMTAPGAMRQTLERMTAGEIDILVATQ 552

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
             AKGHNFP ++LV  VD DLGL   DLR++ERT+Q L+QV+GRAGR       L+Q+YQ
Sbjct: 553 AAAKGHNFPGLTLVVAVDADLGLAGGDLRAAERTYQTLAQVSGRAGRAERPGRVLLQSYQ 612

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P  PV+ AL +GD + F E+E+  R  +  PPFGRLAAVI+SG     +  +A++L    
Sbjct: 613 PESPVICALAAGDREGFTEAELEGRAQLGFPPFGRLAAVILSGDNEARLTRFAHDLALAV 672

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFD 724
           P +  + ++GPA +PL+ ++G YR R L+   R  ++Q    + +   IK  + +R   D
Sbjct: 673 PHAEGVEIWGPAPAPLYRLKGIYRQRFLVKTGRRVSIQAVL-KSWLGPIKLPSGIRRTVD 731

Query: 725 IDPQNF 730
           IDP +F
Sbjct: 732 IDPYSF 737


>gi|296282423|ref|ZP_06860421.1| primosome assembly protein PriA [Citromicrobium bathyomarinum
           JL354]
          Length = 725

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 320/736 (43%), Positives = 442/736 (60%), Gaps = 32/736 (4%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSL---K 71
           R+ +L+L A  G   Y VP  M VE GS+V  PL  R V GIVW   EE+   +S+   K
Sbjct: 3   RIRLLVLNAALGVLDYRVPDGMTVEHGSVVVAPLGPRQVTGIVW--EEERLPGESVPEAK 60

Query: 72  LRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTG 128
           LRPI  V    PL  Q+   ++W ADY  + M  VARMV++   AL     + E  + T 
Sbjct: 61  LRPILSVLPVRPLHAQLRRLIEWTADYYCASMSSVARMVLASGGALKGGVTVTE-YRLTD 119

Query: 129 IFPRINTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPV 186
             P   T  R + L+K+ D  G I   R+L   + VS  V+ GL +QGV++      +  
Sbjct: 120 TQPDRMTPQRKQALEKLVDRQGTI---RELAAIAGVSDGVLRGLVSQGVLE------AEE 170

Query: 187 VDSPNLY------FSLPILDKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIV 239
           VD+   Y       + P+L   Q +V +++V  +  + FA  L+ GVTGSGKTE Y E V
Sbjct: 171 VDADRPYPRAQPDHAEPVLSPQQAEVADELVRAVEAQDFAPILLDGVTGSGKTETYFEPV 230

Query: 240 AAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVA----R 295
           AA +  G+QVL+LLPEI+LT   L RF+ RFGV P  WHSSL +S R + WR +A     
Sbjct: 231 AAAIRAGRQVLVLLPEIALTENFLRRFEDRFGVSPVLWHSSLKSSERRRAWRAIARAPEE 290

Query: 296 GAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVL 355
           G   V+VG RSALFLP+  LGLIV+DE H+IS+KQ++G+ YNARD++++RG  E  PVVL
Sbjct: 291 GGAQVVVGARSALFLPYANLGLIVVDEAHEISFKQDDGVRYNARDVAVMRGHFERIPVVL 350

Query: 356 VSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIR 415
            SATP++ES     +  Y  + L +R+  ++LP ++++D+  +   +G+ L+P +   + 
Sbjct: 351 ASATPALESLHMAETGTYRKLDLPSRFGGASLPTIRLLDLTEEPPERGRWLAPTLARELF 410

Query: 416 HTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIY 475
             + R EQTLLFLNRRGYAPLTLC+ CG R +C  CS WLVEHR   +L CH CGH    
Sbjct: 411 ARMERGEQTLLFLNRRGYAPLTLCRNCGYRFQCKQCSAWLVEHRFSHRLACHHCGHEEPT 470

Query: 476 SQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKG 535
            ++C  CG    ++ CG G+ER+A+EV E  P ARI++ +SD      R    ++    G
Sbjct: 471 PEACPECGEKDSLVPCGPGVERVADEVREIAPEARIAVATSDTLNTPARAAEFVAMAESG 530

Query: 536 EIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLK 595
            ID+I+GTQLV KG +FP ++LVGVVD DLGL   DLR++ER +Q ++QV GRAGR    
Sbjct: 531 AIDVIVGTQLVTKGFHFPDLTLVGVVDADLGLEGGDLRAAERVYQQIAQVAGRAGRASKP 590

Query: 596 SLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVEN 655
              LIQ   P  PV+ AL  GD D+FY +E+ AR   N PPFGR AA+I+S    +E   
Sbjct: 591 GEVLIQTRHPEAPVIAALAEGDRDAFYAAELEARRHANAPPFGRWAAIIVSSEDEKEARL 650

Query: 656 YAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKR 715
            A  + +  PR  DI++ GPA +PL  +RGRYR+RLLI+ KR + LQ      +   ++ 
Sbjct: 651 TAARIGDARPRLDDIMILGPAPAPLAQLRGRYRYRLLINAKRTAALQDAIRD-WLGPLEL 709

Query: 716 SNALRVQFDIDPQNFL 731
              +RV  DIDP +F+
Sbjct: 710 PRGVRVGIDIDPYSFV 725


>gi|255264544|ref|ZP_05343886.1| primosomal protein N' [Thalassiobium sp. R2A62]
 gi|255106879|gb|EET49553.1| primosomal protein N' [Thalassiobium sp. R2A62]
          Length = 739

 Score =  569 bits (1466), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 303/725 (41%), Positives = 448/725 (61%), Gaps = 21/725 (2%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +L  Q +     Y  P      +G+ V VPL  R V+G+VW  S  K   D  K+R    
Sbjct: 23  VLTTQPIDRFLDYKAPEG-GCHIGAFVEVPLGPRKVIGVVW--SAGKGDWDYNKVRAAFR 79

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQF-TGIFPRIN 134
           V D  P+  +M  F+   A+YT +PM  + R+   A  L +   M +  +  TG   R+ 
Sbjct: 80  VLDVSPMRHEMRLFLGRAAEYTLTPMAAMLRLATRAPGLGDPPSMRKIYRLGTGTADRM- 138

Query: 135 TVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNL 192
           T AR +VL  ++D  G  +  R+L   + V++ V+ GL     +  + E  +P  D+P L
Sbjct: 139 TPAREKVLGVLRDYGGLAFTLRELAEMADVTTSVVKGLAK---LDAVVEEDAPR-DTPYL 194

Query: 193 YFSLPILDK----NQQDVVEQV-VPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
                  DK    +Q+   E + V L ++ +  +L+ GVTGSGKTEVYLE VA  L  G+
Sbjct: 195 RLDPGYGDKELTADQETGAEALRVGLRSQDYGTTLLKGVTGSGKTEVYLEAVAECLAQGR 254

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           Q L+LLPEI+LT+  L R +  FG KPAEWHS ++ + R + WR V +G   ++VG RSA
Sbjct: 255 QALVLLPEIALTAEFLTRVEACFGAKPAEWHSGVTMTERRRCWRMVGQGDAQLVVGARSA 314

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LFLP++ LGLI++DEEHD SYKQE+G+LYNARDM+++R  I    VVL SATPS+ES  N
Sbjct: 315 LFLPYQNLGLIIVDEEHDTSYKQEDGVLYNARDMAVLRASIVGAQVVLASATPSLESWAN 374

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + +Y  V L++RY  + +P ++ IDMR + +   K +S  +   ++  + + EQ+LLF
Sbjct: 375 VEAGKYQKVVLTSRYGAAVMPEMRSIDMRAEALPSTKWVSGTLKREVQARIDKGEQSLLF 434

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           +NRRGYAP+TLC+ CG+++ C  C   +VEHR  K+L CHQCG +      C  C +  K
Sbjct: 435 INRRGYAPITLCRACGHQIGCDDCDARMVEHRFLKRLVCHQCGETKPMPTVCPNCQAEDK 494

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           ++  G G+ER+AEEV E FP AR+++LSSD  G    L+ Q+ AIA+GE DIIIGTQLVA
Sbjct: 495 LVPVGPGVERLAEEVIEAFPKARVAVLSSDHFGSARALKEQIVAIAEGEADIIIGTQLVA 554

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP+++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR   +   L+Q YQP H
Sbjct: 555 KGHNFPKLTLVGVIDADLGLQGSDLRAAERTFQLMLQVAGRAGRTEARGTALLQTYQPEH 614

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP- 665
           PV+++++SGD + F+ +E   R+   +PP+GR+A +++S    QE+ +   ++ +   P 
Sbjct: 615 PVIRSILSGDEEGFWTAEASERKQAGVPPYGRMAGIVLSSPNVQELFDLGADMARRDGPL 674

Query: 666 RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDI 725
           R     V+GPA +P+  +RGR+R RLL+   + + +Q   ++ +    + ++ LR+  DI
Sbjct: 675 REIGAQVYGPAPAPIARIRGRHRVRLLVKADKGAPIQAALTK-WVAQFRLTSTLRLSIDI 733

Query: 726 DPQNF 730
           DPQ+F
Sbjct: 734 DPQSF 738


>gi|307294144|ref|ZP_07573988.1| primosomal protein N' [Sphingobium chlorophenolicum L-1]
 gi|306880295|gb|EFN11512.1| primosomal protein N' [Sphingobium chlorophenolicum L-1]
          Length = 728

 Score =  568 bits (1465), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 303/733 (41%), Positives = 435/733 (59%), Gaps = 18/733 (2%)

Query: 12  VCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSE--EKYKIDS 69
           + SR  ++LL A  GP  Y VP  M V+ GSIV  PL  R ++G+VW      +   +  
Sbjct: 1   MSSRARVILLNAALGPLDYRVPHGMSVQPGSIVVAPLGPRQIVGVVWEEDSFPDVETVGD 60

Query: 70  LKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF--T 127
            +LR I    D PP+   +   ++W ADY  +P+  V RM +++++  E     I++  T
Sbjct: 61  NRLRNIVGPVDAPPVPETLRRLIEWTADYYLAPIAAVLRMTLASMAALEGARTVIEYRAT 120

Query: 128 GIFPRINTVARLRVLDKIKDGKIWEKRDLIRA----SQVSSHVIDGLKAQGVIKQIFEVI 183
           G  P      R+         +I E++ LIR       VS  VI GL   G     FE +
Sbjct: 121 GDLPGQEFQGRMTEQRAQAMERIGERQGLIRELAMIGGVSDAVIRGLVKAGA----FEAV 176

Query: 184 SPVVDSP----NLYFSLPILDKNQQDVVEQ-VVPLCTKGFAVSLISGVTGSGKTEVYLEI 238
              VD+P    +   + P+L   Q    ++ +  +  + FA  L+ GVTGSGKTEVY E 
Sbjct: 177 EVSVDTPFPMPDPDHAPPLLSDRQGAAADRFIAAVRGRDFAPFLLDGVTGSGKTEVYFEA 236

Query: 239 VAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAI 298
           +AA +  G+QVL+LLPEI+LT   LERF+KRFG  P  WHS L  + R + WR +A G  
Sbjct: 237 IAAAIREGRQVLVLLPEIALTEPFLERFEKRFGTVPVNWHSGLRQTERRRAWRAIAAGEA 296

Query: 299 SVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSA 358
            V+VG RSALFLP+  LGLIV+DE H+ S+KQE+G+ Y+ARD++++RG IE FPV+L SA
Sbjct: 297 PVVVGARSALFLPYPNLGLIVVDEAHEASFKQEDGVHYHARDVAVMRGLIEKFPVILASA 356

Query: 359 TPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTL 418
           TP+IE+R      RY  + L +R+  + +P ++ +++      +G+ ++P ++  I  T+
Sbjct: 357 TPAIETRHQVELGRYREIKLPSRFGGATMPAVEQVNLLTDPPERGRWIAPPLVKAIDETM 416

Query: 419 ARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQS 478
           A+ EQ+LLFLNRRGYAPLTLC+ CG R +C +C+ W+VEHR   +L CH CGH     + 
Sbjct: 417 AKGEQSLLFLNRRGYAPLTLCRHCGYRFQCPNCTAWMVEHRLTHRLACHHCGHVVPAPRF 476

Query: 479 CVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEID 538
           C  C     ++ACG G+ERIA+EV   +P AR +I++SD      ++   + ++  G +D
Sbjct: 477 CPECKEEDSLVACGPGVERIADEVKALWPQARTAIVTSDTLWSPAKVAEFVKSVEAGAVD 536

Query: 539 IIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLG 598
           IIIGTQLV KG++FP ++LVGV+D DLGL   DLR+SERTFQ + QV GRAGR       
Sbjct: 537 IIIGTQLVTKGYHFPNLTLVGVIDADLGLEGGDLRASERTFQQIVQVAGRAGRGQKPGRV 596

Query: 599 LIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY 658
            IQ   P   V++AL++GD++ FYE E   R   N PPFGR AA+I+S     E    A 
Sbjct: 597 FIQTRMPEAEVIKALIAGDSERFYEVETENRRRANAPPFGRFAAIIVSSEDADEAAEVAR 656

Query: 659 NLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNA 718
            + + AP    + V+GPA +PL ++RGR+R RLLIH  R  ++QG   +   N   +S  
Sbjct: 657 LIGKSAPLIEGMRVYGPAPAPLSVLRGRHRHRLLIHAARQVDVQGAIREWLGNLTWKSGT 716

Query: 719 LRVQFDIDPQNFL 731
            RV  D+DP +F+
Sbjct: 717 -RVAVDVDPYSFM 728


>gi|254452872|ref|ZP_05066309.1| primosomal protein N [Octadecabacter antarcticus 238]
 gi|198267278|gb|EDY91548.1| primosomal protein N [Octadecabacter antarcticus 238]
          Length = 730

 Score =  566 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 302/731 (41%), Positives = 441/731 (60%), Gaps = 29/731 (3%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +     Y  P      LG+ V VPL  R VLG+VW     K   D  K+R +
Sbjct: 12  VGVLTTQPLDRTLDYKAPEG-GCHLGAFVEVPLGPRKVLGVVW--GAGKGDFDYKKVRSV 68

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P++ +M +F+   ADYT +PM  + R+   A  L +   M +  +     P  
Sbjct: 69  IRVLDVAPMADEMRQFLIKAADYTLTPMNAMLRLATRAPGLGDAPSMRKVYRLGTDEPTR 128

Query: 134 NTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPN 191
            T AR +VL  ++D  G  +  +++  ++ V++ V+ GL   G + +         D+P 
Sbjct: 129 MTDARAKVLGVLRDYGGLAFTLKEIAESAGVTTSVVKGLVKLGAVSE--------EDAPR 180

Query: 192 LYFSLPILD--------KNQQDVVEQVVPLCTKG--FAVSLISGVTGSGKTEVYLEIVAA 241
                P LD         N Q V  +++    +   +  +L+ GVTGSGKTEVYLE VA 
Sbjct: 181 -DVPYPRLDPDRGGKELTNDQAVGAKILSEAVRSGTYGTTLLKGVTGSGKTEVYLEAVAE 239

Query: 242 VLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVI 301
            L  G+Q L+LLPEI+LT+  L R + RFG KPAEWHS ++ + R + WR V +G   +I
Sbjct: 240 CLRQGRQALVLLPEIALTAEFLTRVEARFGCKPAEWHSGVTMTERRRCWRMVGQGDAQLI 299

Query: 302 VGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPS 361
           VG RSALFLPF+ LGL+V+DEEHD SYKQE+G+LYNARDM+++R  + +  VVL SATPS
Sbjct: 300 VGARSALFLPFRDLGLVVVDEEHDTSYKQEDGVLYNARDMTVLRASLNAAQVVLASATPS 359

Query: 362 IESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARN 421
           +ES  N  + +Y  V L++RY  + LP +  IDMR + +  G+ +SP +   +   L R 
Sbjct: 360 LESWANVEAGKYARVTLASRYGAAVLPKMSAIDMRIEDLPGGRWVSPTLQKMVEARLERG 419

Query: 422 EQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVV 481
           EQ+LLFLNRRGYAP+T+C+ CG+++ C  C   +VEHR  K+L CHQCG +      C  
Sbjct: 420 EQSLLFLNRRGYAPVTICRACGHQIGCDDCDATMVEHRFLKRLMCHQCGETKPMPTVCPS 479

Query: 482 CGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIII 541
           C +  K+   G G+ER+AEE    FP AR+++LSSDL G    L+  + +IA+GE D+I+
Sbjct: 480 CEAVDKLAPVGPGVERMAEEAQALFPDARVAVLSSDLYGSARALKEHIQSIARGETDVIV 539

Query: 542 GTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQ 601
           GTQLVAKGHNFP+++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR  +    ++Q
Sbjct: 540 GTQLVAKGHNFPKLTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAEIAGEAVLQ 599

Query: 602 AYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL- 660
            +QP HPV++A++ GD ++F+ +E   R +  +PP+GR+A +++S    QEV +    + 
Sbjct: 600 TFQPEHPVIRAILGGDEEAFWTAEAAERRAAGVPPYGRMAGIVLSSPNVQEVFDLGTQMA 659

Query: 661 KEHAP-RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNAL 719
           +   P R     V+GPA +P+  +RGR+R RLL+  ++++ LQ      +    K    L
Sbjct: 660 RMDGPLRKIGAQVYGPAPAPIARIRGRHRVRLLVKAEKSAPLQQALV-AWAAQFKLRGEL 718

Query: 720 RVQFDIDPQNF 730
           R+  DIDPQ+F
Sbjct: 719 RMAIDIDPQSF 729


>gi|89069293|ref|ZP_01156656.1| primosomal protein N' [Oceanicola granulosus HTCC2516]
 gi|89045169|gb|EAR51237.1| primosomal protein N' [Oceanicola granulosus HTCC2516]
          Length = 751

 Score =  565 bits (1455), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 299/726 (41%), Positives = 438/726 (60%), Gaps = 19/726 (2%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q +  P  Y  P       G+ V VPL  R V+G+VW   +  +  D  ++RP+
Sbjct: 33  VGVLTTQPLGRPLDYKAPEG-GCWAGAFVEVPLGPRKVVGVVWGPGQGDF--DRARVRPV 89

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV--SALSETEKMEEKIQFTGIFPRI 133
             V D  P+S  M +F+   ADYT +P+  + R+     AL ET  M    +     P  
Sbjct: 90  SRVLDVAPMSDAMRQFLARAADYTLTPLPAMLRLATRNPALGETPAMRTIYRLGDALPDR 149

Query: 134 NTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP- 190
            T AR +VL  +++  G  +   +L   + V + V+ GL AQG ++   E  +P  D P 
Sbjct: 150 MTAAREKVLAVLEEYEGLSFTLGELAEMAGVGTGVVKGLVAQGAVR---EEEAPR-DGPY 205

Query: 191 ---NLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
              +       L  +QQ     +      G +  +L+ GVTGSGKTEVYLE VA  L  G
Sbjct: 206 PPLDPDHGGKALTPDQQAGAAALRAGVRSGRYGTTLLRGVTGSGKTEVYLEAVAECLRAG 265

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           +Q L+LLPEI+L++  L R + RFG +PAEWHS L+T+ R + W+ +  G   ++VG RS
Sbjct: 266 RQALVLLPEIALSAEFLARVEARFGARPAEWHSGLTTTERRRAWKMIGEGQAQMVVGARS 325

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLPF+ LGL+V+DEEHD SYKQE+G+LYNARDM+++R  +    VVL SATPS+ES  
Sbjct: 326 ALFLPFRDLGLVVVDEEHDTSYKQEDGVLYNARDMAVLRASMADAQVVLASATPSLESWA 385

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N  + +Y  + L++R+  + +P +  IDMR + +     +SP +   +   L R EQ LL
Sbjct: 386 NVEAGKYARLDLTSRFGPAVMPAMAAIDMRVEDLPGASWISPALQGAVHGRLERGEQALL 445

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRGYAP+T+C+ CG+++ C  C   +VEHR  K+L CHQCG +    ++C  C ++G
Sbjct: 446 FLNRRGYAPVTICRACGHQIGCTQCDARMVEHRFLKRLMCHQCGETRPMPETCPSCEAAG 505

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
           K+   G G+ER+AEE    FP AR++ILSSDL G    L+ ++  IA G  DI+IGTQLV
Sbjct: 506 KLAPVGPGVERLAEETERLFPDARLAILSSDLYGSARALKAKIEEIASGGADIVIGTQLV 565

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR       L+Q +QP 
Sbjct: 566 AKGHNFPELTLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRAEAPGEALLQTFQPE 625

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEH-AP 665
           HPV++A++ GD ++F+ +E   R +  +PP+GR+A +++S    Q+  +   +L  H AP
Sbjct: 626 HPVIRAILGGDEEAFWAAEAAERRAAGVPPYGRMAGIVLSSPDVQQAFDLGNHLARHDAP 685

Query: 666 -RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFD 724
            R     VFGPA +P+  +RGR+R RLL+   +++ +Q   ++ +   ++     R+  D
Sbjct: 686 LRRIGAQVFGPAPAPIARIRGRHRVRLLVKADKSAPIQAALAE-WTAQVRLRGETRMAID 744

Query: 725 IDPQNF 730
           IDPQ+F
Sbjct: 745 IDPQSF 750


>gi|254441744|ref|ZP_05055237.1| primosomal protein N', putative [Octadecabacter antarcticus 307]
 gi|198251822|gb|EDY76137.1| primosomal protein N', putative [Octadecabacter antarcticus 307]
          Length = 730

 Score =  565 bits (1455), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 299/717 (41%), Positives = 438/717 (61%), Gaps = 29/717 (4%)

Query: 30  YSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMC 89
           Y  P      LG+ V VPL  R VLG+VW     K   D  K+R +  V D  P++ +M 
Sbjct: 26  YKAPEG-GCHLGAFVEVPLGPRKVLGVVW--GAGKGDFDYKKVRSVIRVLDVAPMADEMR 82

Query: 90  EFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRINTVARLRVLDKIKD 147
           +F+   ADYT +PM  + R+   A  L +   M +  +     P   T AR +VL  ++D
Sbjct: 83  KFLIKAADYTLTPMNAMLRLATRAPGLGDAPSMRKVYRLGSDEPTRMTDARAKVLGVLRD 142

Query: 148 --GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKN--- 202
             G  +  +++  ++ V++ V+ GL   G + +         D+P      P LD +   
Sbjct: 143 YGGLAFTLKEIAESAGVTTSVVKGLVKLGAVSE--------EDAPR-DVPYPRLDPDHGG 193

Query: 203 QQDVVEQVV-------PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPE 255
           +Q   +Q V        + +  +  +L+ GVTGSGKTEVYLE VA  L  G+Q L+LLPE
Sbjct: 194 KQLTSDQAVGAKILSEAVRSGTYGTTLLKGVTGSGKTEVYLEAVAECLRAGRQALVLLPE 253

Query: 256 ISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKL 315
           I+LT+  L R + RFG KPAEWHS ++ + R + WR V +G   +IVG RSALFLP++ L
Sbjct: 254 IALTAEFLTRVEARFGCKPAEWHSGVTMTERRRCWRMVGQGDAQLIVGARSALFLPYRNL 313

Query: 316 GLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHS 375
           GLIV+DEEHD SYKQE+G+LYNARDM+++R  + +  VVL SATPS+ES  N  + +Y  
Sbjct: 314 GLIVVDEEHDTSYKQEDGVLYNARDMTVLRASLNAAQVVLASATPSLESWANVEAGKYAR 373

Query: 376 VHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAP 435
           V L++RY  + LP +  IDMR + +  G+ +SP +   + + L + EQ+LLFLNRRGYAP
Sbjct: 374 VTLASRYGAAVLPKMSAIDMRIEDLPGGRWVSPTLQKMVENRLEKGEQSLLFLNRRGYAP 433

Query: 436 LTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGI 495
           +T+C+ CG+++ C  C   +VEHR  K+L CHQCG +      C  C +  K+   G G+
Sbjct: 434 VTICRACGHQIGCDDCDATMVEHRFLKRLMCHQCGETKPMPTVCPSCEAVDKLAPVGPGV 493

Query: 496 ERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRM 555
           ER+AEE    FP AR+++LSSDL G    L+  + AIA+GE D+I+GTQLVAKGHNFP++
Sbjct: 494 ERMAEEAQALFPDARVAVLSSDLYGTARALKEHIQAIARGEADVIVGTQLVAKGHNFPKL 553

Query: 556 SLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVS 615
           +LVGV+D DLGL  +DLR++ERTFQL+ QV GRAGR  +    ++Q +QP HPV++A++ 
Sbjct: 554 TLVGVIDADLGLQGSDLRAAERTFQLMRQVAGRAGRADIAGEAVLQTFQPEHPVIRAILG 613

Query: 616 GDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-KEHAP-RSSDIVVF 673
           GD ++F+ +E   R +  +PP+GR+A +++S    QEV +    + +   P R     V+
Sbjct: 614 GDEEAFWAAEAGERRAAGVPPYGRMAGIVLSSPNVQEVFDLGTQMARMDGPLRKIGAQVY 673

Query: 674 GPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           GPA +P+  +RGR+R RLL+  ++++ LQ      +    K    LR+  DIDPQ+F
Sbjct: 674 GPAPAPIARIRGRHRVRLLVKAEKSAPLQQALV-AWAAQFKLRGELRMAIDIDPQSF 729


>gi|295691142|ref|YP_003594835.1| primosomal protein N' [Caulobacter segnis ATCC 21756]
 gi|295433045|gb|ADG12217.1| primosomal protein N' [Caulobacter segnis ATCC 21756]
          Length = 719

 Score =  564 bits (1454), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 310/719 (43%), Positives = 424/719 (58%), Gaps = 11/719 (1%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +LL   +   + Y+ P  + +++G  V VPL  R + G+V   +       +  L+ ++ 
Sbjct: 7   VLLPMPLPEAFDYAEPEGLDLKVGDHVAVPLGPRVIRGVV--TALRDGTGGNRPLKAVQG 64

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQ-FTGIFPRINTV 136
             D PPL   +  FV W A Y+    G    M +  L       +K+   TG+ P   T 
Sbjct: 65  KVDDPPLPPGVLTFVDWAARYSVDVPGWPLAMALRGLRHPPPKPDKVLVLTGVQPARMTP 124

Query: 137 ARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSL 196
           ARL+VL   +  K+     L  A+ VS+ V+ GL  +G +   F  + P    P    SL
Sbjct: 125 ARLKVLAAAEGTKL-SSSALASAAGVSAGVVKGLVDEGALAADF--VEPQRGLPQPDLSL 181

Query: 197 P--ILDKNQQDVVEQV-VPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK-QVLIL 252
           P   L+  Q   VE +   L   GF  +L+ GVTGSGKTEVYLE VA  L   + QVL+L
Sbjct: 182 PPRALNPGQAACVEVLKAMLDAGGFQAALLDGVTGSGKTEVYLEAVAEALKDPEAQVLVL 241

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           LPEI+LT A++ RF++RFG  PAEWHS +S   R ++W  VA G   ++VG RSALFLP+
Sbjct: 242 LPEIALTQAVMARFEQRFGAVPAEWHSGVSPPRRRQVWEAVANGDARIVVGARSALFLPY 301

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
           +KL L+V+DEEHD S+KQEEG +Y ARD+++ R KIE   V+L SATPS+ES  N  + R
Sbjct: 302 RKLRLLVVDEEHDGSFKQEEGFIYQARDLAVARAKIEGASVLLASATPSLESLYNAQTGR 361

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  + LS R+  + LP + +IDMR      G+ LSP +I  +  TL R EQ +LFLNRRG
Sbjct: 362 YRWLRLSARHGAAQLPDIDLIDMRQTPPEPGRWLSPPLIKAMAVTLQRGEQAMLFLNRRG 421

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPL LC+ CG ++K      WLVEHR   +L CH  G S    ++C  CG+   +++ G
Sbjct: 422 YAPLVLCRACGEKMKSPDTDSWLVEHRYTGRLVCHLTGFSMKKPEACPHCGAKDSLVSIG 481

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ER+ EE    FP AR+++ SSD        +  ++++A GEIDI++ TQ  AKGHNF
Sbjct: 482 PGVERVEEEARHIFPDARVAVFSSDTVMDAEAARTLVASMAAGEIDILVATQAAAKGHNF 541

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LVGVVD DL L   DLR+ ERTFQLL+Q  GRAGR       L+Q Y P H VMQA
Sbjct: 542 PNLTLVGVVDADLSLRGGDLRAGERTFQLLAQAAGRAGRHEKPGRALLQTYAPDHAVMQA 601

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           L + D D+F E+E+  R+   LPPFGRLAA+I SG     +E Y   L    P +  + V
Sbjct: 602 LAAQDRDAFVEAEMAMRQEAGLPPFGRLAALIASGPDAAALEAYVEALAAVIPNAEGVEV 661

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           FGPA++PL +VRGR R R L+  +RN +LQGF +     T K  N++RV  D+DP +FL
Sbjct: 662 FGPADAPLSLVRGRRRKRFLVRAERNVDLQGFMAAWRART-KIPNSVRVVIDVDPYSFL 719


>gi|209542781|ref|YP_002275010.1| primosome assembly protein PriA [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530458|gb|ACI50395.1| primosomal protein N' [Gluconacetobacter diazotrophicus PAl 5]
          Length = 759

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 314/733 (42%), Positives = 429/733 (58%), Gaps = 18/733 (2%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVEL---GSIVRVPLRSRTVLGIVW---------YNSE 62
           RV +LL     GP+ Y+ P  +       G IV VPL  RT  G+VW         +   
Sbjct: 29  RVAVLLPLPFPGPFDYAAPPDLPAPPLQPGDIVTVPLGRRTETGVVWDPERNLPPEFTPP 88

Query: 63  EKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEE 122
               +   +L+P+    D PPL   +  FV WVA YT SP GLV  M +   +  +    
Sbjct: 89  PMKSVADGRLKPVIARLDQPPLPASLRRFVDWVAAYTLSPPGLVLAMALRTGTAAQAAPA 148

Query: 123 KIQFTGIFPR--INTVARLRVLD-KIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQI 179
                   P    +T AR RVLD    DG +    +L R + V + V+ GL   G ++ +
Sbjct: 149 LGWAVADPPPGLRDTPARRRVLDIAAHDGPL-TAAELARRAGVGTSVVRGLADAGALRGV 207

Query: 180 FEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEI 238
                P    P+     P LD  Q +    +  L  +G F+V+L+ GVTGSGKTE+Y+E 
Sbjct: 208 TMTPRPAFVRPDPDHCPPALDGEQAESARALRALAAEGGFSVTLLEGVTGSGKTEIYMEA 267

Query: 239 VAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAI 298
           +AA L  GKQV++LLPEI+L+S    RF +RFG +PA WHS L   +R   W  VA G  
Sbjct: 268 IAACLARGKQVMVLLPEIALSSQWTGRFARRFGAEPALWHSDLGPRLRRVTWHAVADGTA 327

Query: 299 SVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSA 358
            V+VG RSALFLPF +LGLI++DEEH+ ++KQE+G+ Y+ARDM++VR +++  PVVLVSA
Sbjct: 328 RVVVGARSALFLPFAELGLIIVDEEHETAFKQEDGVTYHARDMAVVRARMDRAPVVLVSA 387

Query: 359 TPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTL 418
           TPS+E+  N  + RY  + L+ R+  + +P ++ IDMR     +G  LSP + + IR  +
Sbjct: 388 TPSLETLANVGAGRYRHLVLTARHGGATMPEVRTIDMRAHPPERGLFLSPVLTEAIRQAI 447

Query: 419 ARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQS 478
            R EQ +LFLNRRGYAPLTLC+ CG+RL+C +C+ WLVEHR+++ L CH CG+      +
Sbjct: 448 GRGEQGMLFLNRRGYAPLTLCRTCGHRLQCPNCTAWLVEHRARQILTCHHCGYQEATPPA 507

Query: 479 CVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEID 538
           C  C +   +   G G+ERI EE    FP ARI +++SD   G       ++ IA+ EID
Sbjct: 508 CPECHAESSLTPIGPGVERITEEARATFPDARILVMASDTLPGPAATADAVARIARREID 567

Query: 539 IIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLG 598
           ++IGTQ+VAKG +FP ++LVGVVD DLGL   DLR++ERT QLL QV GRAGR       
Sbjct: 568 LVIGTQIVAKGWHFPHLTLVGVVDADLGLGGGDLRAAERTVQLLHQVAGRAGRAEAPGTV 627

Query: 599 LIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY 658
           L+Q+Y P HPVM ALVSGD +SF   E   R     PPFGRLAA+I+S    +  +  A 
Sbjct: 628 LLQSYTPDHPVMLALVSGDFESFMRQEAEQRRPGFWPPFGRLAALIVSADTPEAADATAR 687

Query: 659 NLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNA 718
            L + APR   + V GPA +PL ++RGR+R RLL+  +R   +Q    Q  D       A
Sbjct: 688 ALGQAAPRGDSLQVLGPAPAPLAILRGRHRRRLLLRTRREVAVQPLLRQWLDRVTPERGA 747

Query: 719 LRVQFDIDPQNFL 731
            R+  DIDP +FL
Sbjct: 748 -RIDIDIDPVSFL 759


>gi|167644212|ref|YP_001681875.1| primosome assembly protein PriA [Caulobacter sp. K31]
 gi|167346642|gb|ABZ69377.1| primosomal protein N' [Caulobacter sp. K31]
          Length = 724

 Score =  564 bits (1453), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 313/724 (43%), Positives = 425/724 (58%), Gaps = 20/724 (2%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +LL   +   + Y+ P  + + +G  V VPL  R + G+V   +       +  L+P+  
Sbjct: 11  VLLPMPLPEAFDYAEPEGLGLAVGDHVTVPLGPRVIRGVV--TALRDGTGGNRPLKPVLE 68

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETE-KMEEKIQFTGIFPRINTV 136
             D PPL   +  F+ W A Y+    G    M +  L     K ++ +  TG  P   T 
Sbjct: 69  RVDDPPLPPGVLTFIDWAARYSVDIPGWPLAMALRGLRHPPAKPDKALALTGTQPARMTP 128

Query: 137 ARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSL 196
           ARL+VL   + G +     L   + VS+ V+ GL  +G +   +  I P    P    SL
Sbjct: 129 ARLKVLAAAEQGPM-ASGALAALAGVSAGVVKGLVDEGALAVTW--IEPDTSFPQPNLSL 185

Query: 197 P--ILDKNQQ---DVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK--QV 249
           P   L+ +QQ   DV+ ++  L   GF  +L+ GVTGSGKTEVYLE VAA L   +  QV
Sbjct: 186 PPQTLNPSQQASADVLAEM--LAAGGFQAALLDGVTGSGKTEVYLEAVAAALAADEHSQV 243

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           LILLPEI+LT A++ RF++RFGV P EWHS +S   R + W  VA G   ++VG RSALF
Sbjct: 244 LILLPEIALTQAVIARFEQRFGVAPVEWHSGVSPPKRRRAWEGVATGQARIVVGARSALF 303

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
           LPFK L L+V+DEEHD S+KQEEG +Y ARD+++ R KIE   VVL SATPS+ES  N  
Sbjct: 304 LPFKALRLVVVDEEHDGSFKQEEGFIYQARDLAVARAKIEGALVVLASATPSLESLWNAQ 363

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
             RY  + LS R+  + LP + +IDMR      G+ LSP ++  +   L+R EQ+LLFLN
Sbjct: 364 QGRYRWLRLSARHGAAQLPDIDLIDMRETPPEPGRWLSPPLVKAVSLALSRGEQSLLFLN 423

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAPL LC+ CG ++K      WLVEHR   +L CH  G S     +C  CG+   ++
Sbjct: 424 RRGYAPLVLCRACGEKMKSPDTDSWLVEHRYTGRLVCHLTGFSMKKPDACPHCGAKDSLV 483

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSD--LEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           + G G+ER+ EE    FP AR+++ SSD  ++  G R  ++  ++  GEIDI++ TQ  A
Sbjct: 484 SIGPGVERVEEEARHLFPDARVAVFSSDTVVDAAGARALVE--SMEAGEIDILVATQAAA 541

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP ++LVGVVD DL L   DLR+ ERTFQLL+Q  GRAGR       L+Q Y P H
Sbjct: 542 KGHNFPNLTLVGVVDADLSLRGGDLRAGERTFQLLAQAAGRAGRHEKPGRALLQTYAPEH 601

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS 667
            V+QAL + D D+F E+E+  R    LPPFGRLAAVI SG     +E Y   L    P +
Sbjct: 602 GVLQALKAQDRDAFVEAEMAMRREAGLPPFGRLAAVIASGPDAAALEAYCQALAAATPNA 661

Query: 668 SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDP 727
             + VFGPA++PL +VRGR R R L+   R+ +LQGF +  +    K  N++RV FD+DP
Sbjct: 662 DGVEVFGPADAPLALVRGRRRKRFLVRADRSVDLQGFLA-AWRARAKVPNSVRVVFDVDP 720

Query: 728 QNFL 731
            +FL
Sbjct: 721 YSFL 724


>gi|16124601|ref|NP_419165.1| primosome assembly protein PriA [Caulobacter crescentus CB15]
 gi|221233290|ref|YP_002515726.1| primosome assembly protein PriA [Caulobacter crescentus NA1000]
 gi|13421497|gb|AAK22333.1| primosomal protein N' [Caulobacter crescentus CB15]
 gi|220962462|gb|ACL93818.1| primosomal protein N' [Caulobacter crescentus NA1000]
          Length = 719

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 312/721 (43%), Positives = 426/721 (59%), Gaps = 15/721 (2%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +LL   +   + Y+ P  + + +G  V VPL  R + G+V   +       +  L+P+  
Sbjct: 7   VLLPMPLPEAFDYAEPEGLALAVGDHVTVPLGPRVIRGVV--TALRDGTGGNRPLKPVLE 64

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQ-FTGIFPRINTV 136
             D PPL      FV+W A Y+    G    M +  L       +K+   TG+ P   T 
Sbjct: 65  RVDDPPLPPGALAFVEWAARYSVDVPGWPLAMALRGLRHPPPKPDKVLVLTGVQPARVTP 124

Query: 137 ARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSL 196
           ARL+V+    +G       L  A+ VS+ V+ GL  +GV+   F  + P    P    SL
Sbjct: 125 ARLKVM-AAAEGTKLSGAALASAAGVSAGVVKGLVDEGVLAVDF--VEPERGLPQPDLSL 181

Query: 197 PI--LDKNQQ---DVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK-QVL 250
           P   L+  Q    DV++ +  L + GF  +L+ GVTGSGKTEVYLE VA  L   + QVL
Sbjct: 182 PARALNPGQAACVDVLKDM--LESGGFQAALLDGVTGSGKTEVYLEAVAEALKDPETQVL 239

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           +LLPEI+LT A++ RF++RFG  PAEWHS +S   R ++W  VA G   ++VG RSALFL
Sbjct: 240 VLLPEIALTQAVMARFEQRFGALPAEWHSGVSPPRRRQVWEAVAGGNARIVVGARSALFL 299

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PF+KL LIV+DEEHD S+KQEEG +Y ARD+++ R KIE   V+L SATPS+ES  N  +
Sbjct: 300 PFRKLRLIVVDEEHDSSFKQEEGFIYQARDLAVARAKIEGASVLLASATPSLESLYNAQT 359

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            RY  + LS R+  + LP + ++DMR      G+ LSP +I  +  TL R EQ +LFLNR
Sbjct: 360 GRYRWLRLSARHGAAQLPDIGLVDMRQTPPEPGRWLSPPLIKAMAVTLQRGEQAMLFLNR 419

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPL LC+ CG ++K      WLVEHR   +L CH  G S    ++C  CG+   +++
Sbjct: 420 RGYAPLVLCKACGEKMKSPDTDSWLVEHRYTGRLVCHLTGFSMKKPEACPHCGAKDSLVS 479

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G+ER+ EE    FP AR+++ SSD        +  +S++A GEIDI++ TQ  AKGH
Sbjct: 480 IGPGVERVEEEARHIFPDARVAVFSSDTVMDAEGAKALVSSMAAGEIDILVATQAAAKGH 539

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           NFP ++LVGVVD DL L   DLR+ ERTFQLL+Q  GRAGR       L+Q Y P H VM
Sbjct: 540 NFPNLTLVGVVDADLSLRGGDLRAGERTFQLLAQAAGRAGRHEKPGRALLQTYAPDHAVM 599

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
           +AL + D D+F E+E+  RE   LPPFGRLAAVI SG     ++ Y   L    P +  +
Sbjct: 600 RALAAQDRDAFVEAEMAMREDAGLPPFGRLAAVIASGPDGAALDAYVEALAAVIPNAEGV 659

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            VFGPA++PL +VRGR R R L+  +RN +LQGF +  +    K  N++RV  D+DP +F
Sbjct: 660 EVFGPADAPLALVRGRRRKRFLVRAERNVDLQGFMAA-WRARAKVPNSVRVVIDVDPYSF 718

Query: 731 L 731
           L
Sbjct: 719 L 719


>gi|162148141|ref|YP_001602602.1| primosome assembly protein PriA [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786718|emb|CAP56301.1| putative primosomal protein N [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 770

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 314/733 (42%), Positives = 429/733 (58%), Gaps = 18/733 (2%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVEL---GSIVRVPLRSRTVLGIVW---------YNSE 62
           RV +LL     GP+ Y+ P  +       G IV VPL  RT  G+VW         +   
Sbjct: 40  RVAVLLPLPFPGPFDYAAPPDLPAPPLQPGDIVTVPLGRRTETGVVWDPERNLPPEFTPP 99

Query: 63  EKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEE 122
               +   +L+P+    D PPL   +  FV WVA YT SP GLV  M +   +  +    
Sbjct: 100 PMKSVADGRLKPVIARLDQPPLPASLRRFVDWVAAYTLSPPGLVLAMALRTGTAAQAAPA 159

Query: 123 KIQFTGIFPR--INTVARLRVLD-KIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQI 179
                   P    +T AR RVLD    DG +    +L R + V + V+ GL   G ++ +
Sbjct: 160 LGWAVADPPPGLRDTPARRRVLDIAAHDGPL-TAAELARRAGVGTSVVRGLADAGALRGV 218

Query: 180 FEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEI 238
                P    P+     P LD  Q +    +  L  +G F+V+L+ GVTGSGKTE+Y+E 
Sbjct: 219 TMTPRPAFVRPDPDHCPPALDGEQAESARALRALAAEGGFSVTLLEGVTGSGKTEIYMEA 278

Query: 239 VAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAI 298
           +AA L  GKQV++LLPEI+L+S    RF +RFG +PA WHS L   +R   W  VA G  
Sbjct: 279 IAACLARGKQVMVLLPEIALSSQWTGRFARRFGAEPALWHSDLGPRLRRVTWHAVADGTA 338

Query: 299 SVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSA 358
            V+VG RSALFLPF +LGLI++DEEH+ ++KQE+G+ Y+ARDM++VR +++  PVVLVSA
Sbjct: 339 RVVVGARSALFLPFAELGLIIVDEEHETAFKQEDGVTYHARDMAVVRARMDRAPVVLVSA 398

Query: 359 TPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTL 418
           TPS+E+  N  + RY  + L+ R+  + +P ++ IDMR     +G  LSP + + IR  +
Sbjct: 399 TPSLETLANVGAGRYRHLVLTARHGGATMPEVRTIDMRAHPPERGLFLSPVLTEAIRQAI 458

Query: 419 ARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQS 478
            R EQ +LFLNRRGYAPLTLC+ CG+RL+C +C+ WLVEHR+++ L CH CG+      +
Sbjct: 459 GRGEQGMLFLNRRGYAPLTLCRTCGHRLQCPNCTAWLVEHRARQILTCHHCGYQEATPPA 518

Query: 479 CVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEID 538
           C  C +   +   G G+ERI EE    FP ARI +++SD   G       ++ IA+ EID
Sbjct: 519 CPECHAESSLTPIGPGVERITEEARATFPDARILVMASDTLPGPAATADAVARIARREID 578

Query: 539 IIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLG 598
           ++IGTQ+VAKG +FP ++LVGVVD DLGL   DLR++ERT QLL QV GRAGR       
Sbjct: 579 LVIGTQIVAKGWHFPHLTLVGVVDADLGLGGGDLRAAERTVQLLHQVAGRAGRAEAPGTV 638

Query: 599 LIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY 658
           L+Q+Y P HPVM ALVSGD +SF   E   R     PPFGRLAA+I+S    +  +  A 
Sbjct: 639 LLQSYTPDHPVMLALVSGDFESFMRQEAEQRRPGFWPPFGRLAALIVSADTPEAADATAR 698

Query: 659 NLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNA 718
            L + APR   + V GPA +PL ++RGR+R RLL+  +R   +Q    Q  D       A
Sbjct: 699 ALGQAAPRGDSLQVLGPAPAPLAILRGRHRRRLLLRTRREVAVQPLLRQWLDRVTPERGA 758

Query: 719 LRVQFDIDPQNFL 731
            R+  DIDP +FL
Sbjct: 759 -RIDIDIDPVSFL 770


>gi|294085407|ref|YP_003552167.1| primosomal protein N' [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664982|gb|ADE40083.1| Primosomal protein N' (replication factor Y) - superfamily II
           helicase [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 755

 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 305/712 (42%), Positives = 416/712 (58%), Gaps = 23/712 (3%)

Query: 34  SAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVK 93
           SA  +  G+IV VP   R V GIV          +  KL+ I  V   P L+     F++
Sbjct: 53  SAAGISRGTIVTVPFGGRLVTGIVMGAGAGGVAPE--KLKAIHAVAPLPTLNEAFISFIE 110

Query: 94  WVADYTFSPMGLVARMVVSALSETEKMEEKIQFT--GIFP---RINTVARLRVLDKIKDG 148
            VA +T +P+G VA+MV+S     ++  +   FT   I P   RI T AR +VLD + D 
Sbjct: 111 RVAAWTLAPIGAVAKMVLSQPQALQRPPQTTLFTPAKIMPDGVRI-TPARQQVLDVLGDA 169

Query: 149 KIWEKRDLIRASQVSSHVIDGLKAQGVIKQI-----FEVISPVVDSPNLYFSLPILDKNQ 203
                 +L R + V S VI  +    ++  +          P  D P+L      L   Q
Sbjct: 170 GAMTAAELARIANVGSGVISAMAKADMLTAMQVSADRPPPPPQTDRPSL-----TLTGEQ 224

Query: 204 QDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAIL 263
           Q   + +V  C  GF   L+ GVTGSGKTEVY E V AVL  GKQVLILLPEI+L+S   
Sbjct: 225 QAAADIMVAACGTGFHPFLLDGVTGSGKTEVYFEAVKAVLDAGKQVLILLPEIALSSGWR 284

Query: 264 ERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEE 323
            RF +RFGV P EWHS +  S + K WR V  G   ++VG RSALFLPF  LGLI++DEE
Sbjct: 285 SRFARRFGVAPVEWHSDIGNSQKRKAWRYVLSGEAKLVVGARSALFLPFSNLGLIIVDEE 344

Query: 324 HDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN----GISRRYHSVHLS 379
           H+ +YKQE+  +Y ARDM++VR  I+  P++L SATPS+ES VN    G + RY  + L 
Sbjct: 345 HEHAYKQEDQTIYQARDMAVVRAHIQKCPIILASATPSLESWVNAGKTGETPRYQHIGLP 404

Query: 380 TRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLC 439
            R + +ALP +  ID+R     +G+ L+P +++ I   LA  EQ+LLFLNRRGYAPLTLC
Sbjct: 405 NRIKGAALPAMSAIDLRQTPPERGRWLAPPLVEAIATRLAAGEQSLLFLNRRGYAPLTLC 464

Query: 440 QVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIA 499
             CG++L C +C  W+V H+   +L CH CGH    S  C  CG    M ACG G+ER+A
Sbjct: 465 GSCGHKLVCPNCDSWMVAHKLSGQLRCHHCGHQTRPSNHCSACGQDDTMQACGPGVERLA 524

Query: 500 EEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVG 559
           EEV   FP AR ++LSSD  G        + ++ +G++DIIIGTQ+VAKGH+FP ++LVG
Sbjct: 525 EEVLWRFPDARFAVLSSDTVGTPKAADAFIQSVIEGDVDIIIGTQMVAKGHHFPNLTLVG 584

Query: 560 VVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDAD 619
           VVD DLGL   DLR++ERTFQ+LSQV GRAGR       ++Q   P + V+  L+ G  D
Sbjct: 585 VVDADLGLAGGDLRAAERTFQMLSQVAGRAGRESRPGEAMLQTLDPENQVLTCLLEGKRD 644

Query: 620 SFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESP 679
           +F   E  AR    +PPFG+LAA+I+S    + +      L +  P  + + +FGPA +P
Sbjct: 645 AFLAMEAHARSLAGMPPFGQLAALILSSHDEKRLHATLRRLDQSRPHFTGVDIFGPAIAP 704

Query: 680 LFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           +  ++GR+R RLLI   R+ ++QG       +  K  + +++  DIDP NFL
Sbjct: 705 IGFLKGRHRGRLLIRTDRSVDIQGILRDWLAD-FKPDSGVKLHIDIDPYNFL 755


>gi|330993162|ref|ZP_08317099.1| Primosomal protein N' [Gluconacetobacter sp. SXCC-1]
 gi|329759713|gb|EGG76220.1| Primosomal protein N' [Gluconacetobacter sp. SXCC-1]
          Length = 754

 Score =  561 bits (1446), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 309/734 (42%), Positives = 440/734 (59%), Gaps = 20/734 (2%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVEL-GSIVRVPLRSRTVLGIVW---------YNSEE 63
           +RV ++L    +GP  Y++P  +   + G IV VPL  RT  G++W         +    
Sbjct: 25  ARVRVMLTLPFAGPLDYTLPPRLAGAMPGDIVTVPLGRRTETGVIWDATSRLPPEFTPPP 84

Query: 64  KYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV--SALSETEKME 121
           +  + + +L+P+    D PPL  Q+  FV WVA YT SP G+V  M +  +AL+   +  
Sbjct: 85  QKDVPTSRLKPVAARLDLPPLPAQLRRFVDWVAAYTLSPPGMVLAMALRANALAPLPRPA 144

Query: 122 EKIQFTGIFP---RINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQ 178
                    P   R+ T AR +VL+           +L R + V + VI GL   G +  
Sbjct: 145 TGWIAAPTVPSGLRL-TPARQKVLELATTA--LPTAELARRAGVGAAVIRGLAQAGALTA 201

Query: 179 IFEVISPVVDSPNLYFSLPILDKNQQDVVEQV-VPLCTKGFAVSLISGVTGSGKTEVYLE 237
           +  +  P    P+     P L+  Q +V  Q+   +   GF+++L+ GVTGSGKTE+Y+E
Sbjct: 202 VEILPPPPFALPDPAHCPPQLEGEQAEVAAQLRARVDENGFSITLLEGVTGSGKTEIYME 261

Query: 238 IVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGA 297
            +AA +  G+Q L+LLPEI+L++    RF +RFG +PA WHS L   +R   WR VA G 
Sbjct: 262 AIAACVAAGRQALVLLPEIALSAQWTGRFARRFGAEPALWHSDLGARLRRVTWRAVADGT 321

Query: 298 ISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVS 357
             V+VG RSALFLPF +LGLI++DEEH+ ++KQE+G+ Y+ARDM++VR ++   P+VLVS
Sbjct: 322 ARVVVGARSALFLPFDQLGLIIVDEEHETAFKQEDGVTYHARDMAVVRARMSQAPIVLVS 381

Query: 358 ATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHT 417
           ATPS+ES  N  + RY  + L+ R+ N+++P ++ +DMR     +G  LSP +   I   
Sbjct: 382 ATPSLESLANVGAGRYRHLKLNARHGNASMPDVETLDMRADPPERGLFLSPMLTGAINDA 441

Query: 418 LARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQ 477
           + R EQ +LFLNRRGYAPLTLC+ CG+R++C +C+ WLVEHR++  L CH CG+     Q
Sbjct: 442 IGRGEQAMLFLNRRGYAPLTLCRTCGHRMQCPNCTAWLVEHRARHILTCHHCGYDEPIPQ 501

Query: 478 SCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEI 537
           +C  C  +  +   G G+ERI EE    FP ARI +++SD   G       +  IA+ EI
Sbjct: 502 TCPKCADADSLTPIGPGVERITEEARATFPDARILVMASDTLNGPAATAAAVERIARREI 561

Query: 538 DIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSL 597
           D++IGTQ+VAKG +FP ++LVG+VD DLGL   DLR+SERT QLL QV GRAGR      
Sbjct: 562 DLVIGTQIVAKGWHFPHLTLVGIVDADLGLGGGDLRASERTVQLLHQVAGRAGRAEAPGR 621

Query: 598 GLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYA 657
            L+Q+Y P HPVMQALVSGD  SF + E   R     PP+GRLAAVI+S       +  A
Sbjct: 622 VLLQSYVPDHPVMQALVSGDFASFMQQEAEQRRPGFWPPYGRLAAVIVSAEAPDAADLTA 681

Query: 658 YNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSN 717
             L ++APR   + V GPA +PL ++RGR+RFRLL+  +RN  +Q    + + + +K   
Sbjct: 682 RALGQNAPRLDGVQVLGPAPAPLAILRGRHRFRLLLRARRNIAVQPIMRE-WLSRVKPER 740

Query: 718 ALRVQFDIDPQNFL 731
             R+  DIDP +FL
Sbjct: 741 GARIDVDIDPVSFL 754


>gi|296532592|ref|ZP_06895297.1| DNA replication factor Y [Roseomonas cervicalis ATCC 49957]
 gi|296267083|gb|EFH13003.1| DNA replication factor Y [Roseomonas cervicalis ATCC 49957]
          Length = 741

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 290/653 (44%), Positives = 408/653 (62%), Gaps = 12/653 (1%)

Query: 25  SGPYIYSVPSAMKVEL--GSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCP 82
           +G Y Y VP++       G+ V VPL  R+++G+VW + E    +   +LR +  VFD P
Sbjct: 13  AGAYDYRVPASWPEPPPPGAFVEVPLSGRSMVGVVW-DGEADPNLPEKRLRDMLGVFDVP 71

Query: 83  PLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKI--QFTGIFPRIN------ 134
           P+++ + +FV WVA YT SP G V RM +SA +  E    K   + +    R        
Sbjct: 72  PMTQSLRKFVDWVAAYTLSPPGAVLRMAMSAPAALEPPSAKAGWRLSAAGQRAKRGEAKL 131

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           T AR +VLD ++ G +     +   + VSS V+ G+   G+++           SP++  
Sbjct: 132 TPARRQVLDVLEPGDVQSAAAIAAEAGVSSGVVRGMAEAGLLESALLPAGESFFSPDIDR 191

Query: 195 SLPILDKNQQDVVEQVVPLCT-KGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
             P+L   QQ V   +      K F V+L++GVTGSGKTEVYLE VA  +  G+Q L+LL
Sbjct: 192 PGPVLGAEQQAVAAALRQATAAKSFGVTLLTGVTGSGKTEVYLEAVAECVAQGRQALVLL 251

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI+L++  LERF++RFG  PA WHS L +  R   WR VA G ++ +VG RSALFLP+ 
Sbjct: 252 PEIALSTQWLERFERRFGGPPALWHSELGSRRRRDTWRAVAEGRVAALVGARSALFLPYP 311

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LGLI++DEEH+ ++KQEEG++Y+ARDM++VR ++     VLVSATPS+E+  N  + RY
Sbjct: 312 DLGLIIVDEEHETAFKQEEGVVYHARDMAVVRARLSQAACVLVSATPSLETLTNAETGRY 371

Query: 374 HSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGY 433
            S+HL  R+  +ALP + VID R     +G+ LS  ++  +R TLA  +Q +LFLNRRGY
Sbjct: 372 ASLHLPERHGGAALPAVTVIDQRRTPPERGRFLSSPLVTAVRETLAAGQQAMLFLNRRGY 431

Query: 434 APLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGF 493
           APLTLC+ CG+RL+C +C+ WLVEHR ++ L CH CGH+    ++C  CG+ G +   G 
Sbjct: 432 APLTLCRSCGHRLRCPNCTAWLVEHRVRRTLQCHHCGHTESIPENCPECGAEGSLTPLGP 491

Query: 494 GIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFP 553
           G+ER+ EE  + FP AR  +++SD   G         AIA  E+D+IIGTQ+VAKG +FP
Sbjct: 492 GVERVQEEAAQLFPEARRLVMASDTIPGPAAAAEAARAIAAREVDLIIGTQIVAKGWHFP 551

Query: 554 RMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQAL 613
            ++LVGVVD DLGL   DLR++ERT QLL QV GRAGR       L+Q++ P HPV++AL
Sbjct: 552 HLTLVGVVDADLGLAGGDLRAAERTVQLLHQVAGRAGRAEAPGRVLLQSWNPEHPVLEAL 611

Query: 614 VSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR 666
           VSGD D+F ++E   R   + PPFGRLAA+I+S    +E +  A +L   APR
Sbjct: 612 VSGDLDAFMQAEAEGRRPGHWPPFGRLAALIVSAEDEREADRVARDLGLAAPR 664


>gi|163792315|ref|ZP_02186292.1| Primosomal protein N' (replication factor Y) - superfamily II
           helicase [alpha proteobacterium BAL199]
 gi|159182020|gb|EDP66529.1| Primosomal protein N' (replication factor Y) - superfamily II
           helicase [alpha proteobacterium BAL199]
          Length = 733

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 310/725 (42%), Positives = 434/725 (59%), Gaps = 10/725 (1%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR 73
            RV +LL   + GPY Y    A+ +  G++V VPL  R + G+V     +   +   +LR
Sbjct: 12  DRVSVLLPLPLDGPYDYKADPALGLGRGAVVEVPLGKRRMTGVVLGPGGDD--VAEERLR 69

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGI---- 129
            +   FD PP+   + + V WVA +T +P G V RM +S+    E     +  T +    
Sbjct: 70  GVIRSFDVPPIPDSVLDLVDWVAAWTLAPRGSVLRMAISSPGALEPPPSSVVLTSVSEVA 129

Query: 130 FPRIN--TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVV 187
           +P     T AR RVL  + DG   E +DL R + V   VI  +   G++ +      P  
Sbjct: 130 WPPNTRMTPARRRVLAVLSDGPALEPKDLAREAAVGPSVIKSMADAGLLDRHELAPPPPF 189

Query: 188 DSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
            +P+   S   L   Q+   + +    T G F+V+ + GVTGSGKTEVY E +A  L  G
Sbjct: 190 KAPDPNRSGHPLTGEQEIAADALRRAVTAGAFSVAALDGVTGSGKTEVYFEAIATALTAG 249

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           +Q L+LLPEI+L++  LERF+ RFGV+PA WHS L   +R + WR VA G   V+VG RS
Sbjct: 250 RQALVLLPEIALSAQWLERFEARFGVQPAVWHSDLKPKVRRETWRAVAEGTARVLVGARS 309

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLPF +LGLIV+DEEH+ +YKQE+G+ Y ARDM++VR ++E  PV L+SATPS+E+  
Sbjct: 310 ALFLPFHELGLIVVDEEHEPAYKQEDGVAYQARDMAVVRARLEEVPVALISATPSLETLE 369

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N    RY  +HL+ R  ++ LP +++ID+R     +G+ L+P ++  +  TLA  EQ LL
Sbjct: 370 NVRGGRYQGLHLAARPGSATLPSVEMIDLRRDRPDRGRFLAPGLVRAVEQTLADGEQVLL 429

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRGYAPLTLC+ CG RL+C +C+ WLVEHR   KL CH CG S    + C  C +  
Sbjct: 430 FLNRRGYAPLTLCRGCGYRLECPNCTAWLVEHRLLGKLQCHHCGFSGRLPRQCPSCEAED 489

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
             +A G G+ER+AEEV   FP AR  I SSD   G  +    + A+   E+D+I+GTQ+V
Sbjct: 490 SFVASGPGVERLAEEVLSRFPDARFQIASSDTIVGPDQAAEFVRAVNAREVDVIVGTQIV 549

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGH+FP ++LVGVVD DLGL   DLR+ ERT+Q+L QV GRAGR       L+Q + P 
Sbjct: 550 AKGHHFPWLTLVGVVDADLGLAGGDLRAGERTYQMLHQVAGRAGRADRPGRVLMQTHVPE 609

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR 666
           +PVM AL +GD D F + E   R    +PPFGRLA +++S    Q  +  A  +   APR
Sbjct: 610 NPVMAALAAGDRDRFLDYETEQRREAGMPPFGRLAGLVVSAPDPQRADAAARAIARAAPR 669

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
              ++V GPA +PL ++RGR+R RLL+  ++  NLQ      +   I+  NA+R+  D+D
Sbjct: 670 LDGVMVLGPAPAPLALLRGRHRRRLLVKARKEINLQRVLRD-WLAPIRLENAVRLSIDVD 728

Query: 727 PQNFL 731
           P +F+
Sbjct: 729 PYSFM 733


>gi|114797126|ref|YP_760597.1| primosome assembly protein PriA [Hyphomonas neptunium ATCC 15444]
 gi|114737300|gb|ABI75425.1| primosomal protein N' [Hyphomonas neptunium ATCC 15444]
          Length = 732

 Score =  555 bits (1430), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 302/737 (40%), Positives = 422/737 (57%), Gaps = 33/737 (4%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSL------- 70
           IL    +  P+ Y+VP  M ++ GS V  P+     LGIV         +D L       
Sbjct: 6   ILFTLPLPEPFDYAVPEGMTLQPGSYVAAPVGPHDRLGIV---------VDVLGDDVATG 56

Query: 71  -KLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSE--TEKMEEKIQFT 127
            KL+ +  V+D PP+   M EF+ WVA YT +  G V  M + A        +E + + T
Sbjct: 57  RKLKTVTAVYDAPPMGAPMREFLAWVARYTVTHPGQVLAMALRAREGLLPSPVETRYRAT 116

Query: 128 GIFPRINTVARLRVL----------DKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIK 177
           G  P   T AR +VL          D  ++ ++W   DL  A+ VSS V+ GL   GV++
Sbjct: 117 GKLPDRMTPARQKVLEVSRTVPNCPDLSRNDQLWSAVDLASAANVSSGVVKGLAEAGVLE 176

Query: 178 QIFEVISPVVDSPNLYFSLPILDKNQQDVVEQV-VPLCTKGFAVSLISGVTGSGKTEVYL 236
            +     P    P+      +L   Q     ++   +   GF+  L+ GVTGSGKTEVY 
Sbjct: 177 AVELETDPSFAIPDPDRKGAVLTGEQAVAAGELKAAIHAGGFSAFLLDGVTGSGKTEVYF 236

Query: 237 EIVAAVLHLGK--QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVA 294
           E +A  L      Q+L+LLPEI+LT AIL RF+ RFG  PA WHS LS   R + WR+  
Sbjct: 237 EAIAETLKSDPEAQILVLLPEIALTQAILARFEARFGAAPAPWHSGLSPKDRRRTWREAV 296

Query: 295 RGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVV 354
            G   +++G RSALFLP++KL LI++DEEHD S+KQE+G+ Y+ARD++++R K+E   V+
Sbjct: 297 HGRARIVIGARSALFLPYRKLRLIIVDEEHDTSFKQEDGVTYHARDLAVMRAKLEGGQVI 356

Query: 355 LVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGI 414
           L SATP++E+ VN  + RY  + L+ R   S LP ++++D+R     +GK LSP +   +
Sbjct: 357 LASATPALETAVNAEAGRYVHLRLAARPGASRLPDIELVDLRTAPPGKGKWLSPVLERAL 416

Query: 415 RHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAI 474
             TLA  EQ+LLFLNRRGYAPL +C+ CG RLK      WL EHR   +L CH  G+S  
Sbjct: 417 METLANGEQSLLFLNRRGYAPLVICKACGERLKTPGTENWLTEHRYSGRLVCHVTGYSIP 476

Query: 475 YSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAK 534
               C  CG+   ++  G G+ER+AEEV    P ARI I SSD   G    +  +  + +
Sbjct: 477 KPTKCPQCGAPDSLMGVGPGVERVAEEVRTLLPHARIEIFSSDTAQGADVTRSLVERMER 536

Query: 535 GEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGL 594
            EID++IGTQ+VAKGHNFP ++LVGVVD D GL   DLR+ ERT+QLLSQV GRAGR   
Sbjct: 537 SEIDVMIGTQIVAKGHNFPNLTLVGVVDADSGLKGGDLRAGERTYQLLSQVAGRAGRAER 596

Query: 595 KSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVE 654
               L+Q Y P +P M+AL + D D F + E   R  + LPPFGRLAA+I+S      V+
Sbjct: 597 PGRALVQTYAPDNPAMEALAANDRDGFLQIERDVRSELVLPPFGRLAAMILSAPSADLVD 656

Query: 655 NYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIK 714
             A ++   AP    I VFGPA +P+ ++RGR+R R L+   R  +L  + +  +   ++
Sbjct: 657 KAALDIAAAAPNGDGIEVFGPAPAPITVLRGRHRRRFLVKSPRIIDLSAYMAA-WTARLR 715

Query: 715 RSNALRVQFDIDPQNFL 731
             + +R+  DIDP +FL
Sbjct: 716 LPSQVRISIDIDPYSFL 732


>gi|296114851|ref|ZP_06833499.1| primosome assembly protein PriA [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978557|gb|EFG85287.1| primosome assembly protein PriA [Gluconacetobacter hansenii ATCC
           23769]
          Length = 782

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 309/732 (42%), Positives = 435/732 (59%), Gaps = 17/732 (2%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYN---------SEEKY 65
           RV ++L    +G   Y +P A  +  G IV VPL  RT  G+VW                
Sbjct: 53  RVRVMLPLPFAGALDYRMPPAGTLHPGDIVTVPLGRRTETGVVWDTHLRLPPEFMPPPMP 112

Query: 66  KIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLV--ARMVVSALSETEKMEEK 123
            + + +LR +    D PPL   + +F+ WVA YT SP G+V    +  +A++   +    
Sbjct: 113 TVATGRLRAVSARLDLPPLPAALRQFIDWVAAYTLSPPGMVLAMALRANAMAAAPRPAAG 172

Query: 124 IQFTGIFP---RINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIF 180
              T   P   R+ T AR RVL+  + G      +L   + V + V+ GL   G ++++ 
Sbjct: 173 WAVTDTLPPDLRL-TPARHRVLEIARLGTPLSTTELANRAGVGASVVRGLVQAGCLREVA 231

Query: 181 EVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIV 239
               P    P+   + P+L+  Q DV   +     +  F+++L+ GVTGSGKTE+Y+E +
Sbjct: 232 LPTPPAFGMPDPTHAPPVLEGEQADVARALRNTVAEDRFSITLLEGVTGSGKTEIYMEAI 291

Query: 240 AAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAIS 299
           AA L  G Q L+LLPEI+L+S    RF +RFG +PA WHS L T +R   WR VA GA  
Sbjct: 292 AACLEKGLQALVLLPEIALSSQWTGRFARRFGTQPALWHSDLGTRLRRVTWRSVADGAAR 351

Query: 300 VIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSAT 359
           V+VG RSALFLPF +LGLI++DEEH+ S+KQEEG+ YNARDM++VR ++++ P+VLVSAT
Sbjct: 352 VVVGARSALFLPFARLGLIIVDEEHETSFKQEEGVTYNARDMAVVRARMDAAPIVLVSAT 411

Query: 360 PSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLA 419
           PS+E+  N  + RY  + L  R+ N+++P ++ +DMR     +G  LSP +   IR  + 
Sbjct: 412 PSLETLANVGAGRYRHLRLGARHGNASMPQVRTLDMRADPPERGLFLSPVLTGAIRDAIG 471

Query: 420 RNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSC 479
           R EQ +LFLNRRGYAPLTLC+ CG+R++C +C+ WLVEHR++  L CH CGH+     +C
Sbjct: 472 RQEQAMLFLNRRGYAPLTLCRTCGHRMQCPNCTAWLVEHRARHILTCHHCGHNEQMPPAC 531

Query: 480 VVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDI 539
             C +   +   G G+ERI EE    FP ARI +++SD   G       +  IA+ EID+
Sbjct: 532 PSCNAEDSLTPIGPGVERITEEARATFPDARILVMASDTLHGPAATADAVERIARREIDL 591

Query: 540 IIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGL 599
           +IGTQ+VAKG +FP +++VG+VD DLGL   DLR++ERT QLL QV GRAGR       L
Sbjct: 592 VIGTQIVAKGWHFPHLTVVGIVDADLGLGGGDLRAAERTVQLLHQVAGRAGRAEAAGHVL 651

Query: 600 IQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYN 659
           +Q+Y P HPVM+ALVSGD  SF E E   R     PPFGRL A+I+S    +  +  A  
Sbjct: 652 LQSYVPDHPVMEALVSGDFTSFMEQEAEQRRPGFWPPFGRLVALIVSADTPEAADMTARA 711

Query: 660 LKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNAL 719
           L   AP    + V GPA +PL ++RGR+R RLL+  +RN  +Q    + + + +K     
Sbjct: 712 LGHAAPHLDGVQVLGPAPAPLAILRGRHRQRLLLRARRNIPVQPIMRE-WLSRVKPERGA 770

Query: 720 RVQFDIDPQNFL 731
           RV  DIDP +FL
Sbjct: 771 RVDVDIDPISFL 782


>gi|17986530|ref|NP_539164.1| primosomal protein N' [Brucella melitensis bv. 1 str. 16M]
 gi|17982135|gb|AAL51428.1| primosomal protein n' [Brucella melitensis bv. 1 str. 16M]
          Length = 462

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/437 (60%), Positives = 323/437 (73%)

Query: 295 RGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVV 354
           R    V+ G RSALFLPFK+LGLIV+DEEHD +YKQE+ + YNARDM++VRG I SFPVV
Sbjct: 26  REQCGVVAGARSALFLPFKELGLIVVDEEHDPAYKQEDRVFYNARDMAVVRGHIGSFPVV 85

Query: 355 LVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGI 414
           L SATPSIES+VN    RY  + L  RY  +ALP L+ IDMR      G+ LSP + + +
Sbjct: 86  LASATPSIESQVNAEQGRYKRIKLYGRYAEAALPDLKTIDMRRSPPPPGRFLSPALTEAV 145

Query: 415 RHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAI 474
             T+ R EQ LLFLNRRGYAPLTLC+VCG+R +C  CS WLVEHR + +L CHQCG+   
Sbjct: 146 GKTVERGEQALLFLNRRGYAPLTLCRVCGHRFQCPQCSSWLVEHRFRGQLMCHQCGYHEP 205

Query: 475 YSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAK 534
             Q+C  CG+   ++ACG G+ERIAEEV   F  ARI +LSSD+ GG  RL+L+L AIAK
Sbjct: 206 VPQACPECGTLDHLVACGPGVERIAEEVAATFNDARIIVLSSDMAGGVKRLRLELDAIAK 265

Query: 535 GEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGL 594
           GE DI+IGTQLVAKGHNFP M+LVGVVD DLGL N D R++ERTFQLL+QVTGRAGR G 
Sbjct: 266 GEADIVIGTQLVAKGHNFPNMTLVGVVDADLGLANGDPRAAERTFQLLNQVTGRAGRTGR 325

Query: 595 KSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVE 654
           KSLGLIQ YQP HPVM+A+VSGDAD+FY  EI  RE  NL PFGRLAA+IIS     + E
Sbjct: 326 KSLGLIQTYQPDHPVMRAIVSGDADAFYAREIEERERSNLSPFGRLAALIISADNRPDAE 385

Query: 655 NYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIK 714
           N+A  L+  AP S +I V GPAE+PL +VRGR+RFR+L+HG + +++QGF   +     K
Sbjct: 386 NHARALRRCAPSSREISVLGPAEAPLALVRGRHRFRILVHGTKRADIQGFIRALLAAAPK 445

Query: 715 RSNALRVQFDIDPQNFL 731
              ++RVQ DIDPQ+FL
Sbjct: 446 EKGSIRVQVDIDPQSFL 462


>gi|197106793|ref|YP_002132170.1| primosomal protein N' [Phenylobacterium zucineum HLK1]
 gi|196480213|gb|ACG79741.1| primosomal protein N' [Phenylobacterium zucineum HLK1]
          Length = 719

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 300/708 (42%), Positives = 417/708 (58%), Gaps = 9/708 (1%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQ 87
           + Y  P  M +  G  V VPL  R + G+V    +       LK   +    D PPL   
Sbjct: 17  FDYEAPEGMALAPGDQVAVPLGPRLMRGVVAAIRDGHGGNRPLKQ--VAERLDEPPLPPG 74

Query: 88  MCEFVKWVADYTF-SPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIK 146
             EFV+W A Y+  +P   +A  +  A +   K    ++ TG  P   T AR +VL+   
Sbjct: 75  ALEFVQWAARYSVDAPGQPLAIALRGARAPKPKPVRMLEATGRAPGRTTPARTKVLEAAT 134

Query: 147 DGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDV 206
            G +    DL RA+ VS+ V+ GL  +G + +         D P+L      L+ +Q   
Sbjct: 135 -GPM-TAADLARAAGVSAGVVKGLLDEGCLAERLVTEDAAFDPPDLARKGSELNASQAAS 192

Query: 207 VEQVVPLC-TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK--QVLILLPEISLTSAIL 263
              +  +    GF+V+L+ GVTGSGKTEVYLE  AA L      QVLILLPEI+LT A++
Sbjct: 193 AGALADMVRAGGFSVALLDGVTGSGKTEVYLEAAAAALAADPEAQVLILLPEIALTQAVI 252

Query: 264 ERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEE 323
            R   RFG +P EWHS ++   R ++W  VA G   ++VG RSALFLPF+KL LIV+DEE
Sbjct: 253 ARVTHRFGARPGEWHSDVAPPARRRVWEAVASGTCRIVVGARSALFLPFRKLRLIVVDEE 312

Query: 324 HDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYR 383
           HD S+KQE+G +Y  RD+++ RGKIE   VVL SATPS+E+  N  + RY  + LS R+ 
Sbjct: 313 HDSSFKQEDGFIYQGRDLAVARGKIEGAAVVLASATPSLETLRNAEAGRYRWLRLSARHG 372

Query: 384 NSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCG 443
            + LP +++ID++      G+ LSP ++  +  T  R EQTLLFLNRRGYAPL LC+ CG
Sbjct: 373 TARLPDIELIDLKATPPEHGRWLSPPLVAAMAETYGRGEQTLLFLNRRGYAPLVLCRACG 432

Query: 444 NRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVC 503
            R+       WLVEHR   +L CH  G S     +C  CG+   +++ G G+ER+ EE  
Sbjct: 433 ERMTAPDTDSWLVEHRYSGRLVCHLTGFSMPKPSACPHCGAKDSLVSIGPGVERVEEEAR 492

Query: 504 EYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDG 563
           + FP ARI++ SSD        +  + A+A G+IDI++ TQ  AKGHNFP+++LVGVVD 
Sbjct: 493 QLFPQARIAVFSSDTVFDAREARRLVEAMAAGDIDILVATQAAAKGHNFPKLTLVGVVDA 552

Query: 564 DLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYE 623
           DLGL   DLR++ERT+QLL+Q TGRAGR       L+Q Y P HPVMQAL + D D+F E
Sbjct: 553 DLGLRGGDLRAAERTYQLLAQATGRAGRKDRPGRALLQTYAPEHPVMQALKAQDRDAFVE 612

Query: 624 SEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMV 683
           +E+  RE+  LPPFGRLAAVI SG    +++ +   + + AP +  + V+GPA++PL +V
Sbjct: 613 AEMAEREAAGLPPFGRLAAVIASGPDAAQLDAFTQAMAQAAPNTPGVEVYGPADAPLGLV 672

Query: 684 RGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           RGR R R L+   R  +L  + +  +   ++    +RV  DIDP +FL
Sbjct: 673 RGRRRKRFLVRADRGVDLSAYMA-AWRARVRPPGQIRVAIDIDPYSFL 719


>gi|114328724|ref|YP_745881.1| primosome assembly protein PriA [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316898|gb|ABI62958.1| primosomal protein N' [Granulibacter bethesdensis CGDNIH1]
          Length = 747

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 308/738 (41%), Positives = 435/738 (58%), Gaps = 25/738 (3%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSL---- 70
           R+ ++L     GP+ Y+VP  +  + G IV VPL  R  +G+VW  +       S     
Sbjct: 14  RLQVMLPYPFPGPFDYAVPPDLAPQPGDIVLVPLNRREEVGVVWDEATPPAGAASTQSSA 73

Query: 71  ---------KLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV--VSALSETEK 119
                    +L+P+  V D PPL   +  F+ WVA YT SP G V  M   ++AL   E+
Sbjct: 74  GSGRHVPDHRLKPLLAVLDAPPLPAPLRRFIDWVAGYTLSPPGEVMAMALRINAL-RPER 132

Query: 120 MEEKIQFTGIFP---RINTVARLRVLDKIKDGKIWEKRDLIRA-SQVSSHVIDGLKAQGV 175
               +Q     P   R+ T AR +V+  + DG     + +     ++SS V+  + +QG+
Sbjct: 133 AVTGLQLVASPPEGIRL-TEARRQVMALLADGTPMTSQAVREHLPEISSAVLRNMVSQGL 191

Query: 176 IKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQV-VPLCTKGFAVSLISGVTGSGKTEV 234
           ++Q+  V       P   F++P L  +Q +V E +   +    F+V+L+ GVTGSGKTEV
Sbjct: 192 LEQVPMVRPSRYGVPESAFTVPDLSADQAEVAESLREAVRAHTFSVTLLEGVTGSGKTEV 251

Query: 235 YLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVA 294
           YLE +A  L  G+Q LILLPEI+L++  L+RF++RFGV+PA WHS LS+  R + WR V 
Sbjct: 252 YLEAIAEALTCGRQTLILLPEIALSTQWLDRFRRRFGVEPAIWHSDLSSLTRRQCWRAVT 311

Query: 295 RGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVV 354
            G   V+VG RSALFLPF  LGL+V+DEEH+ ++KQE+GI+Y+ARDM++VR + E    +
Sbjct: 312 SGEAKVVVGARSALFLPFSNLGLVVVDEEHETAFKQEDGIIYHARDMAVVRARFEQAASL 371

Query: 355 LVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGI 414
           LVSATPS+E+  N  S RY  + L  R+  + LP +  ID+R     +   LSP ++  I
Sbjct: 372 LVSATPSLETLANVESGRYRRLSLRARHGVARLPSVTAIDLRSHPPERNHFLSPPLVTAI 431

Query: 415 RHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAI 474
           R    R EQ +LFLNRRGYAPLTLC+ CG R++C HC+ WLVEHR +++L CH CGH   
Sbjct: 432 RQAFERGEQAMLFLNRRGYAPLTLCRACGTRMQCPHCTAWLVEHRLRRQLICHHCGHEEP 491

Query: 475 YSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAK 534
              SC  CG+   + A G G+ERI EE    FP AR+ +++SD   G          +A 
Sbjct: 492 VHLSCPSCGAEHALTAIGPGVERITEEAATLFPGARVLVMASDTLPGPAAAAEAAGRVAA 551

Query: 535 GEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGL 594
            E+D++IGTQ+VAKG NFP ++ VGVVD DLGL   DLR+SERT QLL QV GRAGR   
Sbjct: 552 REVDLLIGTQIVAKGWNFPHLTCVGVVDADLGLGGGDLRASERTVQLLHQVAGRAGRAEA 611

Query: 595 KSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVE 654
                +Q++ P HP +QAL++ D  +F E E   R     PP GRLAA+I+S       +
Sbjct: 612 PGHVFLQSWNPDHPAIQALLNNDFAAFMEGESEIRRIGYWPPHGRLAALIVSADDAATAD 671

Query: 655 NYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ-MYDNTI 713
             A +L  +AP    I V GPA +PL ++RGR+R RLL+  +R   +Q    + + + T+
Sbjct: 672 RLALDLARNAPDGDGIWVLGPAPAPLAVLRGRHRRRLLLRTRRTIAVQPILRRWLQEMTV 731

Query: 714 KRSNALRVQFDIDPQNFL 731
            R    R++ D+DP +FL
Sbjct: 732 PRGA--RIEIDVDPVSFL 747


>gi|83944762|ref|ZP_00957128.1| primosomal protein N' [Oceanicaulis alexandrii HTCC2633]
 gi|83851544|gb|EAP89399.1| primosomal protein N' [Oceanicaulis alexandrii HTCC2633]
          Length = 710

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 297/711 (41%), Positives = 425/711 (59%), Gaps = 12/711 (1%)

Query: 27  PYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSR 86
           P+ Y+VP  ++V+ G  V  PL  R+  G+VW    +     S KL+ ++ +   PPLS 
Sbjct: 6   PFDYAVPEGVRVKPGDHVLAPLGKRSAPGVVWDVGPDD---GSRKLKTLDDLRGGPPLSA 62

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALS--ETEKMEEKIQFTG-IFPRINTVARLRVLD 143
            M EFV W A Y   P G+V R V+ +    +    E     TG I  R+ T AR  VLD
Sbjct: 63  PMREFVDWAARYLVEPPGVVLRAVLRSPGALKPSPTETLYHPTGQILARL-TPARRAVLD 121

Query: 144 KIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQ 203
             ++G      +L R + VSS V+ GL   G ++     + P  ++P+ Y     L+  Q
Sbjct: 122 AAQEGPA-SAAELARRAGVSSSVVKGLADAGGLRAEEAPVDPPFETPDPYREGVELNAVQ 180

Query: 204 QDVVEQVVPL-CTKGFAVSLISGVTGSGKTEVYLEIVAAVL--HLGKQVLILLPEISLTS 260
            +    +  L    GF  +L+ GVTGSGKTEVY E +A ++      Q+L+LLPEI+LT 
Sbjct: 181 AEAAASLRRLVAAGGFQAALLDGVTGSGKTEVYFEAIAELMRREPEAQILVLLPEIALTQ 240

Query: 261 AILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVI 320
           A+ +RF+ RFGV+PA WHS L+   R + WR+VA G   ++ G RS++FLPF  L  IV+
Sbjct: 241 AVTKRFRDRFGVEPALWHSGLADKDRRRTWREVASGRARIVAGARSSIFLPFTHLRGIVV 300

Query: 321 DEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLST 380
           DEEHD +YKQ+E + YNARD+++ R K++    +L SATPS+ES VN  + RY  V L +
Sbjct: 301 DEEHDPTYKQDENLTYNARDLAVARAKLQGAACILASATPSLESLVNAEAGRYVHVVLPS 360

Query: 381 RYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQ 440
           R   + LP ++++D+R     +G+ LSP +   +  TLAR EQ +L+LNRRG+APL LC+
Sbjct: 361 RAGGAVLPDIELLDLRVSPPEKGEWLSPPLHKAVAETLARGEQAMLYLNRRGFAPLVLCK 420

Query: 441 VCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAE 500
            CG+++K      WLVEHR   +L CH  G S    + C  CG +  +I  G G+ER+AE
Sbjct: 421 ACGHKMKSPEADRWLVEHRYTGRLVCHVTGFSMPKPKHCPECGEADSLIGVGPGVERVAE 480

Query: 501 EVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGV 560
           E  + FP AR+ + SSD    G  ++  +  +  GEIDI++GTQ+ AKGHNFP ++LVGV
Sbjct: 481 EARQRFPEARVEVFSSDTAQTGDDVRSIVQRMEDGEIDILVGTQIAAKGHNFPHLTLVGV 540

Query: 561 VDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADS 620
           VD DLGL   DLR+ ERT+Q L Q  GRAGR       ++Q + P H  +QAL +GD D+
Sbjct: 541 VDADLGLAGGDLRAGERTYQTLVQAAGRAGRADRPGRAILQTWNPEHEALQALANGDRDA 600

Query: 621 FYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPL 680
           F  +E   RE + LPPFGRLAA+I+SG    ++++    +   AP S  + VFGPAE+PL
Sbjct: 601 FLAAERSMREILGLPPFGRLAALIVSGPDPAQLDDACLAIARAAPVSEGVQVFGPAEAPL 660

Query: 681 FMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            +VRGR+R R L+   RN ++  F  + +   IK  +A+RV  DI+P +FL
Sbjct: 661 GVVRGRWRRRFLVQAPRNVDVSAFM-RAWMGRIKPPSAVRVVLDIEPYSFL 710


>gi|254417835|ref|ZP_05031559.1| primosomal protein N' [Brevundimonas sp. BAL3]
 gi|196184012|gb|EDX78988.1| primosomal protein N' [Brevundimonas sp. BAL3]
          Length = 720

 Score =  545 bits (1404), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 299/719 (41%), Positives = 425/719 (59%), Gaps = 9/719 (1%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +L+   V   + Y  P  M +  G  V VPL  R + G+V    E      + +L+ +E 
Sbjct: 6   VLIPLPVPEAFDYEAPEGMTLARGDQVAVPLGPRLIRGVVAEVFETTGS--NRRLKSVES 63

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSAL-SETEKMEEKIQFTGIF-PRINT 135
             D P L   + +FV+W   +T SP G +A   +  L +   K E +++  G   P   T
Sbjct: 64  RLDDPALPAGVMDFVEWAGRWTLSPPGEMAATALKGLRAPRPKPERRVRRVGDRQPARAT 123

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
            AR  VL+ + + +     DL RA+ VSS ++ GL  +GV++ I        + P+   +
Sbjct: 124 PARTGVLEALGE-RAMAGADLARAAGVSSGLVKGLIDEGVLEIIEIAAEAAFERPDPDHA 182

Query: 196 LPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLH--LGKQVLIL 252
              L+ +Q      +    T G F   L+ GVTGSGKTE YLE +A VL      Q+LIL
Sbjct: 183 PATLNGDQAAAASALAAGVTGGGFRPFLLDGVTGSGKTEAYLEAIARVLRSDPAAQILIL 242

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           LPEI+LT A++ER   RFG  PAEWHS ++   R ++W  V  G  +++VG RSALFLPF
Sbjct: 243 LPEIALTQALIERITARFGAAPAEWHSGVAPPRRRQVWEAVVAGRCNIVVGARSALFLPF 302

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
             L LIV+DEEHD S+KQEEG++Y+ RD+++ R +IE   VVL SATPS+E+  N  + R
Sbjct: 303 VDLRLIVVDEEHDSSFKQEEGLVYHGRDLAVARARIEGAAVVLASATPSLETLWNAQAGR 362

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  + L  R+  + +P ++++D+R  T      LS  +   +  TLAR EQTLLFLNRRG
Sbjct: 363 YDWLKLGARHGVAVMPDIELLDLRQHTPDPQTWLSQPLRTAVAETLARGEQTLLFLNRRG 422

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAP+ LC+VCG+RL       WLVEHR   +L CH  G S    + C  CG+   +++ G
Sbjct: 423 YAPVVLCRVCGHRLTAPDTDSWLVEHRYTGRLVCHLTGFSMARPKLCPSCGAEDSLVSVG 482

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ER+ EEV + FP AR ++ SSD        +  +  +  GEIDI++ TQ  AKGHNF
Sbjct: 483 PGVERVEEEVRQLFPEARTAVFSSDTAPDAKSARALIQRMTDGEIDILVATQAAAKGHNF 542

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           PR++LVGVVD DLGL   DLR++ERT+QLL+Q TGRAGR       ++Q + P HPV+ A
Sbjct: 543 PRLTLVGVVDADLGLRGGDLRAAERTYQLLAQATGRAGRADRPGRAILQTWTPEHPVLMA 602

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           L +GD D+F E+E+  RE+  LPPFGRLAA+I+S      VE  A +L +  P +  + V
Sbjct: 603 LAAGDRDAFVEAEMAEREAAALPPFGRLAAIILSSENAAAVEKVAADLAQAIPNAERLEV 662

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           +GPA++PL +VRGR R RLL+   R+ NLQ F  + +   +K   ++R+  D+DP +FL
Sbjct: 663 YGPADAPLALVRGRRRKRLLVRADRDVNLQAFL-RAWLARVKVPASVRLTVDVDPYSFL 720


>gi|329847601|ref|ZP_08262629.1| primosomal protein N [Asticcacaulis biprosthecum C19]
 gi|328842664|gb|EGF92233.1| primosomal protein N [Asticcacaulis biprosthecum C19]
          Length = 736

 Score =  545 bits (1404), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 306/724 (42%), Positives = 426/724 (58%), Gaps = 18/724 (2%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +++L  V     Y+VP  M + +G  V VPL    V G+V     E   ID   L+PI  
Sbjct: 21  VVVLAPVPEALDYAVPDGMDIAIGDHVVVPLGHAKVRGLVIGLIREA--ID-FPLKPILS 77

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF--TGIFPRINT 135
             D PP+      F  W A++T +P G      + AL +  + + ++ +  TGI P   T
Sbjct: 78  KPDDPPVPENSLHFWLWAANWTVTPPGTFLNGCLRAL-KVARAQVRLGYVRTGIEPARIT 136

Query: 136 VARLRVLDK-IKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
            AR RV++  I    + E   L  A+ VS  V+ GL  +GV++++       +  P+  F
Sbjct: 137 KARERVIETAILPMGLGE---LALAAGVSEGVVTGLAKEGVLEKVALPFDDRIPQPDPDF 193

Query: 195 SLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHL--GKQVLIL 252
           +   L+ +Q    + +     KGFA  L+ GVTGSGKTEVYLE VA VL      QVLIL
Sbjct: 194 APARLNPSQSAAHQLLQMEMAKGFAPVLLDGVTGSGKTEVYLESVADVLRADPAAQVLIL 253

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           LPEI+LT A+L R + RFGV+ A+WH+++  S R +IW  VA G I ++VG RSALFLP+
Sbjct: 254 LPEIALTQAVLGRLKARFGVEVAQWHANIGNSSRRRIWEGVATGKIRLVVGARSALFLPY 313

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
            +LGLIVIDEEHD SYKQEEG+ Y+ARD+++ R +++   VV+ SATPS+E+  N    R
Sbjct: 314 VRLGLIVIDEEHDSSYKQEEGVRYHARDLAVFRARMDGAMVVMASATPSLETLTNAEKER 373

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS-----LSPEMIDGIRHTLARNEQTLLF 427
           Y  + L  R+  + LP +++IDM+     +G+      LS  ++  +  TL R EQ LLF
Sbjct: 374 YTWIRLEKRHGTAVLPDIELIDMKAHAPGKGQKNEQMWLSDILVAEVWETLKRREQVLLF 433

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRGYAPL LC+ CG ++   +   WLVEHRS  +L CH  G S    + C  C +   
Sbjct: 434 LNRRGYAPLVLCKACGEKMSAPNTDSWLVEHRSSGRLVCHLTGFSMRKPKICPHCKAVDS 493

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           +++ G G+ERI EEV   FP AR  + SSD           +  I   +IDI+I TQ  A
Sbjct: 494 LVSVGPGVERILEEVQSRFPDARAEVFSSDTVPDAASSAALIRRIEDHDIDIVIATQAAA 553

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP ++LVG+VD DLGL   DLR++ERTFQLL Q TGRAGR       L+Q Y P H
Sbjct: 554 KGHNFPNLTLVGIVDADLGLKGGDLRAAERTFQLLQQATGRAGRSVKPGKALLQTYTPEH 613

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS 667
           PVMQAL   D ++FY  E  +RE    PP+GRLAA+I+     + ++ ++  L    P +
Sbjct: 614 PVMQALAHQDREAFYAYEGMSREMAGFPPYGRLAALILQAKDQKLLDRFSRELALFIPNT 673

Query: 668 SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDP 727
             I V+GPA++PL +VRG++R R L+   RN +LQGF +  +   IKR NA+R+  DI+P
Sbjct: 674 DGIDVYGPADAPLALVRGQWRKRFLVRADRNRDLQGFVNH-WLAAIKRPNAIRLIVDIEP 732

Query: 728 QNFL 731
            +FL
Sbjct: 733 YSFL 736


>gi|58039204|ref|YP_191168.1| primosome assembly protein PriA [Gluconobacter oxydans 621H]
 gi|58001618|gb|AAW60512.1| Primosomal replication factor Y, primosomal protein N'
           [Gluconobacter oxydans 621H]
          Length = 746

 Score =  542 bits (1397), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 307/739 (41%), Positives = 430/739 (58%), Gaps = 33/739 (4%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE---------K 64
           +RV +L+     GP  Y  P  + +E G +V VPL  R  +G VW               
Sbjct: 20  TRVSVLVPLPFPGPLDYLAP--IPLEPGDLVTVPLGRRETVGCVWETDRTLPADFALPVG 77

Query: 65  YKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV---------SALS 115
            ++   +LRP+    D  PL + +  F+ WVA YT +P GLV  M            AL 
Sbjct: 78  REVPLARLRPVIGKLDVRPLPQSLRRFIDWVAAYTLTPPGLVLAMATRIHLKDAPKPALG 137

Query: 116 --ETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQ 173
              TE  E  ++ T         AR  VL+      +    +L   S  S+ VI GL + 
Sbjct: 138 WVRTEMPEGDLRIT--------PARRSVLNFASSTPM-TTAELGSRSGASAAVIRGLASA 188

Query: 174 GVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKT 232
           G++++    ++    +P+     P L + Q +V +++  P+    F V+L+ GVTGSGKT
Sbjct: 189 GLLREAVIAVAAPFATPDPSHGAPKLSEEQAEVAQELCGPVEAGRFQVTLLEGVTGSGKT 248

Query: 233 EVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQ 292
           EVY E VAA L  GKQVL+LLPEI+L++   +RF +RFG +PA WHS L    R + WR 
Sbjct: 249 EVYFEAVAACLAKGKQVLVLLPEIALSAQWTDRFIRRFGAEPAVWHSDLGAKRRRETWRA 308

Query: 293 VARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFP 352
           VA G+  V+VG RSALFLPF  LGL+V+DEEH+ ++KQEEG++Y+ RDM++VR ++   P
Sbjct: 309 VAEGSARVVVGARSALFLPFADLGLVVVDEEHESAFKQEEGVMYHGRDMAVVRARLADAP 368

Query: 353 VVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMID 412
            +LVSATPS+E+  N  S RY    L+ R+  + LP + ++DMR     +G  LSP++  
Sbjct: 369 AILVSATPSLETLANVESGRYRHELLTARHGGATLPDVSLVDMRADPPERGLFLSPKLCT 428

Query: 413 GIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHS 472
            I  TL + EQ +LFLNRRGYAPLTLC+ CG+R++C +CS WLVEHR++  L CH CGH+
Sbjct: 429 AIDETLEKGEQAMLFLNRRGYAPLTLCRACGHRMQCPNCSAWLVEHRARGILTCHHCGHT 488

Query: 473 AIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAI 532
               + C  C +   ++  G GIERI EE    FP A++ ++SSD  G        +  I
Sbjct: 489 ERIPKDCPECHAENSLVPIGPGIERITEEAKLRFPDAKLLVMSSDTLGSPAATAEAVRKI 548

Query: 533 AKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRF 592
           + GE+++IIGTQ+VAKG +FP+++LVGVVD DLGL   DLR++ERT QLL QV GRAGR 
Sbjct: 549 SDGEVNLIIGTQIVAKGWHFPKLTLVGVVDADLGLGGGDLRAAERTVQLLHQVAGRAGRA 608

Query: 593 GLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQE 652
             +   L+Q+Y   HPVM ALVS D  +F E E   R S   PP+GRLAA+I+S    + 
Sbjct: 609 EHRGRVLLQSYVGEHPVMTALVSNDFQTFMEQEAEQRRSSFWPPYGRLAALIVSAPSAEA 668

Query: 653 VENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNT 712
            +  A  +   AP    + V GPA +PL ++RGR+R RLL+   R   +Q    Q   + 
Sbjct: 669 ADALAREIALSAPEREGVQVLGPAPAPLAVLRGRHRRRLLLRTMRGIAVQPILRQWLGD- 727

Query: 713 IKRSNALRVQFDIDPQNFL 731
           IK +   +V  DIDP +FL
Sbjct: 728 IKPTGGAKVDIDIDPISFL 746


>gi|114571346|ref|YP_758026.1| primosome assembly protein PriA [Maricaulis maris MCS10]
 gi|114341808|gb|ABI67088.1| primosomal protein N' [Maricaulis maris MCS10]
          Length = 727

 Score =  538 bits (1385), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 295/725 (40%), Positives = 416/725 (57%), Gaps = 19/725 (2%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           RV IL    +   + Y VP  M ++ G  V  PL  R   G+VW     K       L+ 
Sbjct: 14  RVSILFPLPLPEAFDYLVPPEMCLQPGDHVVAPLGKRAARGVVWAV---KPGPGERALKQ 70

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV---SALSETEKMEEKIQFTGIFP 131
           +E      PL      FV W++ Y     G+V R V+    AL  +       + +G   
Sbjct: 71  VEEPAGGAPLPEGTRLFVDWLSRYLVQSPGIVLRSVLRSGDALKPSPTETVYRRGSGEPD 130

Query: 132 RINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISP---VVD 188
           R+ T AR RVLD ++        DL R + V++ V+ GL   G + ++   + P   + D
Sbjct: 131 RM-TDARGRVLDAVEVLHEASAADLAREAGVTASVVKGLAKSGALAELTRPVDPPFGLPD 189

Query: 189 SPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVL--HLG 246
           S     +L ++      V+ ++V     GF  +L+ GVTGSGKTEVY E +A VL    G
Sbjct: 190 SEREGLTLTMMQAEAAGVLRRLV--RAGGFQAALLDGVTGSGKTEVYFEAIAEVLRREPG 247

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
            Q+LI+LPEI+LT A+L RF+ RFGV+PA WHS  S   R + WR+VA G   ++VG RS
Sbjct: 248 AQILIMLPEIALTEAVLSRFKARFGVEPALWHSGASPKARRRAWREVAEGRARIVVGARS 307

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           +LFLPF KL ++++DEEHD +YKQ+EG+ Y  RD+++VR KIE   V+L SATPS+ES  
Sbjct: 308 SLFLPFPKLRMVIVDEEHDPTYKQDEGLPYQGRDLAVVRSKIEGAMVILASATPSLESLS 367

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N ++ RY  V L+ R   + LP +  ID+R      G+ LSP MI+ +R TL R EQ LL
Sbjct: 368 NALAGRYVHVRLAARPGAAVLPEVDTIDLREHPAETGRWLSPPMIEAVRDTLERGEQCLL 427

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           +LNRRGYAPL LC+ CG+R+       +LVEHR   +L CH  G S      C  C +  
Sbjct: 428 YLNRRGYAPLVLCRTCGHRMVSPDTQSYLVEHRYTGRLVCHVTGFSMPKPAHCPACNAQD 487

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
            + + G G+ER+AEE    FP A + I SSD   G       ++A+ +GEIDI++GTQ+ 
Sbjct: 488 SLTSIGPGVERVAEEAKLTFPDASVEIYSSDSRSGAE----IVAAMERGEIDILVGTQIA 543

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGHNFP ++LVGVVD DLGL   D R+ ERTFQ L QV GRAGR       L+Q +QP 
Sbjct: 544 AKGHNFPGLTLVGVVDADLGLAGGDPRAGERTFQTLVQVAGRAGRADRPGRALLQTHQPE 603

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR 666
           H  +QAL++GD D+F E E   RES+ LPPFGRLAA+       ++V+  A +    AP 
Sbjct: 604 HDAIQALIAGDRDAFLEMEAMVRESLGLPPFGRLAAIGFMSMNPEQVDRVANDYAAKAPN 663

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
           S  + ++GPAE P  M+RG +R R+L+   +  ++  +  + +   +K   ++RV  D++
Sbjct: 664 SEGVEIWGPAEPPRAMIRGWHRRRILVRADKEIDISAYL-RAWSKRVKTPPSVRVSIDVE 722

Query: 727 PQNFL 731
           P +F+
Sbjct: 723 PYSFI 727


>gi|254294583|ref|YP_003060606.1| primosome assembly protein PriA [Hirschia baltica ATCC 49814]
 gi|254043114|gb|ACT59909.1| primosomal protein N' [Hirschia baltica ATCC 49814]
          Length = 740

 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 298/729 (40%), Positives = 419/729 (57%), Gaps = 23/729 (3%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +LL   +   + Y +   MKVE+G+ V VPL +R+V G+VW   +   K      RP++Y
Sbjct: 20  VLLPMPLPEAFDYRLHEDMKVEVGAFVTVPLGARSVTGVVWGLKQGPSK------RPLKY 73

Query: 78  V---FDCPPLSRQMC-EFVKWVADYTFSPMGLVARMVV---SALSETEKMEEKIQFTGIF 130
           V    +  PL  Q+  +FV+  + YT +PMG +  M +    AL  +       +     
Sbjct: 74  VEEVLEAAPLMPQVTRDFVERSSKYTCTPMGNMLAMCLRSRDALLPSPTETYVYRTKSEL 133

Query: 131 PRINTVARLRVLDKIKDG--KIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVD 188
           PRI T AR +VLD       +     +L R + VS+ V+ GL   G + Q    I     
Sbjct: 134 PRI-TPARQKVLDIAPQSADQGMTAAELARQADVSTGVVKGLVDSGALAQHEAPIDKPFG 192

Query: 189 SPNLYF-SLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHL-- 245
            PN       + D+ Q         + +K F   L+ GVTGSGKTEVY E +A  L    
Sbjct: 193 KPNSELKGFDLTDEQQAGADALCEAVRSKEFKPILLDGVTGSGKTEVYFEAIAEALRTEP 252

Query: 246 GKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVR 305
             Q+L+LLPEI+LT A+ ERF+ RFG  PAEWHS+ +   R ++WR+V  G   ++VG R
Sbjct: 253 DAQILVLLPEIALTQAVRERFENRFGAAPAEWHSNATQKERRRVWREVGAGRAQIVVGAR 312

Query: 306 SALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESR 365
           SALFLPF+ L LI++DEEHD SYKQ+EG +Y  RD+S++R  + S  VVL SATPS+E+ 
Sbjct: 313 SALFLPFQNLRLIIVDEEHDGSYKQDEGAVYQGRDLSVMRAHLGSATVVLASATPSLETL 372

Query: 366 VNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTL 425
            N    RY  + L  R   + LP + + DM+    A+   LSP ++D +   L   EQ+L
Sbjct: 373 ANAYQGRYQHIKLLARPGAAVLPEILLADMKENPPAKDCWLSPLLVDALEQNLDAGEQSL 432

Query: 426 LFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSS 485
           L+LNRRGYAPL +C+ CG RLK      WL EHR    L CH  G S     +C  CG++
Sbjct: 433 LYLNRRGYAPLVICKGCGERLKAPDTESWLTEHRYTGMLVCHLTGFSMKKPVNCPHCGAA 492

Query: 486 GKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQL 545
             ++  G G+ER+AEEV   F  AR+ + SSD       L   +S + +GE+DI+IGTQ+
Sbjct: 493 DSLMGVGPGVERLAEEVRGLFQGARVEVFSSDTARNPEELNGIISRMEQGEVDILIGTQI 552

Query: 546 VAKGHNFPRMSLVGVVDGDLGLT---NADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQA 602
            AKGHNFP ++LVG VD D GL     +DLR+ ERTFQLLSQV+GRAGR       +IQ 
Sbjct: 553 AAKGHNFPNLTLVGAVDADSGLKGGQGSDLRAGERTFQLLSQVSGRAGRADKPGRAIIQT 612

Query: 603 YQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE 662
           Y P  P +QAL++ D D F E E+++RE +  PPFGRLAAV+IS       ++ A     
Sbjct: 613 YAPDSPSIQALLANDRDWFMELEMKSREELGFPPFGRLAAVVISAENSLAADDAAATFVR 672

Query: 663 HAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQ 722
            AP +  + ++GPA +P+ ++RGR+R R+LI   RN +L  + S  +   IK S+++RV 
Sbjct: 673 GAPNADGVDIWGPAPAPIAVLRGRHRRRMLIRANRNVDLSAYLS-AWRERIKLSSSVRVS 731

Query: 723 FDIDPQNFL 731
            DI+P +F+
Sbjct: 732 LDIEPYSFM 740


>gi|315497302|ref|YP_004086106.1| primosomal protein n' [Asticcacaulis excentricus CB 48]
 gi|315415314|gb|ADU11955.1| primosomal protein N' [Asticcacaulis excentricus CB 48]
          Length = 731

 Score =  532 bits (1371), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 306/745 (41%), Positives = 417/745 (55%), Gaps = 33/745 (4%)

Query: 2   ASSGSSVEGVVCSRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIV--WY 59
           A S      V   R  +++L  +     Y VP+ + +  G  V VPL    V G+V   Y
Sbjct: 5   ADSLIEAPAVATRRAKVVVLAPMETALDYLVPNDLDLSAGDHVWVPLGHAKVRGLVVELY 64

Query: 60  NSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEK 119
           +S E     ++KL+P+    D P +      F  W A +T +  G   +  + AL     
Sbjct: 65  DSAE-----TVKLKPVAARIDDPRVPEASLRFWLWAAGWTLTAPGTFLKGCLQALKTPRA 119

Query: 120 ME---------EKIQFTGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGL 170
                      E ++ T    R+  +A L +             +L +A+ V+  V+  L
Sbjct: 120 QARHGYVRHEVEALKPTAKQARVLELAVLPL----------TAAELAQAAGVTPGVVQTL 169

Query: 171 KAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVV--PLCTKGFAVSLISGVTG 228
           + +G ++++ E+      +P+  F +P L+ +Q    +Q++      +GFA  L+ GVTG
Sbjct: 170 EKKGWLEKV-ELSREGFAAPDPDFKMPSLNGDQA-AADQLLRNEWARQGFAPVLLDGVTG 227

Query: 229 SGKTEVYLEIVAAVLH--LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMR 286
           SGKTEVYLE VA  L      QVL+LLPEI+LT+A++ R Q RFGV P +WHS++S S R
Sbjct: 228 SGKTEVYLETVARALRDDPTAQVLVLLPEIALTTAVMGRLQSRFGVPPVQWHSAVSASQR 287

Query: 287 EKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRG 346
            +IW  VA G   +IVG RSALFLP+  L LIVIDEEHD SYKQEEG+ Y ARD++++R 
Sbjct: 288 RRIWDGVATGEARLIVGARSALFLPYTNLKLIVIDEEHDGSYKQEEGVRYQARDLAVMRA 347

Query: 347 KIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSL 406
             + F VVL SATPS+E+  N    RY  V L  R+  + LP + +IDM+     +G  L
Sbjct: 348 HRDGFMVVLASATPSLETLTNAQKGRYQWVRLENRHGTAQLPDIALIDMKAHPPEKGFWL 407

Query: 407 SPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYC 466
           S  ++  I  TL R EQ LLFLNRRGYAPL LC+ CG R+       WLVEHR+  +L C
Sbjct: 408 SDPLVGEILATLQRREQVLLFLNRRGYAPLVLCRACGERMTSPKTDSWLVEHRATGRLVC 467

Query: 467 HQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQ 526
           H  G S      C  CG+   + + G G+ERI EEV E FP AR  I SSD         
Sbjct: 468 HLTGFSMKKPDRCPHCGALDGLTSIGPGVERILEEVQERFPQARAEIFSSDTTPDADSSA 527

Query: 527 LQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVT 586
             +  +   EIDI+I TQ  AKGHNF  ++LVG+VD DLGL   DLR++ERTFQLL+Q T
Sbjct: 528 ALIRRVENHEIDILIATQAAAKGHNFLNLTLVGIVDADLGLKGGDLRAAERTFQLLAQAT 587

Query: 587 GRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIIS 646
           GRAGR       L+Q Y P HPVMQAL + D ++FY  E  +R+    PPFGRL AVI+S
Sbjct: 588 GRAGRATKPGRALLQTYTPEHPVMQALQAQDREAFYAYEQMSRDIAQFPPFGRLGAVILS 647

Query: 647 GTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFS 706
                 +  Y   L    P +  I V+GPA++PL +VRG +R R L+   RN +LQGF S
Sbjct: 648 AKDNGLLNRYVRELALAIPNTEGIDVYGPADAPLSLVRGMWRKRFLVRADRNRDLQGFMS 707

Query: 707 QMYDNTIKRSNALRVQFDIDPQNFL 731
             +  ++K  NA+RV  DI+P +FL
Sbjct: 708 -AWLKSLKAPNAVRVVTDIEPYSFL 731


>gi|302381674|ref|YP_003817497.1| primosomal protein N' [Brevundimonas subvibrioides ATCC 15264]
 gi|302192302|gb|ADK99873.1| primosomal protein N' [Brevundimonas subvibrioides ATCC 15264]
          Length = 720

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 297/719 (41%), Positives = 416/719 (57%), Gaps = 9/719 (1%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEY 77
           +L+   V   + Y VP AM +  G  V VPL  R + GIV    E       LK+  +E 
Sbjct: 6   VLIPLPVHEAFDYEVPEAMALARGDQVAVPLGPRMMRGIVAEVRETTGSNRRLKV--VET 63

Query: 78  VFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFT--GIFPRINT 135
             D PPL     +FV+W A +T SP G +A   +  L       E+         P   T
Sbjct: 64  RLDDPPLPPGTVDFVEWAARWTLSPPGEMAATALKGLRAPRPRPERRLRRVGDRTPARPT 123

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
             R  VL  + +  +    DL RA+ VSS VI GL  +GV++ I  +     D+P+   +
Sbjct: 124 AGRTAVLAALGEAAM-PGPDLARAAGVSSAVIKGLVDEGVLEVIETLADAAFDAPDPAHA 182

Query: 196 LPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHL--GKQVLIL 252
              L+ +Q    + +      G F   L+ GVTGSGKTE YLE VA  L      Q+LIL
Sbjct: 183 PATLNADQGAAADAIAAATAAGGFRPFLLDGVTGSGKTEAYLEAVARTLAADPAAQILIL 242

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           LPEI+LT  ++ R   RFG  PAEWHS ++   R ++W  V  G  S++VG RSALFLPF
Sbjct: 243 LPEIALTQDLIARITARFGAAPAEWHSGVAPPKRRRVWEAVVAGRCSIVVGARSALFLPF 302

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
             L L+++DEEHD S+KQE+G++Y+ RD+++ R +IE   VVL SATPS+E+  N   +R
Sbjct: 303 PNLKLVIVDEEHDGSFKQEDGLVYHGRDLAVARARIEGAVVVLASATPSLETLWNAQGQR 362

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  + LS+R+  + LP +Q++D+R         LS  + + I  TL   EQTLLFLNRRG
Sbjct: 363 YGWLKLSSRHGAAQLPDIQLLDLRQCPPDPQTWLSQPLREAIAQTLMAGEQTLLFLNRRG 422

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAP+ LC+ CG+R+       WLVEHR   +L CH  G +    + C  CG+   +++ G
Sbjct: 423 YAPVVLCRACGHRMTSPDTDSWLVEHRYTGRLVCHLTGFTMARPRICPSCGAEDSLVSVG 482

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ER+ EEV + FP AR ++ SSD        +  +  + +GEIDI++ TQ  AKGHNF
Sbjct: 483 PGVERVEEEVRQLFPEARTAVFSSDTVPDARAARALIQRMTEGEIDILVATQAAAKGHNF 542

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LVGVVD DLGL   DLR++ERT+QLL+Q TGRAGR       ++Q + P HPV+ A
Sbjct: 543 PLLTLVGVVDADLGLRGGDLRAAERTYQLLTQATGRAGRADRPGRAILQTWTPEHPVLMA 602

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           L  GD D F E+E+  RE+  LPP GRLAA+I+SG     VE  A +L    P +  + V
Sbjct: 603 LAKGDRDGFVEAEMAEREAATLPPHGRLAALILSGVDAMAVEKVAADLAAAIPNAERLEV 662

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           +GPA++PL ++RGR R RLL+   R+ +LQGF  + +   +K   ++RV  D+DP +FL
Sbjct: 663 YGPADAPLGLIRGRRRKRLLVRADRDVDLQGFL-RAWLARVKVPGSVRVTVDVDPYSFL 720


>gi|83592558|ref|YP_426310.1| primosome assembly protein PriA [Rhodospirillum rubrum ATCC 11170]
 gi|130901|sp|P05445|PRIA_RHORU RecName: Full=Primosomal protein N'; AltName: Full=ATP-dependent
           helicase priA; AltName: Full=Replication factor Y
 gi|46363|emb|CAA26334.1| unnamed protein product [Rhodospirillum rubrum]
 gi|83575472|gb|ABC22023.1| Primosomal protein n [Rhodospirillum rubrum ATCC 11170]
          Length = 811

 Score =  528 bits (1359), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 307/791 (38%), Positives = 428/791 (54%), Gaps = 79/791 (9%)

Query: 16  VIILLLQAVSGPYIYSVPSAM-KVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           V +LL   ++G Y Y VP+ M +  +G++VRVPL  R  +G+VW     +   +  +L+P
Sbjct: 25  VAVLLPLPLAGAYDYKVPAGMARPAVGTLVRVPLGRREEIGVVWGAGAGETPPE--RLKP 82

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSAL----------------SETE 118
           +    +CPPL   +  F+ WVA YT  P G V RM +S                  +   
Sbjct: 83  LIGFPECPPLPAPLRAFIDWVAAYTVQPPGAVLRMALSVPAALEAPPPALGWRRPSAGQR 142

Query: 119 KMEEKIQFTGIFP---RINTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQ 173
              ++ +  G  P   R++   R RVL  + D  G  +   DL R + V   V+  +   
Sbjct: 143 AAGQRAEGQGPLPGGARLSP-GRQRVLAVLDDHPGLPFAGADLAREAAVGPAVVAAMAKA 201

Query: 174 GVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTE 233
           G+++ +         +P+     P+L  +QQ   + +     +GF+  L+ GVTGSGKTE
Sbjct: 202 GLLEAVTRSNEWSPQAPDADRPGPLLSADQQAAADGLRTALDQGFSGLLLEGVTGSGKTE 261

Query: 234 VYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQV 293
           VY E +A  L  G+Q L+LLPEI+L +    RF  RFG  P +WHS +  + R + WR V
Sbjct: 262 VYFEAIAETLRRGRQALVLLPEIALAAQWPRRFADRFGAAPVQWHSQMGAAARRRAWRAV 321

Query: 294 ARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPV 353
           A G   V+VG RSALFLP+  LGLI++DEEHD ++KQEEG+ YNARDM++VR ++  FP 
Sbjct: 322 ALGRAPVVVGARSALFLPYPDLGLIIVDEEHDSAFKQEEGVPYNARDMAVVRARLGGFPA 381

Query: 354 VLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVI-------------DMRGQTI 400
           VL SATPS+E+  N    RY  + L  R+  + +P + ++             D  G   
Sbjct: 382 VLASATPSLETIENARQGRYRHLVLPRRHGGAEMPEITLLDLRRAPPQKWLPTDFAGPGG 441

Query: 401 AQGKS----------------------------------------LSPEMIDGIRHTLAR 420
           ++G +                                        LSP +I  +  TLA 
Sbjct: 442 SEGLAAPGGANDEAEEQKAPPPSPTASPSPTASPSPMARPARLGWLSPPLITAVEETLAA 501

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
            EQ LLFLNRRGYAPLTLC+ CG+RLKC  C+ WLVEHR   +L CH CG+     ++C 
Sbjct: 502 GEQVLLFLNRRGYAPLTLCRSCGHRLKCPRCTAWLVEHRRDGRLRCHHCGYQQPIPETCP 561

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
            CG +  +  CG G+ER+AEE    FP AR+ + +SD   G        + IA  +ID+I
Sbjct: 562 ACGVADSLAPCGPGVERLAEEAAHRFPKARMDVAASDTVTGPKEAAALATRIANHDIDLI 621

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQ++AKGH+FP ++LVGVVDGDLGLT  DLR+SERT QLL QV GRAGR       LI
Sbjct: 622 IGTQIMAKGHHFPLITLVGVVDGDLGLTGGDLRASERTHQLLHQVAGRAGRAERPGRVLI 681

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           Q   P HPVM+AL SGD   F E E   R+++ +PPFGRL A++ISG     V+  A  L
Sbjct: 682 QTVDPGHPVMEALASGDPALFLEVEAAERQALAMPPFGRLVALVISGEDSARVQAVAAAL 741

Query: 661 KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALR 720
              AP    + V GP  +PL M+RGR+R RLL+   R   +Q      + + +     ++
Sbjct: 742 GRAAPMGPGLDVLGPVPAPLAMLRGRHRHRLLLKAARGVKVQPVVRH-WLSLVSIPPGVK 800

Query: 721 VQFDIDPQNFL 731
           VQ D+DP +FL
Sbjct: 801 VQVDVDPISFL 811


>gi|260576664|ref|ZP_05844651.1| primosomal protein N' [Rhodobacter sp. SW2]
 gi|259021149|gb|EEW24458.1| primosomal protein N' [Rhodobacter sp. SW2]
          Length = 507

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 246/508 (48%), Positives = 343/508 (67%), Gaps = 3/508 (0%)

Query: 226 VTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSM 285
           +TGSGKTEVYLE VA  L  G+Q L+LLPEI+LT+  L R + RFG +PAEWHS ++ + 
Sbjct: 1   MTGSGKTEVYLEAVAECLKQGRQALVLLPEIALTAEFLTRVEARFGARPAEWHSGVTMTE 60

Query: 286 REKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVR 345
           R ++WR V +G   ++VG RSALFLPF++LGLIV+DEEHD SYKQE+G+LY+ARDM+++R
Sbjct: 61  RRRLWRMVGQGGAQMVVGARSALFLPFRELGLIVVDEEHDTSYKQEDGVLYHARDMAVLR 120

Query: 346 GKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS 405
             +    VVL SATPS+ES  N  + +Y  + L  R+  + LP ++ IDMRGQ++A  + 
Sbjct: 121 AALAGCQVVLASATPSLESWANAQAGKYGRLDLGARFGVAELPDMRAIDMRGQSLANDRW 180

Query: 406 LSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLY 465
           +S  +   +   +A  EQ +LFLNRRGYAP+T+C+ CG+++ C  C   +VEHR  K+L 
Sbjct: 181 ISEPLAQAVAARVAFGEQAMLFLNRRGYAPVTVCRACGHQVGCDDCDARMVEHRFLKRLV 240

Query: 466 CHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRL 525
           CHQCG +      C  CG +G+M   G G+ER+AEEV   FP AR+++LSSDL G    L
Sbjct: 241 CHQCGATKPIPTVCPACGVAGRMAPVGPGVERLAEEVTARFPQARLAVLSSDLFGSARAL 300

Query: 526 QLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQV 585
           + Q+  IA G  DIIIGTQ+VAKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV
Sbjct: 301 KEQIGVIAAGGADIIIGTQIVAKGHNFPLLTLVGVIDADLGLQGSDLRAAERTFQLMRQV 360

Query: 586 TGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVII 645
            GRAGR     L L+Q +QP HPV++A++ GD ++F+ +E   R    +PP+GR+A +I+
Sbjct: 361 AGRAGRAEKPGLALLQTHQPEHPVIRAILGGDEEAFWSAEAEERRVSGVPPYGRMAGIIL 420

Query: 646 SGTKYQEVENYAYNL-KEHAP-RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQG 703
           S        ++   L +  AP R     VFGPA +P+  VRGR+R RLL+  ++   LQ 
Sbjct: 421 SSPDVALAFDFGGELARRDAPLRRIGAQVFGPAPAPIARVRGRHRVRLLVKAEKGVPLQA 480

Query: 704 FFSQMYDNTIKRSNALRVQFDIDPQNFL 731
             ++ +   +K    LR+  DIDPQ+FL
Sbjct: 481 ALAE-WLGQLKLPANLRLAVDIDPQSFL 507


>gi|15604397|ref|NP_220913.1| primosome assembly protein PriA [Rickettsia prowazekii str. Madrid
           E]
 gi|8928317|sp|Q9ZD10|PRIA_RICPR RecName: Full=Primosomal protein N'; AltName: Full=ATP-dependent
           helicase priA; AltName: Full=Replication factor Y
 gi|3861089|emb|CAA14989.1| POSSIBLE PRIMOSOMAL PROTEIN N (priA) [Rickettsia prowazekii]
 gi|292572155|gb|ADE30070.1| Primosomal protein N' [Rickettsia prowazekii Rp22]
          Length = 648

 Score =  496 bits (1277), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 270/708 (38%), Positives = 408/708 (57%), Gaps = 79/708 (11%)

Query: 27  PYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW---YNSEEKYKIDSLKLR-PIEYVFDCP 82
           P  Y +   +++ +G +V V  R++ + GIVW    NSE K KI +++ + P+       
Sbjct: 15  PLDYLITEDLELNIGDLVVVHFRNKELTGIVWELDTNSEAK-KIKTIEAKAPLNL----- 68

Query: 83  PLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVL 142
            ++ ++ E +KW++ Y  S +G +A++V+                     IN        
Sbjct: 69  SITLEVLELIKWMSSYYMSELGSIAKLVLP--------------------IN-------- 100

Query: 143 DKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKN 202
                  I EK   I+  QV +H                            F LP L + 
Sbjct: 101 -------ISEKPIKIKEQQVKNH----------------------------FVLPKLSEE 125

Query: 203 QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAI 262
           Q+    Q V +  +    +LI GVTGSGKTE+Y  I+A  L  G+QVLI+LPEI+L   I
Sbjct: 126 QK----QAVTILNESNKPTLIKGVTGSGKTEIYFHIIADYLIKGRQVLIMLPEIALGKQI 181

Query: 263 LERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDE 322
           + RF  RFG +P  W+SS++ + ++ I R +    + V++G RS+LFLPF  LGLIVIDE
Sbjct: 182 INRFIDRFGFEPIIWNSSVTKAQKKMILRGILSNKVKVVIGTRSSLFLPFHNLGLIVIDE 241

Query: 323 EHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRY 382
           EHD SYKQ++ ILYNARD +IVRGK +   +VL SATPS+E+  N  + +Y  V L+ RY
Sbjct: 242 EHDDSYKQDDNILYNARDTAIVRGKFDKAKIVLCSATPSLETIYNIKTHKYQLVTLANRY 301

Query: 383 RNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVC 442
           +N  LP++++IDM  + + +   LS  +ID I+  L   +Q LLFLNRRGYAPL LC+ C
Sbjct: 302 KNVDLPNIEIIDMTKEKLPKNSYLSKILIDAIKGNLENKKQALLFLNRRGYAPLMLCKAC 361

Query: 443 GNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEV 502
           G+R  C  CS W+V H++ KKL CH CG+ +    SC  C     +  CG GIERIAEE 
Sbjct: 362 GHRFTCKFCSAWMVLHKATKKLECHHCGYQSKIFSSCPECLEDETLTICGPGIERIAEEA 421

Query: 503 CEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVD 562
              FP ++I+++S D      ++   L  +   EIDI+IGTQ++ KG++FP ++LVGV+D
Sbjct: 422 MLLFPKSKIAVISKDHAKTPEKIAQLLHQMENLEIDILIGTQIITKGYHFPNLTLVGVID 481

Query: 563 GDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFY 622
            DLG  NA+LR+SERTFQLL QV GRAGR   K +  +Q+Y P + +   +  GD D F+
Sbjct: 482 ADLGSNNAELRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNIIFSYVKVGDEDRFF 541

Query: 623 ESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFM 682
            +E+  R++ N+PPF + A++I+SG    ++ + A  + + AP+ +++ + GPA S +  
Sbjct: 542 TNELEIRKAANMPPFSKTASLILSGFSESKILDIARKIVQIAPK-ANVKILGPARSLMSK 600

Query: 683 VRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           + G+YR+R+LI   +  NLQ +  + +   IK  +  +++ DIDP+ F
Sbjct: 601 LAGKYRYRILIIADKKFNLQKYL-KFWLGFIKIPSYCQIKIDIDPKTF 647


>gi|326403868|ref|YP_004283950.1| primosomal protein n' [Acidiphilium multivorum AIU301]
 gi|325050730|dbj|BAJ81068.1| primosomal protein n' [Acidiphilium multivorum AIU301]
          Length = 717

 Score =  491 bits (1264), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 297/721 (41%), Positives = 406/721 (56%), Gaps = 12/721 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +LL  A    + Y    A     G++V VPL  R V G+VW ++ E   I   +L+ +
Sbjct: 4   VSVLLPYAFDAAFTYEAREAPPP--GAVVTVPLGRRIVHGVVWDDAPEP-GIAPARLKTL 60

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFP--RI 133
             V   P L   +  F+ WVA YT +P G V  + +                G  P  RI
Sbjct: 61  HAVIATPALPGPLRRFIDWVAQYTMAPRGEVLALALKTGLLDPPAPRAGWAAGAAPSGRI 120

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T  R RVLD +         +L  A+   + V+ GL   G+++    V  P V  P+  
Sbjct: 121 -TATRQRVLDALATLDRPTTAELAAAAGTGAAVVRGLADAGLLRP--AVRDPSVPLPDPD 177

Query: 194 FSLPILDKNQQDVVEQV-VPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
            + P L   Q++    +   +  + F V+L+ GVTG+GKTEV+ E +AA L  G+Q L+L
Sbjct: 178 HAPPALSAAQEEAATALRASVAARRFEVTLLEGVTGAGKTEVFCEAIAACLREGRQALVL 237

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI+L++    RF  RFG  PA WHS L+ + R   +  VA GA  +++G RSALFLPF
Sbjct: 238 VPEIALSAQFAARFAARFGAAPALWHSGLTPATRRANYHAVASGAARLVLGARSALFLPF 297

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
              GLIV+DEEH+ +YKQE+G+ Y+ARDM++VRG+I    V+L SATPS+ES VN  + R
Sbjct: 298 ADPGLIVVDEEHEAAYKQEDGVTYHARDMAVVRGRISGCAVILASATPSLESAVNAEAGR 357

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  + L+ R+  + LP ++ ID+R    A+G+ LSP +   +  TL    Q +LFLNRRG
Sbjct: 358 YRHITLAARHGGARLPAIEAIDLRAAPPARGRFLSPVLAGALETTLEGGGQAMLFLNRRG 417

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+ CG+RL C +C+ WLVEHR    L CH CGH+A     C  C +    +  G
Sbjct: 418 YAPLTLCRGCGHRLTCPNCTAWLVEHRRPGHLLCHHCGHAAQAPAKCPDCAAEQSFVPIG 477

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ERIAEEV E FP AR  +++SD      + +  L AI   EID++IGTQ++AKG +F
Sbjct: 478 PGVERIAEEVAELFPAARTILMASDAITTAEQAEAALRAIVAHEIDLVIGTQMIAKGWHF 537

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P + LVGVVD DLGL   DLR+ ER+ QLL QV GRAGR  L    L+Q Y P HPVM+A
Sbjct: 538 PDLVLVGVVDADLGLGGGDLRAGERSAQLLHQVAGRAGRGRLPGRVLLQTYAPEHPVMRA 597

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           L+  D   F  +E   R   + PPFGRLAA+I+S  +    +  A  L    PR   + V
Sbjct: 598 LIGNDLAGFRRAEADLRAPGHWPPFGRLAALIVSADEAATADAAAAALARTQPRDG-VQV 656

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRS--NALRVQFDIDPQNF 730
            GPA +P  M+RGR+R RLL+   R   +Q       D         A R+  DIDP +F
Sbjct: 657 LGPAPAPFAMLRGRHRRRLLLRAPRGIAVQPVLRAWLDRARAEGLPRAARIDIDIDPISF 716

Query: 731 L 731
           L
Sbjct: 717 L 717


>gi|149203731|ref|ZP_01880700.1| primosome assembly protein PriA [Roseovarius sp. TM1035]
 gi|149142848|gb|EDM30890.1| primosome assembly protein PriA [Roseovarius sp. TM1035]
          Length = 721

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 269/611 (44%), Positives = 377/611 (61%), Gaps = 22/611 (3%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +L  Q + GP  Y  P    V  G+ V VPL  R VLG+VW      +  D  K R I
Sbjct: 15  VAVLTAQPLEGPLDYLAPEG-GVMAGAFVEVPLGPRRVLGVVWGPGRGGF--DLKKARGI 71

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA--LSETEKMEEKIQFTGIFPRI 133
             V D  P+  +M EF++   +YT +P+  + R+   A  LS+   M++  +     P  
Sbjct: 72  GRVLDVAPMRVEMQEFLRRAGEYTLTPLPAMLRLATRAPGLSDPPSMQKIYRLGDTEPAR 131

Query: 134 NTVARLRVLDKIKD--GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP- 190
            T AR RVL+ ++D  G  +  +++   + V+S V+  L AQG +    E  +P  D+P 
Sbjct: 132 LTDARARVLEVLRDHGGLGFTLKEVSDLAGVTSSVVKALVAQGAV---LEEDTPR-DTPF 187

Query: 191 -NLYFSLPI--LDKNQQDVVEQV-VPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
             L   LP   L ++Q     ++ + L    +  +L+ GVTGSGKTEVYLE VA  L  G
Sbjct: 188 VPLDPDLPAKALTEDQAAAAARLRMGLQAGSYGTTLLRGVTGSGKTEVYLEAVAEALRQG 247

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
            Q L+LLPEI+LT+  L R + RFG +PAEWHS ++ + R ++W+ V +G   ++VG RS
Sbjct: 248 GQALVLLPEIALTAEFLTRVEVRFGTRPAEWHSGVTMTERRRVWKMVGQGGAQMVVGARS 307

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALFLPF+ L LIV+DEEHD SYKQE+G LY+ARDM+++R  +    VVL SATPS+ES  
Sbjct: 308 ALFLPFQNLALIVVDEEHDTSYKQEDGALYHARDMAVLRASLCGARVVLASATPSLESWA 367

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N  + +Y  + L  R+  + +P L  IDMR +T+   + +SP +   +   +A  EQ LL
Sbjct: 368 NAEAGKYERLDLDARFGVAVMPELAAIDMRVETLPSNRWISPTLQAAVNARVAAGEQALL 427

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRGYAP T+C+ CG+++ C HC   +VEHR +K+L CHQCG SA   ++C  CG +G
Sbjct: 428 FLNRRGYAPTTVCRACGHQIGCDHCDARMVEHRFQKRLICHQCGESAAMPEACPACGVAG 487

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
           K+ A G G+ER+AEE    FP ARI++LSSDL G    L+ Q+  IA+G  DIIIGTQLV
Sbjct: 488 KLAAVGPGVERLAEEAAALFPQARIAVLSSDLFGSARALKEQIVEIAQGAADIIIGTQLV 547

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGR-AGRFGLKSL-----GLI 600
           AKGHNFP ++LVGV+D DLGL  +DLR++ERTFQL+ QV GR AG+ G ++L       I
Sbjct: 548 AKGHNFPLLTLVGVIDSDLGLQGSDLRAAERTFQLMRQVAGRAAGQSGRRALCRRFSPSI 607

Query: 601 QAYQPTHPVMQ 611
           +++ P  P M+
Sbjct: 608 RSFAPFWPAMK 618


>gi|269958653|ref|YP_003328440.1| primosomal protein N' [Anaplasma centrale str. Israel]
 gi|269848482|gb|ACZ49126.1| primosomal protein N' [Anaplasma centrale str. Israel]
          Length = 662

 Score =  487 bits (1253), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 268/706 (37%), Positives = 403/706 (57%), Gaps = 66/706 (9%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQ 87
           + YSV   M++ +G  VRVP  +R  +GI+   +        ++L+ I      PP+ R 
Sbjct: 19  FYYSVREGMELSVGDYVRVPFGNRVAIGII--TTMRSGPAPDMELKDIGDKIPLPPVQRP 76

Query: 88  MCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKD 147
           + EF+KWV+ Y   P+G+V +MV+ ++                     VA+ R+      
Sbjct: 77  LMEFLKWVSSYNIMPIGMVLKMVLGSV--------------------IVAKSRMFGT--- 113

Query: 148 GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVV 207
                                         Q ++   P  +SP L  S   L   Q    
Sbjct: 114 ------------------------------QEYKCCVPTDNSPALSTS-AALSGEQLKAR 142

Query: 208 EQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH--LGKQVLILLPEISLTSAILER 265
           +Q+V   + GF+V+++ G TGSGKTEVY   +A +LH  L  QVLILLPEI L + +++R
Sbjct: 143 DQIVGRLS-GFSVTVLDGKTGSGKTEVYCAAIAKLLHDCLDAQVLILLPEIVLATQLMKR 201

Query: 266 FQKRF-GVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEH 324
               F G  P EWHS L+   R + W  +  GA S++VG RSALFLPFK L +IV+DEEH
Sbjct: 202 VHSYFAGCNPVEWHSGLTAKQRRENWLAITYGASSIVVGARSALFLPFKNLKMIVVDEEH 261

Query: 325 DISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRN 384
           + S+KQ+ GI+YNARDMSIV  K    PVVL SATP++E+  N    +YH V L  R+  
Sbjct: 262 ESSFKQDSGIIYNARDMSIVLAKRLGVPVVLCSATPALETMHNVNQGKYHHVVLKQRFGE 321

Query: 385 SALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGN 444
           + +P + V+DMR   + + + LS  + D I  TLA+  Q +LFLNRRGYA L LC+ CG 
Sbjct: 322 AVMPDITVVDMRKDQLLR-EWLSSALHDKITSTLAKGNQAMLFLNRRGYARLVLCKKCGY 380

Query: 445 RLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCE 504
           ++ C +C  WL EH+    L CH C +S    Q C  C     M+  G G+ER+AE + E
Sbjct: 381 KISCPNCCTWLTEHKRLDGLLCHYCAYSCAVPQQCPDCTKHNTMMPYGVGVERVAEGIKE 440

Query: 505 YFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGD 564
             P A ++I+SSD+     R+   +  I +GE++II+GTQ++AKGHNFP+++LVGV+D D
Sbjct: 441 LIPEANVAIISSDVNTK--RITRTIEQIMEGEVNIIVGTQIIAKGHNFPKLTLVGVIDAD 498

Query: 565 LGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYES 624
           LG+ N+DLR++E+T+QLL QV+GR+GRF  K   ++Q + P  PV+Q+L+S + + FY +
Sbjct: 499 LGMGNSDLRATEKTYQLLHQVSGRSGRFEEKGEVVLQTHGPESPVIQSLMSCEREDFYNA 558

Query: 625 EIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVR 684
           E+ +R+  ++PP+ RL A+I+SG +   V + + ++  +  R   I V+GPA +P+ +V 
Sbjct: 559 ELHSRKITDMPPYTRLVAIIVSGKEEFRVVDTSKDIVAYLSRH--ITVWGPAPAPMSLVN 616

Query: 685 GRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           G YR+R+L+       ++   ++  D   K    +RV  D+DP NF
Sbjct: 617 GVYRYRMLMKISNIMAVRKILTECRDRYTKLGR-VRVVIDVDPVNF 661


>gi|238650305|ref|YP_002916157.1| primosome assembly protein PriA [Rickettsia peacockii str. Rustic]
 gi|238624403|gb|ACR47109.1| primosome assembly protein PriA [Rickettsia peacockii str. Rustic]
          Length = 648

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 240/540 (44%), Positives = 354/540 (65%), Gaps = 6/540 (1%)

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           N  F LP L + Q+    Q V +  +    +L+ GVTGSGKTE+Y  ++A  L  GKQVL
Sbjct: 114 NNNFVLPDLLEEQK----QAVTILNESNKPTLVKGVTGSGKTEIYFHLIADYLAKGKQVL 169

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           ++LPEI+L++ I+ RF +RFG +P  W+SS++ + ++ I R +    + V++G RS+LFL
Sbjct: 170 VMLPEIALSTQIINRFIERFGFEPIIWNSSVTKAHKKMILRGILSDKVKVVIGARSSLFL 229

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LGLIVIDEEHD SYKQ++GILYNARD +IVRG  +   +VL SATPSIE+  N   
Sbjct: 230 PFKNLGLIVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSIETIHNIEI 289

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  V L  RY+N ALP++++IDM  + +++   LS  +I+ I+  L   +Q LLFLNR
Sbjct: 290 GKYQLVTLVNRYKNVALPNIEIIDMTKEKLSKNSYLSKLLIEAIKGNLDNKKQVLLFLNR 349

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPL LC+ CG+RL C  CS W+V H++ KKL CH CG+ +    SC  C     +  
Sbjct: 350 RGYAPLMLCKACGHRLTCKFCSSWMVVHKATKKLECHHCGYQSKIFSSCPECLEDETLTI 409

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
           CG GIERI EE    FP ++I+++S D      ++   L  +   EIDI+IGTQ++ KG+
Sbjct: 410 CGPGIERIEEEAKALFPESKIAVISKDHAKSPEKIAQLLHQMENLEIDILIGTQIITKGY 469

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LVGV+D DLG  NADLR+SERTFQLL QV GRAGR   K +  +Q+Y P + + 
Sbjct: 470 HFPNLTLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNTIF 529

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
             + +GD DSF+ +E+  R+S ++PPF + A+VI+SG+   ++   A ++   AP+ +++
Sbjct: 530 SYVKAGDEDSFFANELEIRKSADMPPFSKTASVILSGSSEAKILEIARDMVRIAPK-ANV 588

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            + GPA S +  + G+YR+R+LI   +  NLQ +  + + + IK  +   ++ DIDP++F
Sbjct: 589 KILGPASSLMSKLAGKYRYRILIIADKKFNLQKYL-KFWLSLIKIPSFCHLKIDIDPKSF 647



 Score = 52.4 bits (124), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 66/123 (53%), Gaps = 13/123 (10%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW---YNSEEKYKIDSLKLR- 73
           ILL  A   P  Y +P  +++ +G +V VP R++ + GIVW    NSE K KI +++ + 
Sbjct: 6   ILLPVAKLFPLDYLIPEDLELNIGDLVVVPFRNKELTGIVWELVSNSEAK-KIKTIRAKV 64

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGIF 130
           P+        ++ ++ E +KW++ Y  S +G +A++V+    A    +  E+K+    + 
Sbjct: 65  PLNL-----NITSEVLELIKWMSSYYMSELGSIAKLVLPMDIAEKPIKVKEQKVNNNFVL 119

Query: 131 PRI 133
           P +
Sbjct: 120 PDL 122


>gi|56416933|ref|YP_154007.1| primosomal protein N' [Anaplasma marginale str. St. Maries]
 gi|222475299|ref|YP_002563716.1| primosomal protein N' (priA) [Anaplasma marginale str. Florida]
 gi|56388165|gb|AAV86752.1| primosomal protein N' [Anaplasma marginale str. St. Maries]
 gi|222419437|gb|ACM49460.1| primosomal protein N' (priA) [Anaplasma marginale str. Florida]
          Length = 662

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 268/706 (37%), Positives = 403/706 (57%), Gaps = 66/706 (9%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQ 87
           + YSV   M++ +G  VRVP  +R  +GI+   +        ++L+ I      PP+ R 
Sbjct: 19  FYYSVREDMELSVGDYVRVPFGNRVAIGII--TTMRSGPAPDMELKDIGDKIPLPPVQRP 76

Query: 88  MCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKD 147
           + EF+KWV+ Y   P+G+V +MV+ ++                     VA+ R+      
Sbjct: 77  LMEFLKWVSSYNIMPIGMVLKMVLGSV--------------------IVAKSRMFGT--- 113

Query: 148 GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVV 207
                                         Q ++   P  +SP L  S   L   Q    
Sbjct: 114 ------------------------------QEYKCCVPTDNSPALSTS-AALSGEQLKAR 142

Query: 208 EQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH--LGKQVLILLPEISLTSAILER 265
           +Q+V   + GF+V+++ G TGSGKTEVY   +A +LH  L  QVLILLPEI L + +++R
Sbjct: 143 DQIVGRLS-GFSVTVLDGKTGSGKTEVYCAAIAKLLHDCLDAQVLILLPEIVLATQLMKR 201

Query: 266 FQKRF-GVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEH 324
               F G  P EWHS L+   R + W  +  GA S++VG RSALFLPFK L +IV+DEEH
Sbjct: 202 VHSYFAGCNPVEWHSGLTAKQRRENWLAITYGASSIVVGARSALFLPFKNLKMIVVDEEH 261

Query: 325 DISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRN 384
           + S+KQ+ GI+YNARDMSIV  K    PVVL SATP++E+  N    +YH V L  R+  
Sbjct: 262 ESSFKQDSGIIYNARDMSIVLAKRLGVPVVLCSATPALETMHNVNQGKYHHVVLKQRFGE 321

Query: 385 SALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGN 444
           + +P + V+DMR   + + + LS  + D I  TLA+  Q +LFLNRRGYA L LC+ CG 
Sbjct: 322 AVMPDITVVDMRKDQLLR-EWLSSALHDKITSTLAKGNQAMLFLNRRGYARLVLCKKCGY 380

Query: 445 RLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCE 504
           ++ C +C  WL EH+    L CH C +S    Q C  C     M+  G G+ER+AE + E
Sbjct: 381 KISCPNCCTWLTEHKRLDGLLCHYCAYSCAVPQQCPDCTKHNTMMPYGVGVERVAEGIKE 440

Query: 505 YFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGD 564
             P A ++I+SSD+     R+   +  I +GE++II+GTQ++AKGHNFP+++LVGV+D D
Sbjct: 441 LIPGANVAIISSDVSTK--RITRTIEQIMEGEVNIIVGTQIIAKGHNFPKLTLVGVIDAD 498

Query: 565 LGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYES 624
           LG+ N+DLR++E+T+QLL QV+GR+GRF  K   ++Q + P  PV+Q+L+S + + FY +
Sbjct: 499 LGMGNSDLRATEKTYQLLHQVSGRSGRFEEKGEVVLQTHGPESPVIQSLMSCEREDFYNA 558

Query: 625 EIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVR 684
           E+ +R+  ++PP+ RL A+I+SG +   V + + ++  +  R   I V+GPA +P+ +V 
Sbjct: 559 ELHSRKITDMPPYTRLVAIIVSGKEEFRVVDTSKDIVAYLSRH--ITVWGPAPAPMSLVN 616

Query: 685 GRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           G YR+R+L+       ++   ++  D   K    +RV  D+DP NF
Sbjct: 617 GVYRYRMLMKISNIMAVRKILTECRDRYTKLGR-VRVVIDVDPVNF 661


>gi|157828670|ref|YP_001494912.1| primosome assembly protein PriA [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933389|ref|YP_001650178.1| primosome assembly protein PriA [Rickettsia rickettsii str. Iowa]
 gi|157801151|gb|ABV76404.1| primosome assembly protein PriA [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908476|gb|ABY72772.1| primosomal protein N' [Rickettsia rickettsii str. Iowa]
          Length = 648

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 239/540 (44%), Positives = 353/540 (65%), Gaps = 6/540 (1%)

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           N  F LP L + Q+    Q V +  +    +L+ GVTGSGKTE+Y  ++A  L  GKQVL
Sbjct: 114 NNNFVLPDLSEEQK----QAVTILNESNKPTLVKGVTGSGKTEIYFHLIADYLAKGKQVL 169

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           ++LPEI+L++ I+ RF +RFG +P  W+SS++ + ++ I R +    + V++G RS+LFL
Sbjct: 170 VMLPEIALSTQIINRFIERFGFEPIIWNSSVTKAHKKMILRGILSDKVKVVIGARSSLFL 229

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LGLIVIDEEHD SYKQ++GILYNARD +IVRG  +   +VL SATPSIE+  N   
Sbjct: 230 PFKNLGLIVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSIETIHNIEI 289

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  V L  RY+N  LP++++IDM  + +++   LS  +I+ I+  L   +Q LLFLNR
Sbjct: 290 GKYQLVTLVNRYKNVDLPNIEIIDMTKEKLSKNSYLSKLLIEAIKGNLDNKKQVLLFLNR 349

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPL LC+ CG+RL C  CS W+V H++ KKL CH CG+ +    SC  C     +  
Sbjct: 350 RGYAPLMLCKACGHRLTCKFCSSWMVVHKATKKLECHHCGYQSKIFSSCPECLEDETLTI 409

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
           CG GIERI EE    FP ++I+++S D      ++   L  +   EIDI+IGTQ++ KG+
Sbjct: 410 CGPGIERIEEEAKALFPESKIAVISKDHAKSPEKIAQLLHQMENLEIDILIGTQIITKGY 469

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LVGV+D DLG  NADLR+SERTFQLL QV GRAGR   K +  +Q+Y P + + 
Sbjct: 470 HFPNLTLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNTIF 529

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
             + +GD DSF+ +E+  R+S ++PPF + A+VI+SG+   ++   A ++   AP+ +++
Sbjct: 530 SYVKAGDEDSFFANELEIRKSADMPPFSKTASVILSGSSEAKILEIARDMVRIAPK-ANV 588

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            + GPA S +  + G+YR+R+LI   +  NLQ +  + + + IK  +   ++ DIDP++F
Sbjct: 589 KILGPASSLMSKLAGKYRYRILIIADKKFNLQKYL-KFWLSLIKIPSFCHLKIDIDPKSF 647



 Score = 52.4 bits (124), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 67/124 (54%), Gaps = 13/124 (10%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW---YNSEEKYKIDSLKLR- 73
           ILL  A   P  Y +P  +++ +G +V VP R++ + GIVW    NSE K KI +++ + 
Sbjct: 6   ILLPVAKLFPLDYLIPEDLELNIGDLVVVPFRNKELTGIVWELVSNSEAK-KIKTIRAKV 64

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGIF 130
           P+        ++ ++ E +KW++ Y  S +G +A++V+    A    +  E+K+    + 
Sbjct: 65  PLNL-----NITSEVLELIKWMSSYYMSELGSIAKLVLPMDIAEKPIKVKEQKVNNNFVL 119

Query: 131 PRIN 134
           P ++
Sbjct: 120 PDLS 123


>gi|229586861|ref|YP_002845362.1| primosome assembly protein PriA [Rickettsia africae ESF-5]
 gi|228021911|gb|ACP53619.1| Primosomal protein N [Rickettsia africae ESF-5]
          Length = 648

 Score =  485 bits (1249), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 238/540 (44%), Positives = 353/540 (65%), Gaps = 6/540 (1%)

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           N  F LP L + Q+    Q V +  +    +L+ G+TGSGKTE+Y  ++A  L  GKQVL
Sbjct: 114 NNNFVLPDLSEEQK----QAVTILNESNKPTLVKGITGSGKTEIYFHLIADYLAKGKQVL 169

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           ++LPEI+L++ I+ RF +RFG +P  W+SS++ + ++ I R +    + V++G RS+LFL
Sbjct: 170 VMLPEIALSTQIINRFIERFGFEPIIWNSSVTKAHKKMILRGILSDKVKVVIGARSSLFL 229

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LGLIVIDEEHD SYKQ++GILYNARD +IVRG  +   +VL SATPSIE+  N   
Sbjct: 230 PFKNLGLIVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSIETIHNIEI 289

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  V L  RY+N  LP++++IDM  + +++   LS  +I+ I+  L   +Q LLFLNR
Sbjct: 290 GKYQLVTLVNRYKNVDLPNIEIIDMTKEKLSKNSYLSKLLIEAIKGNLDNKKQVLLFLNR 349

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPL LC+ CG+RL C  CS W+V H++ KKL CH CG+ +    SC  C     +  
Sbjct: 350 RGYAPLMLCKACGHRLTCKFCSSWMVVHKATKKLECHHCGYQSKIFSSCPECLEDETLTI 409

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
           CG GIERI EE    FP ++I+++S D      ++   L  +   EIDI+IGTQ++ KG+
Sbjct: 410 CGPGIERIEEEAKALFPESKIAVISKDHAKSPEKIAQLLHQMENLEIDILIGTQIITKGY 469

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LVGV+D DLG  NADLR+SERTFQLL QV GRAGR   K +  +Q+Y P + + 
Sbjct: 470 HFPNLTLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNTIF 529

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
             + +GD DSF+ +E+  R+S ++PPF + A+VI+SG+   ++   A ++   AP+ +++
Sbjct: 530 SYVKAGDEDSFFANELEIRKSADMPPFSKTASVILSGSSEAKILEIARDMVRIAPK-ANV 588

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            + GPA S +  + G+YR+R+LI   +  NLQ +  + + + IK  +   ++ DIDP++F
Sbjct: 589 KILGPASSLMSKLAGKYRYRILIIADKKFNLQKYL-KFWLSLIKIPSFCHLKIDIDPKSF 647



 Score = 53.1 bits (126), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 68/124 (54%), Gaps = 13/124 (10%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW---YNSEEKYKIDSLKLR- 73
           ILL  A   P  Y +P  +++ +G +V VP R++ + GIVW    NSE K KI +++++ 
Sbjct: 6   ILLPVAKLFPLDYLIPEDLELNIGDLVVVPFRNKELTGIVWELVSNSEAK-KIKTIRVKV 64

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGIF 130
           P+        ++ ++ E +KW++ Y  S +G +A++V+    A    +  E+K+    + 
Sbjct: 65  PLNL-----NITSEVLELIKWMSSYYMSELGSIAKLVLPMDIAEKPIKVKEQKVNNNFVL 119

Query: 131 PRIN 134
           P ++
Sbjct: 120 PDLS 123


>gi|255003283|ref|ZP_05278247.1| primosomal protein N' (priA) [Anaplasma marginale str. Puerto Rico]
          Length = 648

 Score =  485 bits (1249), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 268/706 (37%), Positives = 403/706 (57%), Gaps = 66/706 (9%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQ 87
           + YSV   M++ +G  VRVP  +R  +GI+   +        ++L+ I      PP+ R 
Sbjct: 5   FYYSVREDMELSVGDYVRVPFGNRVAIGII--TTMRSGPAPDMELKDIGDKIPLPPVQRP 62

Query: 88  MCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIKD 147
           + EF+KWV+ Y   P+G+V +MV+ ++                     VA+ R+      
Sbjct: 63  LMEFLKWVSSYNIMPIGMVLKMVLGSV--------------------IVAKSRMFGT--- 99

Query: 148 GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVV 207
                                         Q ++   P  +SP L  S   L   Q    
Sbjct: 100 ------------------------------QEYKCCVPTDNSPALSTS-AALSGEQLKAR 128

Query: 208 EQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH--LGKQVLILLPEISLTSAILER 265
           +Q+V   + GF+V+++ G TGSGKTEVY   +A +LH  L  QVLILLPEI L + +++R
Sbjct: 129 DQIVGRLS-GFSVTVLDGKTGSGKTEVYCAAIAKLLHDCLDAQVLILLPEIVLATQLMKR 187

Query: 266 FQKRF-GVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEH 324
               F G  P EWHS L+   R + W  +  GA S++VG RSALFLPFK L +IV+DEEH
Sbjct: 188 VHSYFAGCNPVEWHSGLTAKQRRENWLAITYGASSIVVGARSALFLPFKNLKMIVVDEEH 247

Query: 325 DISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRN 384
           + S+KQ+ GI+YNARDMSIV  K    PVVL SATP++E+  N    +YH V L  R+  
Sbjct: 248 ESSFKQDSGIIYNARDMSIVLAKRLGVPVVLCSATPALETMHNVNQGKYHHVVLKQRFGE 307

Query: 385 SALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGN 444
           + +P + V+DMR   + + + LS  + D I  TLA+  Q +LFLNRRGYA L LC+ CG 
Sbjct: 308 AVMPDITVVDMRKDQLLR-EWLSSALHDKITSTLAKGNQAMLFLNRRGYARLVLCKKCGY 366

Query: 445 RLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCE 504
           ++ C +C  WL EH+    L CH C +S    Q C  C     M+  G G+ER+AE + E
Sbjct: 367 KISCPNCCTWLTEHKRLDGLLCHYCAYSCAVPQQCPDCTKHNTMMPYGVGVERVAEGIKE 426

Query: 505 YFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGD 564
             P A ++I+SSD+     R+   +  I +GE++II+GTQ++AKGHNFP+++LVGV+D D
Sbjct: 427 LIPGANVAIISSDVSTK--RITRTIEQIMEGEVNIIVGTQIIAKGHNFPKLTLVGVIDAD 484

Query: 565 LGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYES 624
           LG+ N+DLR++E+T+QLL QV+GR+GRF  K   ++Q + P  PV+Q+L+S + + FY +
Sbjct: 485 LGMGNSDLRATEKTYQLLHQVSGRSGRFEEKGEVVLQTHGPESPVIQSLMSCEREDFYNA 544

Query: 625 EIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVR 684
           E+ +R+  ++PP+ RL A+I+SG +   V + + ++  +  R   I V+GPA +P+ +V 
Sbjct: 545 ELHSRKITDMPPYTRLVAIIVSGKEEFRVVDTSKDIVAYLSRH--ITVWGPAPAPMSLVN 602

Query: 685 GRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           G YR+R+L+       ++   ++  D   K    +RV  D+DP NF
Sbjct: 603 GVYRYRMLMKISNIMAVRKILTECRDRYTKLGR-VRVVIDVDPVNF 647


>gi|34581552|ref|ZP_00143032.1| possible primosomal protein N [Rickettsia sibirica 246]
 gi|28262937|gb|EAA26441.1| possible primosomal protein N [Rickettsia sibirica 246]
          Length = 648

 Score =  485 bits (1248), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 238/540 (44%), Positives = 353/540 (65%), Gaps = 6/540 (1%)

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           N  F LP L + Q+    Q V +  +    +L+ GVTGSGKTE+Y  ++A  L  GKQVL
Sbjct: 114 NNNFVLPDLSEEQK----QAVTILNESNKPTLVKGVTGSGKTEIYFHLIADYLAKGKQVL 169

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           ++LPEI+L++ I+ RF +RFG +P  W+SS++ + ++ I R +    + V++G RS+LFL
Sbjct: 170 VMLPEIALSTQIINRFIERFGFEPIIWNSSVTKAHKKMILRGILSDKVKVVIGARSSLFL 229

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LGLIVIDEEHD SYKQ++GILYNARD +IVRG  +   +VL SATPSIE+  N   
Sbjct: 230 PFKNLGLIVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSIETIHNIEI 289

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  V L  RY+N  LP++++IDM  + +++   LS  +I+ I+  L   +Q LLFLNR
Sbjct: 290 GKYQLVTLVNRYKNVDLPNIEIIDMTKEKLSKNSYLSKLLIEAIKGNLDNKKQVLLFLNR 349

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPL LC+ CG+RL C  CS W+V H++ KKL CH CG+ +    SC  C     +  
Sbjct: 350 RGYAPLMLCKACGHRLTCKFCSAWMVVHKATKKLECHHCGYQSKIFSSCPECLEDETLTI 409

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
           CG GIERI EE    FP ++I+++S D      ++   L  +   EIDI+IGTQ++ KG+
Sbjct: 410 CGPGIERIEEEAKALFPESKIAVISKDHAKSPEKIAQLLHQMENLEIDILIGTQIITKGY 469

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LVGV+D DLG  NADLR+SERTFQLL QV GRAGR   K +  +Q+Y P + + 
Sbjct: 470 HFPNLTLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNTIF 529

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
             + +GD DSF+ +E+  R+S ++PPF + A++I+SG+   ++   A ++   AP+ +++
Sbjct: 530 SYVKAGDEDSFFANELEIRKSADMPPFSKTASIILSGSSEAKILEIARDMVGIAPK-ANV 588

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            + GPA S +  + G+YR+R+LI   +  NLQ +  + + + IK  +   ++ DIDP++F
Sbjct: 589 KILGPASSLMSKLAGKYRYRILIIADKKFNLQKYL-KFWLSLIKIPSFCHLKIDIDPKSF 647



 Score = 53.5 bits (127), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 68/124 (54%), Gaps = 13/124 (10%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW---YNSEEKYKIDSLKLR- 73
           ILL  A   P  Y +P  +++ +G +V VP R++ + GIVW    NSE K KI +++++ 
Sbjct: 6   ILLPVAKLFPLDYLIPEDLELNIGDLVVVPFRNKELTGIVWELVSNSEAK-KIKTIRVKV 64

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGIF 130
           P+        ++ ++ E +KW++ Y  S +G +A++V+    A    +  E+K+    + 
Sbjct: 65  PLNL-----NITSEVLELIKWMSSYYMSELGSIAKLVLPMDIAEKPIKVKEQKVNNNFVL 119

Query: 131 PRIN 134
           P ++
Sbjct: 120 PDLS 123


>gi|15892723|ref|NP_360437.1| primosome assembly protein PriA [Rickettsia conorii str. Malish 7]
 gi|61215292|sp|Q92HH1|PRIA_RICCN RecName: Full=Primosomal protein N'; AltName: Full=ATP-dependent
           helicase priA; AltName: Full=Replication factor Y
 gi|15619899|gb|AAL03338.1| possible primosomal protein N [Rickettsia conorii str. Malish 7]
          Length = 648

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 239/540 (44%), Positives = 352/540 (65%), Gaps = 6/540 (1%)

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           N  F LP L + Q+    Q V +  +    +L+ GVTGSGKTE+Y  ++A  L  GKQVL
Sbjct: 114 NNNFVLPDLSEEQK----QAVTILNESNKPTLVKGVTGSGKTEIYFHLIADYLAKGKQVL 169

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           ++LPEI+L++ I+ RF +RFG +P  W+SS++ + ++ I R +    + V++G RS+LFL
Sbjct: 170 VMLPEIALSTQIINRFIERFGFEPIIWNSSVTKAHKKMILRGILSDKVKVVIGARSSLFL 229

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LGLIVIDEEHD SYKQ++GILYNARD +IVRG  +   +VL SATPSIE+  N   
Sbjct: 230 PFKNLGLIVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSIETIHNIEI 289

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  V L  RY+N  LP++++IDM  + +++   LS  +I+ I+  L   +Q LLFLNR
Sbjct: 290 GKYQLVTLVNRYKNVDLPNIEIIDMTKEKLSKNSYLSKLLIEAIKGNLDNKKQVLLFLNR 349

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPL LC+ CG RL C  CS W+V H++ KKL CH CG+ +    SC  C     +  
Sbjct: 350 RGYAPLMLCKACGYRLTCKFCSSWMVVHKATKKLECHHCGYQSKIFSSCPECLEDETLTI 409

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
           CG GIERI EE    FP ++I+++S D      ++   L  +   EIDI+IGTQ++ KG+
Sbjct: 410 CGPGIERIEEEAKALFPESKIAVISKDHAKSPEKIAQLLHQMENLEIDILIGTQIITKGY 469

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LVGV+D DLG  NADLR+SERTFQLL QV GRAGR   K +  +Q+Y P + + 
Sbjct: 470 HFPNLTLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNTIF 529

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
             + +GD DSF+ +E+  R+S ++PPF + A+VI+SG+   ++   A ++   AP+ +++
Sbjct: 530 SYVKAGDEDSFFANELEIRKSADMPPFSKTASVILSGSSEAKILEIARDMVRIAPK-ANV 588

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            + GPA S +  + G+YR+R+LI   +  NLQ +  + + + IK  +   ++ DIDP++F
Sbjct: 589 KILGPASSLMSKLAGKYRYRILIIANKKFNLQKYL-KFWLSLIKIPSFCHLKIDIDPKSF 647



 Score = 53.1 bits (126), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 68/124 (54%), Gaps = 13/124 (10%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW---YNSEEKYKIDSLKLR- 73
           ILL  A   P  Y +P  +++ +G +V VP R++ + GIVW    NSE K KI +++++ 
Sbjct: 6   ILLPVAKLFPLDYLIPEDLELNIGDLVVVPFRNKELTGIVWELVSNSEAK-KIKTIRVKV 64

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGIF 130
           P+        ++ ++ E +KW++ Y  S +G +A++V+    A    +  E+K+    + 
Sbjct: 65  PLNL-----NITSEVLELIKWMSSYYMSELGSIAKLVLPMDIAEKPIKVKEQKVNNNFVL 119

Query: 131 PRIN 134
           P ++
Sbjct: 120 PDLS 123


>gi|51473723|ref|YP_067480.1| primosome assembly protein PriA [Rickettsia typhi str. Wilmington]
 gi|61214906|sp|Q68WJ4|PRIA_RICTY RecName: Full=Primosomal protein N'; AltName: Full=ATP-dependent
           helicase priA; AltName: Full=Replication factor Y
 gi|51460035|gb|AAU03998.1| primosomal protein N prime [Rickettsia typhi str. Wilmington]
          Length = 648

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 264/707 (37%), Positives = 401/707 (56%), Gaps = 77/707 (10%)

Query: 27  PYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW---YNSEEKYKIDSLKLRPIEYVFDCPP 83
           P  Y +   +++ +G +V V  R++ + GIVW    NSE K         P+        
Sbjct: 15  PLDYLITEDLELNIGDLVVVHFRNQELTGIVWELATNSEAKKIKTIKAKVPLNL-----N 69

Query: 84  LSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLD 143
           +S ++   +KW++ Y  S +G +A++V+                     IN         
Sbjct: 70  ISLEVLALIKWMSSYYMSELGSIAKLVLP--------------------IN--------- 100

Query: 144 KIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQ 203
                 I EK   I+  QV ++ +                            LP L + Q
Sbjct: 101 ------IAEKPIKIKEQQVKNYFV----------------------------LPQLSEEQ 126

Query: 204 QDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAIL 263
           +    Q V +  +    +LI GVTGSGKTE+Y  I+A  L  G+QVLI+LPEI+L+  I+
Sbjct: 127 K----QAVTIFNESNKPTLIKGVTGSGKTEIYFHIIADHLMKGQQVLIMLPEIALSRQII 182

Query: 264 ERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEE 323
            RF  RFG +P  W+SS++ + ++ I R +    + V++G RS+LFLPF  LGLIVIDEE
Sbjct: 183 NRFIDRFGFEPIIWNSSVTKAQKKMILRGILSDKVKVVIGARSSLFLPFHNLGLIVIDEE 242

Query: 324 HDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYR 383
           HD SYKQ++ ILYNARD +IVRG  +   +VL SATPS+E+  N  + +Y  V L  RY+
Sbjct: 243 HDDSYKQDDNILYNARDTAIVRGVFDKAKIVLCSATPSLETIYNIKTHKYQLVTLVNRYK 302

Query: 384 NSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCG 443
           N  LP++++IDM  + + +   LS  +ID I+  L   +Q LLFLNRRGYAPL LC+ CG
Sbjct: 303 NIDLPNIEIIDMTKEKLPKNSYLSKILIDAIKGNLENKKQVLLFLNRRGYAPLMLCKACG 362

Query: 444 NRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVC 503
           +R  C  CS W+V H++ K L CH CG+ +    SC  C     +  CG GIERI EE  
Sbjct: 363 HRFTCRFCSAWMVLHKATKTLECHHCGYQSKIFSSCPECLEDETLTICGPGIERIEEEAM 422

Query: 504 EYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDG 563
             FP ++I+++S D      ++   L  +   EIDI+IGTQ++ KG++FP ++LVGV+D 
Sbjct: 423 LLFPKSKIAVISKDHAKTPAKIAQLLHQMENLEIDILIGTQIITKGYHFPNLTLVGVIDA 482

Query: 564 DLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYE 623
           DLG  NA+LR+SERTFQLL QV GRAGR   K +  +Q+Y P + +   +  GD DSF+ 
Sbjct: 483 DLGSNNAELRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNIIFSYVKVGDEDSFFT 542

Query: 624 SEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMV 683
           +E+  R++ N+PPF + A++I+SG    ++ + A N+ + AP+ +++ + GPA + +  +
Sbjct: 543 NELEIRKAANMPPFSKTASLILSGFSESKILDIAKNIVQIAPK-ANVKILGPARALMSKL 601

Query: 684 RGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            G+YR+R+LI   +  NLQ +  + + + IK  +  +++ DIDP+ F
Sbjct: 602 AGKYRYRILIIADKKFNLQQYL-KFWLSLIKIPSYCQIKIDIDPKTF 647


>gi|157803636|ref|YP_001492185.1| primosome assembly protein PriA [Rickettsia canadensis str. McKiel]
 gi|157784899|gb|ABV73400.1| primosome assembly protein PriA [Rickettsia canadensis str. McKiel]
          Length = 648

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 241/537 (44%), Positives = 348/537 (64%), Gaps = 6/537 (1%)

Query: 194 FSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           F LP L + Q+    Q V +  +     +I GVTGSGKTE+Y  ++A  L  GKQVLI+L
Sbjct: 117 FILPDLSEEQK----QAVTVLNESNKPVIIKGVTGSGKTEIYFHLIADYLVKGKQVLIML 172

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI+L++ I+ RF +RFG +P  W+SS++ + ++ I R +    + V++G RS+LFLPFK
Sbjct: 173 PEIALSTQIINRFIERFGFEPIIWNSSVTKAQKQMILRGILIDKVKVVIGARSSLFLPFK 232

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LGLIVIDEEHD SYKQ++GILYNARD +IVRG  +   +VL SATPSIE+  N    +Y
Sbjct: 233 NLGLIVIDEEHDESYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSIETMYNVDLGKY 292

Query: 374 HSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGY 433
             ++L  RY+N+ LP+++VIDM  + + +   LS  +I+ I+  LA  +QTLLFLNRRGY
Sbjct: 293 RLINLINRYKNAHLPNIEVIDMTKEKLPKNSYLSKILIEAIKANLANKKQTLLFLNRRGY 352

Query: 434 APLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGF 493
           APL LC+ CG RL C +CS W+V H++ KKL CH CG+ +     C  C     +  CG 
Sbjct: 353 APLMLCKACGYRLTCKYCSSWMVVHKANKKLECHHCGYQSKIFSVCPECLEDATLTICGP 412

Query: 494 GIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFP 553
           GIERI EE    FP  +I+++S D      ++   L  I   EIDI+IGTQ++ KG++FP
Sbjct: 413 GIERIEEEAKALFPERKIAVISKDHAKNTEKIAQILHQIENLEIDILIGTQMITKGYHFP 472

Query: 554 RMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQAL 613
            ++LVGV+D DLG  NADLR+SERTFQLL QV GRAGR   K L  +Q+Y P + +   +
Sbjct: 473 NLTLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDSKGLVYLQSYCPNNIIFSYV 532

Query: 614 VSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVF 673
                DSF+  E+  R+S  +PPF ++A+VI+SG    ++   A N+   AP+ +++ + 
Sbjct: 533 KVSYEDSFFAHELEIRKSAYMPPFSKMASVILSGASEHKILAIAKNMVRIAPK-ANVKIL 591

Query: 674 GPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           GPA S +  + G+YR+R+LI   +  NLQ +  + + + IK  +  +++ DIDP++F
Sbjct: 592 GPASSLMSKLAGKYRYRILIIADKKFNLQKYL-KFWLSLIKIPSFCQIKIDIDPKSF 647



 Score = 46.2 bits (108), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 61/122 (50%), Gaps = 9/122 (7%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW--YNSEEKYKIDSLKLRPI 75
           ILL  A   P  Y +P  + V +G +V V  R++ + GIVW   +  E  K+ ++  R +
Sbjct: 6   ILLPVAKLFPLDYLIPKDLSVNIGDLVIVSFRNKELTGIVWELVSDSEIQKLKTIH-RKV 64

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGIFPR 132
               +  P   ++ E +KW++ Y  S +G +A++V+    A    +  E+K+    I P 
Sbjct: 65  SLNLNITP---EVLELIKWMSVYYMSELGSIAKLVLPIDIAAKPIKIKEQKVNNDFILPD 121

Query: 133 IN 134
           ++
Sbjct: 122 LS 123


>gi|67459250|ref|YP_246874.1| primosome assembly protein PriA [Rickettsia felis URRWXCal2]
 gi|75536318|sp|Q4UL64|PRIA_RICFE RecName: Full=Primosomal protein N'; AltName: Full=ATP-dependent
           helicase priA; AltName: Full=Replication factor Y
 gi|67004783|gb|AAY61709.1| Primosomal protein N' [Rickettsia felis URRWXCal2]
          Length = 648

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 240/540 (44%), Positives = 349/540 (64%), Gaps = 6/540 (1%)

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           N  F LP L + Q+    Q V +  +    +LI GVTGSGKTE+Y  ++A  L  GKQVL
Sbjct: 114 NNSFVLPDLSEEQK----QAVTILNESNKPTLIKGVTGSGKTEIYFHLIADYLVKGKQVL 169

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           I+LPEI+L++ I+ RF +RFG +P  W+SS++ + ++ I R +    + V++G RS+LFL
Sbjct: 170 IMLPEIALSTQIINRFIERFGFEPIIWNSSVTKAQKKMILRGILSDKVKVVIGARSSLFL 229

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LGL+VIDEEHD SYKQ++GILYNARD +IVRG  +   +VL SATPSIE+  N   
Sbjct: 230 PFKNLGLVVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSIETMYNIEI 289

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  V L  RY N  LP++++IDM  + +++   LS  +I+ I+  L   +Q LLFLNR
Sbjct: 290 GKYQLVTLVNRYNNVDLPNIEIIDMTKEKLSKNSYLSKILIEAIKDNLDNKKQVLLFLNR 349

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPL LC+ CG+R  C  CS W+V H++ KKL CH CG+ +    SC  C     +  
Sbjct: 350 RGYAPLMLCKACGHRFTCKFCSSWMVVHKATKKLECHHCGYQSKIFSSCPECLEDETLTI 409

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
           CG GIERI EE    FP  +I+++S D      R+   L  +   EIDI+IGTQ++ KG+
Sbjct: 410 CGPGIERIEEEAKALFPENKIAVISKDHAKNPERIAQLLHQMENLEIDILIGTQMITKGY 469

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LVGV+D DLG  NADLR+SERTFQLL QV GRAGR   K +  +Q+Y P + + 
Sbjct: 470 HFPNLTLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDGKGVVYLQSYYPDNIIF 529

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
             + +GD DSF+ +E+  R+S ++PPF + A+VI+SG+   ++   A  +   AP+ +++
Sbjct: 530 SYVKAGDEDSFFANELEIRKSADMPPFSKTASVILSGSNESKILEIARAMVRIAPK-ANV 588

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            + GPA S +  + G+YR+R+LI   +  NLQ +  + + + IK  +   ++ DIDP++F
Sbjct: 589 KILGPASSLMSKLAGKYRYRILIIADKKFNLQKYL-KFWLSLIKIPSFCHLKIDIDPKSF 647



 Score = 51.2 bits (121), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 67/123 (54%), Gaps = 11/123 (8%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSE--EKYKIDSLKLR-P 74
           ILL  A   P  Y +P ++ + +G +V VP RS+ + GIVW  +   E  K+ ++K + P
Sbjct: 6   ILLPAAKLFPLDYLIPESLVLNIGDLVIVPFRSKELTGIVWEFATIPEASKLKTVKEKVP 65

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGIFP 131
           ++       ++ ++ E +KW++ Y  S +G +A++V+    A    +  E+K+  + + P
Sbjct: 66  LDL-----SITSEVLELIKWLSSYYMSELGSIAKLVLPIDIAEKPIKVKEQKVNNSFVLP 120

Query: 132 RIN 134
            ++
Sbjct: 121 DLS 123


>gi|91205740|ref|YP_538095.1| primosome assembly protein PriA [Rickettsia bellii RML369-C]
 gi|123266194|sp|Q1RI08|PRIA_RICBR RecName: Full=Primosomal protein N'; AltName: Full=ATP-dependent
           helicase priA; AltName: Full=Replication factor Y
 gi|91069284|gb|ABE05006.1| Primosomal protein N' [Rickettsia bellii RML369-C]
          Length = 648

 Score =  483 bits (1243), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 236/540 (43%), Positives = 348/540 (64%), Gaps = 6/540 (1%)

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           N  F+LP L + Q+    Q + +        LI GVTGSGKTEVY  ++A  L  GKQ L
Sbjct: 114 NNNFTLPDLSEEQK----QALQMLNDSNKPILIKGVTGSGKTEVYFYLIAEYLAKGKQAL 169

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           ++LPEI+L++ I+ RF++RFG  P  W+SS++ + ++ I R +    + +++G RS+LFL
Sbjct: 170 VMLPEIALSTQIINRFKERFGFDPIIWNSSVTKAQKKMILRGILEDKVKIVIGARSSLFL 229

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LGLIVIDEEHD SYKQ++G+LYNARD +IVR   +   +VL SATPSIE+  N   
Sbjct: 230 PFKNLGLIVIDEEHDDSYKQDDGVLYNARDTAIVRSTFDKAQIVLCSATPSIETMYNANI 289

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  ++LS+RY+N+ LP++++IDM  + + +   LS  +I  I++ L   EQTLLFLNR
Sbjct: 290 GKYSVINLSSRYKNAVLPNIEMIDMTKEELPKNCYLSNILIKAIKNNLENKEQTLLFLNR 349

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPL LC+ CG++  C +CS W+V H+S KKL CH CG+ +    SC  C     +  
Sbjct: 350 RGYAPLMLCKSCGHKFTCKYCSSWMVVHKSSKKLECHHCGYQSKIFNSCPECLEDESLAI 409

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
           CG GIERI EE    FP ++I+++S D      ++   L  +   EIDI+IGTQ++ KG+
Sbjct: 410 CGPGIERIEEEAKTLFPNSKIAVISKDHVKNPEKIAQLLHQMENLEIDILIGTQMITKGY 469

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LVGVVD DLG  +ADLRSSER FQLL QV GRAGR   K +  +Q+Y P + + 
Sbjct: 470 HFPNLTLVGVVDADLGSNHADLRSSERAFQLLHQVGGRAGRGNSKGMVYLQSYYPDNIIF 529

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
             +     D+F+ +E+  R++ ++PPF ++A+VI+SGT   ++   A N+   AP +  +
Sbjct: 530 SYIKDEREDNFFVNELEVRKAADMPPFSKMASVILSGTNEHKILEVAKNMVRIAPEAQ-V 588

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            + GPA S +  + G+YRFR+LI   +  NLQ +  + +   IK  +   ++ DIDP++F
Sbjct: 589 KILGPASSLMSKLAGKYRFRILIIADKKFNLQKYL-KFWLELIKIPSFCHIKIDIDPKSF 647



 Score = 49.3 bits (116), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 56/97 (57%), Gaps = 9/97 (9%)

Query: 19  LLLQAVS-GPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW--YNSEEKYKIDSLKLR-P 74
           +LL AV   P  Y +P  + + +G +V VP R++ + GIVW   N  E  K+ ++K + P
Sbjct: 6   ILLSAVKLFPLDYLIPEDLSLNIGDLVVVPFRNKELTGIVWEFSNVPEVKKLKTIKEKVP 65

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV 111
           +        ++ ++ + +KW+++Y  + +G +A++V+
Sbjct: 66  LNLT-----ITSEVLDLIKWMSNYYMAELGSIAKLVL 97


>gi|157964671|ref|YP_001499495.1| primosome assembly protein PriA [Rickettsia massiliae MTU5]
 gi|157844447|gb|ABV84948.1| Primosomal protein N' [Rickettsia massiliae MTU5]
          Length = 648

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 235/535 (43%), Positives = 351/535 (65%), Gaps = 6/535 (1%)

Query: 196 LPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPE 255
           LP L + Q+    Q V +  +    +L+ GVTGSGKTE+Y  ++A  L  GKQVL++LPE
Sbjct: 119 LPNLSEEQK----QAVTILNESNKPTLVKGVTGSGKTEIYFHLIADYLAKGKQVLVMLPE 174

Query: 256 ISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKL 315
           I+L++ I+ RF +RFG +P  W+SS++ + ++ I R +    + V++G RS+LFLPFK L
Sbjct: 175 IALSTQIINRFIERFGFEPIIWNSSVTKAHKKMILRGILSDKVKVVIGARSSLFLPFKNL 234

Query: 316 GLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHS 375
           GLIVIDEEHD SYKQ++GILYNARD +IVRG  +   +VL SATPSIE+  N    +Y  
Sbjct: 235 GLIVIDEEHDDSYKQDDGILYNARDTAIVRGTFDKAQIVLCSATPSIETIHNIERDKYQL 294

Query: 376 VHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAP 435
           V L  RY+N  +P++++IDM  + +++   LS  +I+ I+  L   +Q LLFLNRRGYAP
Sbjct: 295 VTLVNRYKNVDVPNIEIIDMTKEKLSKNSYLSKLLIEAIKGNLDNKKQVLLFLNRRGYAP 354

Query: 436 LTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGI 495
           L LC+ CG+R  C  CS W+V H++ KKL CH CG+ +    SC  C     +  CG GI
Sbjct: 355 LMLCKACGHRFTCKFCSSWMVVHKATKKLECHHCGYQSKIFSSCPECLEDETLTICGPGI 414

Query: 496 ERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRM 555
           ERI EE    FP ++I+++S D      ++   L  +   EIDI+IGTQ++ KG++FP +
Sbjct: 415 ERIEEEAKALFPESKIAVISKDHAKSPEKIAQLLHQMENLEIDILIGTQIITKGYHFPNL 474

Query: 556 SLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVS 615
           +LVGV+D DLG  NADLR+SERTFQLL QV GRAGR   K +  +Q+Y P + +   + +
Sbjct: 475 TLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNTIFSYVKA 534

Query: 616 GDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGP 675
           GD DSF+ +E++ R+S N+PPF + A+VI+SG+   ++   A ++   AP+ +++ + GP
Sbjct: 535 GDEDSFFANELKIRKSANMPPFSKTASVILSGSSEAKILEIARDMVRIAPK-ANVKILGP 593

Query: 676 AESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           A S +  + G+YR+R+LI   +  +LQ +  + + + IK  +   ++ DIDP++F
Sbjct: 594 ASSLMSKLAGKYRYRILIIADKKFSLQQYL-KFWLSLIKIPSFCHLKIDIDPKSF 647



 Score = 51.6 bits (122), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 63/115 (54%), Gaps = 13/115 (11%)

Query: 27  PYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWY---NSEEKYKIDSLKLR-PIEYVFDCP 82
           P  Y +P  +++ +G +V VP R++ + GIVW    NSE K KI +++ + P+       
Sbjct: 15  PLDYLIPEDLELNIGDLVVVPFRNKELTGIVWKLVSNSEAK-KIKTIRAKVPLNL----- 68

Query: 83  PLSRQMCEFVKWVADYTFSPMGLVARMVVS---ALSETEKMEEKIQFTGIFPRIN 134
            ++ ++ E +KW++ Y  S +G +A++V+    A    +  E+K+    + P ++
Sbjct: 69  NITSEVLELIKWMSSYYMSELGSIAKLVLPIDIAEKPIKVKEQKVNNNVVLPNLS 123


>gi|157827132|ref|YP_001496196.1| primosome assembly protein PriA [Rickettsia bellii OSU 85-389]
 gi|157802436|gb|ABV79159.1| primosome assembly protein PriA [Rickettsia bellii OSU 85-389]
          Length = 648

 Score =  482 bits (1241), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 236/540 (43%), Positives = 347/540 (64%), Gaps = 6/540 (1%)

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           N  F+LP L + Q+    Q + +        LI GVTGSGKTEVY  ++A  L  GKQ L
Sbjct: 114 NNNFTLPDLSEEQK----QALQMLNDSNKPILIKGVTGSGKTEVYFHLIAEYLAKGKQAL 169

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           ++LPEI+L++ I+ RF++RFG  P  W+SS++ + ++ I R +    + +++G RS+LFL
Sbjct: 170 VMLPEIALSTQIINRFKERFGFDPIIWNSSVTKAQKKMILRGILEDKVKIVIGARSSLFL 229

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LGLIVIDEEHD SYKQ++G+LYNARD +IVR   +   +VL SATPSIE+  N   
Sbjct: 230 PFKNLGLIVIDEEHDDSYKQDDGVLYNARDTAIVRSTFDKAQIVLCSATPSIETMYNANI 289

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  ++LS+RY+N+ LP++++IDM  + + +   LS  +I  I++ L   EQTLLFLNR
Sbjct: 290 GKYSVINLSSRYKNAVLPNIEMIDMTKEELPKNCYLSNILIKAIKNNLENKEQTLLFLNR 349

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPL LC+ CG++  C +CS W+V H+S KKL CH CG+ +    SC  C     +  
Sbjct: 350 RGYAPLMLCKSCGHKFTCKYCSSWMVVHKSSKKLECHHCGYQSKIFNSCPECLEDESLAI 409

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
           CG GIERI EE    FP ++I+++S D      ++   L  +   EIDI+IGTQ++ KG+
Sbjct: 410 CGPGIERIEEEAKTLFPNSKIAVISKDHVKNPEKIAQLLHQMENLEIDILIGTQMITKGY 469

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LVGVVD DLG  +ADLRSSER FQLL QV GRAGR   K +  +Q+Y P + + 
Sbjct: 470 HFPNLTLVGVVDADLGSNHADLRSSERAFQLLHQVGGRAGRGNSKGMVYLQSYYPDNIIF 529

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
             +     D+F+ +E+  R++  +PPF ++A+VI+SGT   ++   A N+   AP +  +
Sbjct: 530 SYIKDEREDNFFVNELEVRKAAYMPPFSKMASVILSGTNEHKILEVAKNMVRIAPEAQ-V 588

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            + GPA S +  + G+YRFR+LI   +  NLQ +  + +   IK  +   ++ DIDP++F
Sbjct: 589 KILGPASSLMSKLAGKYRFRILIIADKKFNLQKYL-KFWLELIKIPSFCHIKIDIDPKSF 647



 Score = 49.3 bits (116), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 56/97 (57%), Gaps = 9/97 (9%)

Query: 19  LLLQAVS-GPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVW--YNSEEKYKIDSLKLR-P 74
           +LL AV   P  Y +P  + + +G +V VP R++ + GIVW   N  E  K+ ++K + P
Sbjct: 6   ILLSAVKLFPLDYLIPEDLSLNIGDLVVVPFRNKELTGIVWEFSNVPEVKKLKTIKEKVP 65

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVV 111
           +        ++ ++ + +KW+++Y  + +G +A++V+
Sbjct: 66  LNLT-----ITSEVLDLIKWMSNYYMAELGSIAKLVL 97


>gi|157825861|ref|YP_001493581.1| primosome assembly protein PriA [Rickettsia akari str. Hartford]
 gi|157799819|gb|ABV75073.1| primosome assembly protein PriA [Rickettsia akari str. Hartford]
          Length = 648

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/540 (43%), Positives = 348/540 (64%), Gaps = 6/540 (1%)

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           N  F LP L + Q       V +  +     +I GVTGSGKTE+Y  ++A  L  GKQVL
Sbjct: 114 NHNFVLPNLSEEQN----MAVTVLNESSKPVIIKGVTGSGKTEIYFHLIADYLAKGKQVL 169

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           ++LPEI+L++ I+ RF +RFG +P  W+S+++ + ++ I R +    + V++G RS+LFL
Sbjct: 170 VMLPEIALSTQIINRFIERFGFEPIIWNSNVTKAQKKMILRGILSDKVKVVIGARSSLFL 229

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LGLIVIDEEHD SYKQ++GILYNARD +IVRG+ +   +VL SATPSIE+  N  +
Sbjct: 230 PFKNLGLIVIDEEHDDSYKQDDGILYNARDTAIVRGRFDKAQIVLCSATPSIETIYNIET 289

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  + L  RY++  LP++++IDM  + +A+   LS  +I  I+  L   +Q LLFLNR
Sbjct: 290 GKYQRITLVNRYKDVDLPNIEIIDMTKEKLAKNSYLSKLLIKAIKDNLDNKKQVLLFLNR 349

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGYAPL LC+ CG+R  C  CS W+V H+S KKL CH CG+ +    SC  C     +  
Sbjct: 350 RGYAPLMLCKTCGHRFTCKFCSSWMVVHKSTKKLECHHCGYQSKIFSSCPECLEGETLTI 409

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
           CG GIERI EE    FP ++I+++S D      ++   L  +   EIDI+IGTQ++ KG+
Sbjct: 410 CGPGIERIEEEAKALFPESKIALISKDHAKNPEKIVQLLHQMENLEIDILIGTQMITKGY 469

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LVGV+D DLG  NADLR+SERTFQLL QV GRAGR   K +  +Q+Y P + + 
Sbjct: 470 HFPYLTLVGVIDADLGSNNADLRASERTFQLLHQVGGRAGRGDSKGVVYLQSYYPDNIIF 529

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDI 670
             + +GD DSF+  E+  R+S ++PPF + A++I+SG+   ++   A ++   AP+ +++
Sbjct: 530 SYVKAGDEDSFFAHELEIRKSADMPPFSKTASIILSGSSESKILEIARDMVRIAPK-ANV 588

Query: 671 VVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
            + GPA S +  + G+YR+R+ I   +  NLQ +  + + + IK  +   ++ DIDP++F
Sbjct: 589 KILGPASSLMSKLAGKYRYRIFIIASKQFNLQKYL-KFWLSLIKIPSFCHLKIDIDPKSF 647



 Score = 45.4 bits (106), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 67/128 (52%), Gaps = 7/128 (5%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI-E 76
           ILL  A   P  Y +   +++ +G +V VP R++ + GI+W   E     ++ KL+ I E
Sbjct: 6   ILLPAAKLFPLDYLIAEDLELNIGDLVVVPFRNKELTGIIW---EFTTIPEAKKLKIIKE 62

Query: 77  YVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSA-LSET--EKMEEKIQFTGIFPRI 133
            V     ++ ++ E +KW++ Y  S +G +A++V+   +SE   +  E+K+    + P +
Sbjct: 63  KVPLNLNITLEVLELIKWMSSYYMSELGSIAKLVLPVDISEKPIKVKEQKVNHNFVLPNL 122

Query: 134 NTVARLRV 141
           +    + V
Sbjct: 123 SEEQNMAV 130


>gi|148260674|ref|YP_001234801.1| primosome assembly protein PriA [Acidiphilium cryptum JF-5]
 gi|146402355|gb|ABQ30882.1| primosomal protein N' [Acidiphilium cryptum JF-5]
          Length = 718

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 296/721 (41%), Positives = 402/721 (55%), Gaps = 11/721 (1%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +LL  A    + Y    A     G++V VPL  R V G+VW ++ E   I   +L+ +
Sbjct: 4   VSVLLPYAFDAAFTYEAREAPPPP-GAVVTVPLGRRIVHGVVWDDAPEP-GIAPARLKTL 61

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFP--RI 133
             V   P L   +  F+ WVA YT +P G V  + +                G  P  RI
Sbjct: 62  HAVIATPALPGPLRRFIDWVAQYTMAPRGEVLALALKTGLLDPPAPRAGWAAGAAPSGRI 121

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
            T  R RVLD +         +L  A+   + V+ GL   G+++       P V  P+  
Sbjct: 122 -TATRQRVLDALATLDRPTTAELAAAAGTGAAVVRGLADAGLLRPAAR--DPSVPLPDPD 178

Query: 194 FSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
            + P L   Q++    +        F V+L+ GVTG+GKTEV+ E +AA L  G+Q L+L
Sbjct: 179 HAPPALSAAQEEAAAALRASVAARRFEVTLLEGVTGAGKTEVFCEAIAACLREGRQALVL 238

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI+L++    RF  RFG  PA WHS L+ + R   +  VA GA  +++G RSALFLPF
Sbjct: 239 VPEIALSAQFAARFAARFGAAPALWHSGLTQATRRANYHAVASGAAKLVLGARSALFLPF 298

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
              GLIV+DEEH+ +YKQE+G+ Y+ARDM++VRG+I    V+L SATPS+ES VN  + R
Sbjct: 299 ADPGLIVVDEEHEAAYKQEDGVTYHARDMAVVRGRISGCAVILASATPSLESAVNAEAGR 358

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  + L+ R+  + LP ++ ID+R    A+G+ LSP +   +  TL    Q +LFLNRRG
Sbjct: 359 YRHITLAARHGGARLPAIEAIDLRAAPPARGRFLSPVLAGALETTLEGGGQAMLFLNRRG 418

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YAPLTLC+ CG+RL C +C+ WLVEHR    L CH CGH+A     C  C +    +  G
Sbjct: 419 YAPLTLCRGCGHRLTCPNCTAWLVEHRRPGHLLCHHCGHAAQVPAKCPDCAAEQSFVPIG 478

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G+ERIAEEV E FP AR  +++SD      + +  L AI   EID++IGTQ++AKG +F
Sbjct: 479 PGVERIAEEVAELFPAARTILMASDAITTAEQAEAALRAIVAHEIDLVIGTQMIAKGWHF 538

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P + LVGVVD DLGL   DLR+ ER  QLL QV GRAGR  L    L+Q Y P HPVM+A
Sbjct: 539 PDLVLVGVVDADLGLGGGDLRAGERGAQLLHQVAGRAGRGRLPGRVLLQTYAPEHPVMRA 598

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           L+  D   F  +E   R   + PPFGRLAA+I+S  +    +  A  L    PR   + V
Sbjct: 599 LIGNDLAGFRRAEADLRAPGHWPPFGRLAALIVSADEAATADAAAAALARTQPRDG-VQV 657

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRS--NALRVQFDIDPQNF 730
            GPA +P  M+RGR+R RLL+   R   +Q       D         A R+  DIDP +F
Sbjct: 658 LGPAPAPFAMLRGRHRRRLLLRAPRGIAVQPVLRAWLDRARAEGLPRAARIDIDIDPISF 717

Query: 731 L 731
           L
Sbjct: 718 L 718


>gi|88607600|ref|YP_504963.1| primosomal protein N' [Anaplasma phagocytophilum HZ]
 gi|88598663|gb|ABD44133.1| primosomal protein N' [Anaplasma phagocytophilum HZ]
          Length = 658

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 267/719 (37%), Positives = 406/719 (56%), Gaps = 70/719 (9%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDS-LKLRPIE 76
           +LL   +  P+ Y VP  +++ +G  VRVP  +R  LG+V   ++ K  I+S L+L+ I+
Sbjct: 5   VLLPIPLDRPFYYLVPDEIQISVGDYVRVPFGNRVALGLV---TDLKNSIESDLELKYIK 61

Query: 77  YVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTV 136
                P ++    +F++WV++Y   P+G+V +MV               F G+ PR    
Sbjct: 62  DKLILPSMAPSFIKFIQWVSNYNIVPIGMVLKMV---------------FAGM-PR---- 101

Query: 137 ARLRVLDKIKDGKIWE-KRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
                      GK      DL +++ V+   I+  K                        
Sbjct: 102 -----------GKFMPLGGDLAQSTSVNDVNIEAGK------------------------ 126

Query: 196 LPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH--LGKQVLILL 253
           LP   ++Q      +V   T GF+V+++ G TG+GKTEVY      +L      QVL+LL
Sbjct: 127 LPQPSEDQSYACNYIVERST-GFSVTVLDGKTGAGKTEVYCTAAEKLLQECADAQVLVLL 185

Query: 254 PEISLTSAILERFQKRFGV-KPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           PEI L + +++R    F    P EWHS L+   R + W  V RG  S++VG RSALFLPF
Sbjct: 186 PEIVLATQLMKRIYSYFSTCNPVEWHSELTVKRRRENWLAVTRGTTSIVVGARSALFLPF 245

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
           K L +I++DEEH+ SYKQ+ G++YNARDM+IV GK    PVVL +ATPS+E+  N   ++
Sbjct: 246 KNLKMIIVDEEHESSYKQDSGMIYNARDMAIVLGKHVDIPVVLCTATPSLETMNNIQQKK 305

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y+ V L  R+  + +P + V DMR   + +   +S  + + I  TLA+ +Q +LFLNRRG
Sbjct: 306 YNHVVLKRRFGEAVMPDIIVADMRKDELKKA-WMSTCLYEKICETLAKQQQVMLFLNRRG 364

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           YA L LC+ CG+++ C +C  WL EHR  + + CH C +S    + C  C     M   G
Sbjct: 365 YARLVLCKQCGHKVNCPNCCTWLTEHRVLRAMLCHYCAYSCEIPRECPSCQEYNTMSPYG 424

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            GIERI E + E  P AR  +LSSD+        ++   + +GE+DIIIGTQ++AKGHNF
Sbjct: 425 VGIERILEGIQELIPTARSVVLSSDISAKQANSIVE--QVLQGEVDIIIGTQIIAKGHNF 482

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P+++LVGV+D DLGL N+DLR++E+T+QLL QV+GR+GR+  K   ++Q Y P   V+++
Sbjct: 483 PKLTLVGVIDADLGLGNSDLRATEKTYQLLHQVSGRSGRYKEKGQVVLQTYDPESAVIKS 542

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           L+S + D FY  E++ R+   +PP+ RL ++IISG   +E+   A   +  A  +  I V
Sbjct: 543 LLSSNRDDFYSVELKTRKVAEMPPYMRLVSIIISGR--EEIGVIAVANEIVASMAGKITV 600

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           +GPA +PL ++   +R+R+L+     S ++   S+  +   K  N +RV  D+DP NF+
Sbjct: 601 WGPAPAPLSLLNNMHRYRVLLKVTSISAIKSLLSECREKYKKLRN-VRVVIDVDPMNFI 658


>gi|88658546|ref|YP_507299.1| primosomal protein N' [Ehrlichia chaffeensis str. Arkansas]
 gi|88600003|gb|ABD45472.1| primosomal protein N' [Ehrlichia chaffeensis str. Arkansas]
          Length = 658

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 240/651 (36%), Positives = 380/651 (58%), Gaps = 33/651 (5%)

Query: 95  VADYTFSPMGLVARMVVSALSETEKM------EEKIQFTGI-----FPRINTVARLRVLD 143
           V +Y   P G  AR +V  + +   M       EK+Q   +      PR+N VA L  + 
Sbjct: 27  VGEYVLVPFG--ARTLVGVILKLNDMIPSDCNVEKLQLKVVISKNSLPRVN-VALLNFIK 83

Query: 144 KIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQ 203
            + D  I     +++   V S+V++         + F  +       +   S+ I   N+
Sbjct: 84  WVSDYNIVPAGLVLK--MVFSNVVNA--------KSFSKLKFYAKQNDRCNSVEINLSNE 133

Query: 204 QDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK--QVLILLPEISLTSA 261
           Q +    +     G++V ++ G TGSGKTEVY E++  ++      Q LILLPEI LT  
Sbjct: 134 QRIAYNSIVNKISGYSVIVLDGETGSGKTEVYCEVIRELIKRDSTAQALILLPEIVLTLQ 193

Query: 262 ILERFQKRF-GVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVI 320
           +++R +  F    P EWHS+L+   R++ W  +A G   +++G RSALFLP+K L +I++
Sbjct: 194 LIKRIKHYFDSYYPVEWHSNLTLKNRKEYWLSIAYGQSLIVIGARSALFLPYKNLKMIIV 253

Query: 321 DEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLST 380
           DEEHD S+KQE G+LYNARDMSIV  K    P++L SATPS+E+  N +  +Y+ V L+ 
Sbjct: 254 DEEHDSSFKQECGVLYNARDMSIVLAKNLDIPIILSSATPSLEAINNVLKSQYYHVKLTQ 313

Query: 381 RYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQ 440
           R+ N+ LP ++++D+    +     LS ++ + I  TL R +Q +LFLNRRGYA L LC+
Sbjct: 314 RFGNAKLPSVRIVDLCKSKMV-NVWLSNKLYNSILETLQRQDQVMLFLNRRGYAKLRLCK 372

Query: 441 VCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAE 500
            CG ++ C +C+ WLVEH+ K  L CH CG+S      C  C     +I+ G G+E+IAE
Sbjct: 373 ACGFKINCKNCATWLVEHKKKNILLCHYCGYSCPMQDECTNCSDKSSLISYGVGVEKIAE 432

Query: 501 EVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGV 560
           ++    P A+++I+SSD+      + + +  I + E+++IIGTQ++AKGHNFPR++LVG+
Sbjct: 433 DIVALIPNAKVAIISSDISSKD--VSVMIDMIMRNEVNVIIGTQVIAKGHNFPRLTLVGI 490

Query: 561 VDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADS 620
           +D DL L N+DLR++ERT+QLL QV+GR+GRF      ++Q Y    P++++L S + + 
Sbjct: 491 IDADLSLNNSDLRATERTYQLLHQVSGRSGRFADNGEVILQTYDTNSPLIKSLSSYNREL 550

Query: 621 FYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPL 680
           FY  E+ +R    +PP+ RL  +IISG     V N +  + +  P +  + V GPA +P+
Sbjct: 551 FYSLELESRLLTKMPPYTRLIGIIISGKDETHVINVSKQIVKSLPHT--LTVLGPAPAPI 608

Query: 681 FMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
             +  +YR+R+LI  + N  +Q   ++ Y     ++N +R+  D+DP NF+
Sbjct: 609 SFLNRKYRYRILIKVQHNVIIQKLLAK-YKEYYAKANKIRITIDVDPVNFM 658


>gi|73667161|ref|YP_303177.1| primosomal protein n [Ehrlichia canis str. Jake]
 gi|72394302|gb|AAZ68579.1| Primosomal protein n [Ehrlichia canis str. Jake]
          Length = 658

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 243/664 (36%), Positives = 384/664 (57%), Gaps = 57/664 (8%)

Query: 94  WVADYTFSPMGLVARM-VVSALSETEKME---EKIQFTGI-----FPRINTVARLRVLDK 144
           ++ +Y   P G+   + +V  LS ++ ++   EK+Q   I      PRIN      +L+ 
Sbjct: 26  FIGEYVLVPFGVRTLVGIVLKLSNSKPLDCGIEKLQLKVIISKSSLPRINPT----LLNF 81

Query: 145 IKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQ 204
           IK    W          VS + +  + A  V+K +F  +       +L FS+   DK   
Sbjct: 82  IK----W----------VSEYNV--VPAGLVLKMVFSNVINAKSFSSLKFSVKKNDKYND 125

Query: 205 --------------DVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK--Q 248
                         D++++V      G++V ++ G TGSGKTEVY E++  ++   +  Q
Sbjct: 126 VAISLSDEQRFAYDDIIDKV-----SGYSVIVLDGETGSGKTEVYCEVIRELIKRDETAQ 180

Query: 249 VLILLPEISLTSAILERFQKRF-GVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
            LILLPEI LT  +++R ++ F    P EWHS+L+   R + W  VA G   +++G RSA
Sbjct: 181 ALILLPEIVLTLQLIKRIKRYFDSYYPVEWHSNLTLKNRREYWLSVAYGQSLIVIGARSA 240

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LFLP+  L +I++DEEHD S+KQE G+LYNARDMSIV  K  + P++L SATPS+E+  N
Sbjct: 241 LFLPYNNLKVIIVDEEHDSSFKQESGVLYNARDMSIVLAKNLNIPIILSSATPSLETINN 300

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
            +  +Y+ V L+ R+ N+ LP ++++D+    +     LS E+ + I   L R +Q +LF
Sbjct: 301 VLKSQYYHVKLTKRFGNAKLPSVKIVDLCKSKMV-NTWLSYELYNNILKVLERQDQVMLF 359

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LN RGYA L LC+ CG ++ C +CS WL+EH+ K  L CH CG+S      C  C     
Sbjct: 360 LNSRGYAKLRLCRACGFKMSCKNCSTWLIEHKKKNVLLCHYCGYSCAMQNQCSNCLCESS 419

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           +I+ G G+ER+AEE+    P A+I+++SSD+      + + L  I + E+++IIGTQ++A
Sbjct: 420 LISYGVGVERVAEEIVALIPDAKIAVISSDVSSKDIGIMVDL--IMRNEVNVIIGTQVIA 477

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP+++ VGVVD DLGL N+DLR++ERT+QLL QV+GR+GRF      ++Q Y    
Sbjct: 478 KGHNFPKLTFVGVVDADLGLNNSDLRATERTYQLLHQVSGRSGRFVDNGEVMLQTYDVNS 537

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS 667
            ++++L+S + + FY  E+ +R    +PP+ RL  +I+SG    +V N +  +    P +
Sbjct: 538 ALIKSLLSYNRELFYNLELESRSLTKMPPYTRLIGIIVSGEHEPDVVNVSKRIVNTLPHT 597

Query: 668 SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDP 727
             + V GP  +P+  +  RYR+R+LI  + N  +Q   ++ Y     + N +++  D+DP
Sbjct: 598 --LTVLGPVPAPISFLNRRYRYRILIKVQNNVMIQKLLAK-YKEYYSKVNKIKITIDVDP 654

Query: 728 QNFL 731
            NF+
Sbjct: 655 VNFM 658


>gi|58579226|ref|YP_197438.1| primosomal protein N' [Ehrlichia ruminantium str. Welgevonden]
 gi|58417852|emb|CAI27056.1| Primosomal protein N' [Ehrlichia ruminantium str. Welgevonden]
          Length = 664

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 248/720 (34%), Positives = 405/720 (56%), Gaps = 71/720 (9%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE---KYKIDSLKLRP 74
           +LL   V+  + Y++P      +G  V VP  SR ++GIV   S+      +++  +L+ 
Sbjct: 10  VLLPVPVNKTFFYNIPYNENFIVGDYVIVPFGSRLIVGIVLAISDSIPSTCEVNISQLKM 69

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRIN 134
           +      P +   +  F+KWV+DY   P GL+ +MV S +    K   K+QF+       
Sbjct: 70  VNCKGSLPGICSALIHFIKWVSDYNVVPAGLILKMVFSNVVNV-KFFNKLQFS------- 121

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                     + + K +     I  S V              KQ +  I   + S    +
Sbjct: 122 ----------VDENKKYSSDIKINLSDVQ-------------KQAYNNIIGKISS----Y 154

Query: 195 SLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK--QVLIL 252
           S+ +LD                        G TGSGKTEVY E++  ++      QVL+L
Sbjct: 155 SVILLD------------------------GETGSGKTEVYCEVIRELVTRDNTAQVLVL 190

Query: 253 LPEISLTSAILERFQKRF-GVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           LPEI LT  +++R +  F    P EWHS+L+   R + W  +A G  S+++G RSALFLP
Sbjct: 191 LPEIVLTLQLIKRIKYYFENYFPVEWHSNLTVKSRREYWLSIAYGQSSIVIGARSALFLP 250

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK L +I++DEEHD S+KQ+ G++YNARDMSIV  K  + PV+L SATPS+E+  N    
Sbjct: 251 FKNLKMIIVDEEHDASFKQDYGVIYNARDMSIVLAKQFNIPVILSSATPSLETISNIQKS 310

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           +Y+ V L+ R+ ++ LP +++ID+    +   + LS ++   +   L R +Q +LFLNRR
Sbjct: 311 QYYHVRLTQRFGDAKLPTVKIIDLCKSKMV-NRWLSYDLYSSMLKVLQRQDQVMLFLNRR 369

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIAC 491
           GYA L LC+ CG +++C +C+ WL+EH+ +  L CH CG+S      C  C     +I+ 
Sbjct: 370 GYATLRLCKTCGFKVQCKNCATWLIEHKRRNVLLCHYCGYSCTIVDECYNCLDKSSVISY 429

Query: 492 GFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHN 551
           G G+E++AE++    P A+I+I+SS  +     + + +  I + +++IIIGTQ++AKGHN
Sbjct: 430 GIGVEKVAEDIMTLIPDAKIAIISS--DISSKEIGVTIDLIMQNKVNIIIGTQVIAKGHN 487

Query: 552 FPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQ 611
           FP+++LVGV+D DLGL N+DLR++ERT+QLL QV GR+GRF  +S  ++Q Y   + +++
Sbjct: 488 FPKLTLVGVIDADLGLNNSDLRATERTYQLLHQVAGRSGRFVDRSEVILQTYDANNALIK 547

Query: 612 ALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIV 671
           +L S + + FY+ E+++R    +PP+ RL  +I++G    +V N +  + +  P +  + 
Sbjct: 548 SLSSYNRELFYDLELKSRLLTQMPPYTRLIGIIVTGKNEAKVINVSKQIVKSLPTT--LT 605

Query: 672 VFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           V GPA +P+ ++  +YR+R+LI  + N  +Q   ++ Y      +  +++  D+DP NF+
Sbjct: 606 VLGPAPAPISLLNRQYRYRILIKVQNNVVIQKLLTR-YKEYYASTGKVKIIIDVDPINFM 664


>gi|254455945|ref|ZP_05069374.1| primosomal protein N' [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082947|gb|EDZ60373.1| primosomal protein N' [Candidatus Pelagibacter sp. HTCC7211]
          Length = 651

 Score =  439 bits (1128), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 243/717 (33%), Positives = 375/717 (52%), Gaps = 69/717 (9%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           +V ILL    + P+ Y   S + +++G  V VP     + G+VW   E+K      K++ 
Sbjct: 2   KVPILLPNIFNHPFTYE--SNLDLKIGDYVVVPFGKSKITGVVWDEFEKKNN-RHFKIKS 58

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRIN 134
           +    D  PL +   +F+ W ++Y   P G+  ++V+ + +  EK++             
Sbjct: 59  VLKKLDVVPLKKTTIKFLNWFSEYNIIPKGMALKLVLLSSNAIEKIQ------------- 105

Query: 135 TVARLRVLDKIKDG-KIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY 193
                      KD  KI+E      A ++S      L+   V  Q               
Sbjct: 106 -----------KDAYKIFESNIKTNAIELSEEQKKSLRKMNVSNQ--------------- 139

Query: 194 FSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
                                   F V ++ G TGSGKT VY E + A+++ G Q LILL
Sbjct: 140 -----------------------KFRVHVLQGTTGSGKTMVYFEALKAIINKGFQGLILL 176

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI LT    ++F++ FG  PA WHS ++   +E IW  +  G I V++G RS+LFLPFK
Sbjct: 177 PEIGLTGQFEKKFKEFFGFTPAVWHSGITKKKKEIIWSGITNGEIKVVIGARSSLFLPFK 236

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
           KLGLI++DEEHD SYKQ+EG+ YNARDM+I R   E+ P+ L++A PSIE+  N    ++
Sbjct: 237 KLGLIIVDEEHDQSYKQDEGVTYNARDMAISRASFENIPINLITAVPSIETYENIKKGKF 296

Query: 374 HSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGY 433
               L  RY+N++LP+ ++I++    + +   LS ++I+ +   L +N+Q L FLNRRG+
Sbjct: 297 TISKLEKRYKNASLPNYEIINLNETKLEKQSWLSKKIIEKVNFHLDKNDQVLFFLNRRGF 356

Query: 434 APLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGF 493
           +P  LC  C N   C +CS  LV H+ K  L CH CG  +   ++CV  G   + I  G 
Sbjct: 357 SPHVLCNKCFNSYSCPNCSINLVYHKKKNNLLCHYCGFKSSLKRTCVKEGDC-EFIFSGP 415

Query: 494 GIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFP 553
           G+ERI+EEV + FP  +I I SSD          +L  I   E+ I++GTQL++KG +FP
Sbjct: 416 GVERISEEVKKNFPSKKIEIFSSDTMNKKSSSD-KLEKIIDNEVQILVGTQLISKGFHFP 474

Query: 554 RMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQAL 613
            ++ + VVD DL     DLR +E+  QL  Q++GRAGR G  +    Q Y     ++  L
Sbjct: 475 SLNCIVVVDIDLSSQGHDLRGAEKNLQLYHQLSGRAGRTGKPATVYFQTYNTNTKMISDL 534

Query: 614 VSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVF 673
            + + D F + E+  R   NLPPF R  ++I++G     +E  A+  K    +     V 
Sbjct: 535 TNSNPDIFLDRELDIRRQNNLPPFQRFISLILTGDNEARLEKEAFYFKNFIEKKIKGRVL 594

Query: 674 GPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           GP  +P+F ++ ++R R+LI G ++ NLQ   +++  N  K S+ +++  D+DP NF
Sbjct: 595 GPVSAPIFRLKKKFRIRMLIRGSKSLNLQNSIAKIIAN-YKFSSGIKLSVDVDPINF 650


>gi|57239263|ref|YP_180399.1| primosomal protein N' [Ehrlichia ruminantium str. Welgevonden]
 gi|57161342|emb|CAH58265.1| primosomal protein N' [Ehrlichia ruminantium str. Welgevonden]
          Length = 659

 Score =  439 bits (1128), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 248/720 (34%), Positives = 405/720 (56%), Gaps = 71/720 (9%)

Query: 18  ILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE---KYKIDSLKLRP 74
           +LL   V+  + Y++P      +G  V VP  SR ++GIV   S+      +++  +L+ 
Sbjct: 5   VLLPVPVNKTFFYNIPYNENFIVGDYVIVPFGSRLIVGIVLAISDSIPSTCEVNISQLKM 64

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRIN 134
           +      P +   +  F+KWV+DY   P GL+ +MV S +    K   K+QF+       
Sbjct: 65  VNCKGSLPGICSALIHFIKWVSDYNVVPAGLILKMVFSNVVNV-KFFNKLQFS------- 116

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                     + + K +     I  S V              KQ +  I   + S    +
Sbjct: 117 ----------VDENKKYSSDIKINLSDVQ-------------KQAYNNIIGKISS----Y 149

Query: 195 SLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK--QVLIL 252
           S+ +LD                        G TGSGKTEVY E++  ++      QVL+L
Sbjct: 150 SVILLD------------------------GETGSGKTEVYCEVIRELVTRDNTAQVLVL 185

Query: 253 LPEISLTSAILERFQKRF-GVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           LPEI LT  +++R +  F    P EWHS+L+   R + W  +A G  S+++G RSALFLP
Sbjct: 186 LPEIVLTLQLIKRIKYYFENYFPVEWHSNLTVKSRREYWLSIAYGQSSIVIGARSALFLP 245

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK L +I++DEEHD S+KQ+ G++YNARDMSIV  K  + PV+L SATPS+E+  N    
Sbjct: 246 FKNLKMIIVDEEHDASFKQDYGVIYNARDMSIVLAKQFNIPVILSSATPSLETISNIQKS 305

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           +Y+ V L+ R+ ++ LP +++ID+    +   + LS ++   +   L R +Q +LFLNRR
Sbjct: 306 QYYHVRLTQRFGDAKLPTVKIIDLCKSKMV-NRWLSYDLYSSMLKVLQRQDQVMLFLNRR 364

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIAC 491
           GYA L LC+ CG +++C +C+ WL+EH+ +  L CH CG+S      C  C     +I+ 
Sbjct: 365 GYATLRLCKTCGFKVQCKNCATWLIEHKRRNVLLCHYCGYSCTIVDECYNCLDKSSVISY 424

Query: 492 GFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHN 551
           G G+E++AE++    P A+I+I+SS  +     + + +  I + +++IIIGTQ++AKGHN
Sbjct: 425 GIGVEKVAEDIMTLIPDAKIAIISS--DISSKEIGVTIDLIMQNKVNIIIGTQVIAKGHN 482

Query: 552 FPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQ 611
           FP+++LVGV+D DLGL N+DLR++ERT+QLL QV GR+GRF  +S  ++Q Y   + +++
Sbjct: 483 FPKLTLVGVIDADLGLNNSDLRATERTYQLLHQVAGRSGRFVDRSEVILQTYDANNALIK 542

Query: 612 ALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIV 671
           +L S + + FY+ E+++R    +PP+ RL  +I++G    +V N +  + +  P  + + 
Sbjct: 543 SLSSYNRELFYDLELKSRLLTQMPPYTRLIGIIVTGKNEAKVINVSKQIVKSLP--TTLT 600

Query: 672 VFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           V GPA +P+ ++  +YR+R+LI  + N  +Q   ++ Y      +  +++  D+DP NF+
Sbjct: 601 VLGPAPAPISLLNRQYRYRILIKVQNNVVIQKLLTR-YKEYYASTGKVKIIIDVDPINFM 659


>gi|91762637|ref|ZP_01264602.1| probable primosomal protein N [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718439|gb|EAS85089.1| probable primosomal protein N [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 651

 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 242/716 (33%), Positives = 375/716 (52%), Gaps = 67/716 (9%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           +V IL+    + P+ Y+  S + +++G  V VP     V G+VW + E+K    +  ++ 
Sbjct: 2   KVPILIPNIFNHPFTYN--SDLNLKVGDYVAVPFGKSEVTGVVWDDFEKKTN-KNFAIKK 58

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRIN 134
           +    D PPL +   +F+ W ++Y  +P G+  ++++ +    EK+            I 
Sbjct: 59  VLRKLDVPPLKKNTIKFLNWFSEYNMTPKGMALKLLLLSSGAIEKLP-----------IE 107

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                ++   IK+ +I          ++S    + LK   V+ Q F              
Sbjct: 108 AYEPFKI--DIKENEI----------KLSKEQKNSLKKMNVLNQKFR------------- 142

Query: 195 SLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLP 254
                                    V ++ G TGSGKT VY E +  +++ G Q LILLP
Sbjct: 143 -------------------------VHVLQGTTGSGKTMVYFEALKEIINKGFQGLILLP 177

Query: 255 EISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKK 314
           EI LT     +F + FG KPA WHS ++   +E IW  +A   I V++G RS+LFLPFKK
Sbjct: 178 EIGLTGQFQNKFIEFFGFKPAVWHSGITKKNKEIIWSGIANDKIKVVIGARSSLFLPFKK 237

Query: 315 LGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYH 374
           LGLI++DEEHD SYKQ+EG+ YNARDM+I R   E+ P+ L++A PSIE+  N    +Y 
Sbjct: 238 LGLIIVDEEHDQSYKQDEGVTYNARDMAISRASFENIPINLITAVPSIETYDNIKKGKYS 297

Query: 375 SVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYA 434
              L  RY N++LP  ++I++    +     ++ E I+ ++  L + +Q L FLNRRG++
Sbjct: 298 LSKLDQRYLNASLPKYEIINLNNSKLESQSWIAKETIEKVKFHLEKKDQVLFFLNRRGFS 357

Query: 435 PLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFG 494
           P  LC+ C     C +CS  LV H++K+ L CH CG+  + ++ C   G     I  G G
Sbjct: 358 PHVLCKKCFTSYSCPNCSINLVYHKNKQNLLCHYCGYKTLLNRDCSKEGKCD-FIFSGPG 416

Query: 495 IERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPR 554
           +ERI+EEV + FP    +I SSD         + L  I   +I I+IGTQL++KG +FP 
Sbjct: 417 VERISEEVKKIFPTNETTIFSSDTMNKKSSADV-LEKIIDNKIQILIGTQLISKGFHFPS 475

Query: 555 MSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALV 614
           ++ + VVD DL     DLR +E+  QL  Q++GRAGR G  +    Q Y     ++  + 
Sbjct: 476 LNCIVVVDIDLSSQGHDLRGAEKNLQLYHQLSGRAGRTGKPATVYFQTYNLDTKMITDIT 535

Query: 615 SGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFG 674
           + D D F + E+  R   NLPPF R  A+II+G   +E+E  AY  K     + D  V G
Sbjct: 536 NKDPDIFLDKELEIRRENNLPPFQRFIALIITGNNERELEKEAYKFKSFIESAVDGRVLG 595

Query: 675 PAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           P  +P+F ++ R+R RLLI G+++  +Q   S++ +   K    +++  D+DP NF
Sbjct: 596 PVNAPIFRLKRRFRVRLLIRGRKSLKVQNSLSKVIE-KFKFPAGMKLTVDVDPINF 650


>gi|71082939|ref|YP_265658.1| primosomal protein N [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062052|gb|AAZ21055.1| probable primosomal protein N [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 651

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 242/716 (33%), Positives = 374/716 (52%), Gaps = 67/716 (9%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           +V IL+    + P+ Y+  S + +++G  V VP     V G+VW + E+K    +  ++ 
Sbjct: 2   KVPILIPNIFNHPFTYN--SDLNLKVGDYVAVPFGKSEVTGVVWDDFEKKTN-KNFAIKK 58

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRIN 134
           +    D PPL +   +F+ W ++Y  +P G+  ++++ +    EK+            I 
Sbjct: 59  VLRKLDVPPLKKNTIKFLNWFSEYNMTPKGMALKLLLLSSGAIEKLP-----------IE 107

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                ++   IK+ +I          ++S    + LK   V+ Q F V            
Sbjct: 108 AYEPFKI--DIKENEI----------KLSKEQKNSLKKMNVLNQKFRV------------ 143

Query: 195 SLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLP 254
                                      ++ G TGSGKT VY E +  ++  G Q LILLP
Sbjct: 144 --------------------------HVLQGTTGSGKTMVYFEALKEIIDKGFQGLILLP 177

Query: 255 EISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKK 314
           EI LT     +F + FG KPA WHS ++   +E IW  +A   I V++G RS+LFLPFKK
Sbjct: 178 EIGLTGQFQNKFIEFFGFKPAVWHSGITKKNKEIIWSGIANDKIKVVIGARSSLFLPFKK 237

Query: 315 LGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYH 374
           LGLI++DEEHD SYKQ+EG+ YNARDM+I R   E+ P+ L++A PSIE+  N    +Y 
Sbjct: 238 LGLIIVDEEHDQSYKQDEGVTYNARDMAISRASFENIPINLITAVPSIETYDNIKKGKYS 297

Query: 375 SVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYA 434
              L  RY N++LP  ++I++    +     ++ E I+ ++  L + +Q L FLNRRG++
Sbjct: 298 LSKLDQRYLNASLPKYEIINLNNSKLESQSWIAKETIEKVKFHLEKKDQVLFFLNRRGFS 357

Query: 435 PLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFG 494
           P  LC+ C     C +CS  LV H++K+ L CH CG+  + ++ C   G     I  G G
Sbjct: 358 PHVLCKKCFTSYSCPNCSINLVYHKNKQNLLCHYCGYKTLLNRDCSKEGKCD-FIFSGPG 416

Query: 495 IERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPR 554
           +ERI+EEV + FP    +I SSD         + L  I   +I I+IGTQL++KG +FP 
Sbjct: 417 VERISEEVKKIFPTNETTIFSSDTMNKKSSADV-LEKIIDNKIQILIGTQLISKGFHFPS 475

Query: 555 MSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALV 614
           ++ + VVD DL     DLR +E+  QL  Q++GRAGR G  +    Q Y     ++  + 
Sbjct: 476 LNCIVVVDIDLSSQGHDLRGAEKNLQLYHQLSGRAGRTGKPATVYFQTYNLDTKMITDIT 535

Query: 615 SGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFG 674
           + D D F + E+  R   NLPPF R  A+II+G   +E+E  AY  K     + D  V G
Sbjct: 536 NKDPDIFLDKELEIRRENNLPPFQRFIALIITGNNERELEKEAYKFKSFIESAVDGRVLG 595

Query: 675 PAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           P  +P+F ++ R+R RLLI G+++  +Q   S++ +   K    +++  D+DP NF
Sbjct: 596 PVNAPIFRLKRRFRVRLLIRGRKSLKVQNSLSKVIE-KFKFPAGMKLTVDVDPINF 650


>gi|189183675|ref|YP_001937460.1| primosome assembly protein PriA [Orientia tsutsugamushi str. Ikeda]
 gi|189180446|dbj|BAG40226.1| primosomal protein N [Orientia tsutsugamushi str. Ikeda]
          Length = 646

 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 219/515 (42%), Positives = 316/515 (61%), Gaps = 3/515 (0%)

Query: 216 KGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPA 275
           K    +L+ G+TGSGKTEVY  ++   L  G QVL+L+PEI+L S I  RF  RF     
Sbjct: 134 KTTGATLLQGITGSGKTEVYFHLIVEALRQGLQVLLLMPEINLASHIAFRFASRFKFNAV 193

Query: 276 EWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGIL 335
            W+SS+S ++++K  R +    I V++G RS++FLP+  LGLI++DEEHD SYKQE  IL
Sbjct: 194 IWNSSVSKALKKKALRGILTNEIKVVIGTRSSIFLPYSSLGLIIVDEEHDQSYKQENNIL 253

Query: 336 YNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDM 395
           YNARDM+++RG I + PV+L SATPS+ES  N  +++Y  V L +R+ +S LP++ +IDM
Sbjct: 254 YNARDMAVMRGHIANIPVILASATPSLESIYNTYNKKYSFVKLKSRFGSSTLPNINIIDM 313

Query: 396 RGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWL 455
           + + +  G  LS  + + +  TL  N+Q LLFLNR+GYAP+ LC+ CG R  C  CS  L
Sbjct: 314 KKEHLPNGMWLSSSLKNAMEQTLKLNKQILLFLNRKGYAPIILCRNCGFRFTCSSCSSCL 373

Query: 456 VEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILS 515
           V H+SK KL CH CG    ++Q C  C     + A G GIERIAEEV  YFP  + +I+S
Sbjct: 374 VFHKSKNKLQCHHCGGFKTFAQFCPECNEE-TLSAYGPGIERIAEEVKVYFPKYKTAIVS 432

Query: 516 SDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSS 575
            D           L  I   E+DIIIGTQ++ KG++FP + LVG++D DLG    DLR++
Sbjct: 433 RDTTSTLDDSTEILQQIINNEVDIIIGTQMLTKGYHFPNLKLVGIIDADLGY-GGDLRAN 491

Query: 576 ERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLP 635
           E+T+QLL+QV GRAGR   K    IQ Y P   +++ L++   D F   E+  R S N+P
Sbjct: 492 EKTYQLLNQVAGRAGREEDKGHVYIQTYYPDSSLLKYLINYKDDDFINYEMNLRISNNMP 551

Query: 636 PFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHG 695
           P  R  A+ +  T  Q  +  A N+   A   S + + GPA + L+ ++ +YRFR+L+  
Sbjct: 552 PATRFVAISVISTSEQNAQEVAKNIVRTAKPCSSLRILGPAPALLYKLKNKYRFRILLIF 611

Query: 696 KRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           +R  +++ +    ++     S  + ++ DIDP NF
Sbjct: 612 ERKLDIRSYIKN-WNILSFHSKRVSLKIDIDPYNF 645


>gi|117927011|ref|YP_867628.1| replication restart DNA helicase PriA [Magnetococcus sp. MC-1]
 gi|117610767|gb|ABK46222.1| replication restart DNA helicase PriA [Magnetococcus sp. MC-1]
          Length = 738

 Score =  432 bits (1111), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 260/741 (35%), Positives = 392/741 (52%), Gaps = 30/741 (4%)

Query: 16  VIILLLQAVSGPYIYSVPSAMK--VELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR 73
            ++ L  A    + Y +P+ +      G +V VP+ +    G+VW  S      +  +L+
Sbjct: 3   ALVALTGARDASFSYKIPAELADGCHPGYLVLVPVGNSLRTGVVWACSATPQWCEG-ELK 61

Query: 74  PIEYVF-DCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR 132
            IE V  D   L  ++ + + W+  Y   P G V    +      ++ +++I++      
Sbjct: 62  EIEEVLSDESLLDDELRQLLNWMIRYYHQPAGAVITAALPGHLRYDR-KQRIRWNPAADP 120

Query: 133 INTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQI------------- 179
                +   L  I          L   +   +H   GL  +  +KQ+             
Sbjct: 121 TTLAQQPAALQAIATALQKRSNGLTEETLARNHGRRGLSRR--LKQLEMAGYILTEQSWN 178

Query: 180 -FEVISPVVDSPN---LYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVY 235
                +   +SP    +  + P+ ++ QQ V + V  L  + FA  L+ GVTGSGKTEVY
Sbjct: 179 ARHTATEAAESPTSRVMQAAPPLNEQQQQAVGQLVAALEAQHFAAFLLDGVTGSGKTEVY 238

Query: 236 LEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVAR 295
              V   L  G+Q L+L+PEI+LT  +++R++ RF    A +HS +S + R + W++   
Sbjct: 239 FRGVEHCLAQGRQALLLVPEIALTPQLIQRYEARFHENLAVFHSEMSAARRYRDWQRAKS 298

Query: 296 GAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVL 355
           GA  V++G RSALF PF KLGLIV+DEEH+ SYKQEEG+ YNARDM++VR ++    +VL
Sbjct: 299 GAARVVIGARSALFAPFAKLGLIVVDEEHEGSYKQEEGVPYNARDMAVVRARMNQAVLVL 358

Query: 356 VSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRG----QTIAQGKSLSPEMI 411
            SATPS+ES  N    RYH +HL+ R    ALP +QVI++      Q +  G  LS  + 
Sbjct: 359 GSATPSMESLYNAQQGRYHHLHLTQRATGVALPPVQVINLADKKNLQGLPFGTLLSHPLR 418

Query: 412 DGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGH 471
             ++      +Q+LLFLNRRG+AP  LC +CG  + C +CS  L  H+   KL CH C H
Sbjct: 419 QAMQQVWQAGKQSLLFLNRRGFAPAILCNLCGITVSCPNCSVALTLHKGAAKLVCHYCDH 478

Query: 472 SAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSA 531
                  C  C   G +I  G G ER+  EV   FP AR++ L  D     G ++  L  
Sbjct: 479 VQGVPDLCPNCKQLG-LIQFGPGTERLQLEVESCFPEARVARLDRDAVAQSGAMERILKQ 537

Query: 532 IAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGR 591
             +G+IDI++GTQ+VAKGH+FPR++LVGVV  +  L+  D R++ERTFQL++QV GRAGR
Sbjct: 538 FHEGQIDILVGTQMVAKGHHFPRLTLVGVVLAETTLSMPDFRAAERTFQLITQVAGRAGR 597

Query: 592 FGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQ 651
                   +Q++ P H  +QA ++ DAD F ++E   R+ V  PPF R+A +  S    Q
Sbjct: 598 EAEVGQVYVQSFDPAHYAIQAAMAHDADRFADAEFGFRQLVGYPPFKRMAVLRFSTPNVQ 657

Query: 652 EVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDN 711
           E  ++ + L+   P    +VV GPA +PLF +R R+R++L+I  +    +    SQ+   
Sbjct: 658 EGGHFIHELRRLVPDQPGVVVLGPAPAPLFKLRNRFRWQLMIKAETVQGVHAMVSQLLQI 717

Query: 712 TIKRSN-ALRVQFDIDPQNFL 731
               +   +RV  DIDP  F+
Sbjct: 718 AQPMAGRKIRVDVDIDPYGFV 738


>gi|254796593|ref|YP_003081429.1| primosomal protein N' [Neorickettsia risticii str. Illinois]
 gi|254589831|gb|ACT69193.1| primosomal protein N' [Neorickettsia risticii str. Illinois]
          Length = 709

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 259/733 (35%), Positives = 410/733 (55%), Gaps = 46/733 (6%)

Query: 17  IILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWY---NSEEKYKIDSLKLR 73
           ++L L   SG ++YS      V +GS+V+V  R R + G+V       + +Y +     +
Sbjct: 5   VVLPLPLDSG-FLYS-SEHFDVYVGSLVKVDFRGRKITGLVTSIVPEDDHEYVV-----K 57

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVAR-MVVSALSETEK---MEEKIQFTGI 129
            I  V   PP S +  +F+ W+A Y F+ +GLV R  ++  + ++       + I+ + +
Sbjct: 58  EILAVEKIPPFSSEYVQFLSWIACYNFTRVGLVLRSALIKDIPDSAAYILTNDNIERSSL 117

Query: 130 FPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDS 189
                T A  RVL   + G  +   D + A+++    +  L   G I+++   IS +   
Sbjct: 118 -----TTAMCRVLGLFR-GSRYITSDALDAAKIQKKTVQKLIDIGAIERVHAAISEMKAV 171

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHL--GK 247
           P     L     ++Q    +   +C  GF V L+ GVTGSGKT VYL     +L      
Sbjct: 172 PEELKKLEFELSDEQSAARE--KICMDGFTVYLLDGVTGSGKTLVYLSAALEILQRDPAA 229

Query: 248 QVLILLPEISLTSAILERFQKRF--GVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVR 305
           QV++L  EI+L S + ER +K F   V+  EWHS LS + R K W +V      +I+G R
Sbjct: 230 QVIMLFSEIALASYVFERVKKSFLGMVEIVEWHSELSPARRRKNWYKVVTNKARLIIGAR 289

Query: 306 SALFLPFKKLGLIVIDEEHDISYKQEEG-ILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           SA+ LP   L +IV+DEEHD S+KQ++G   YNARD++I+RGK+   PV+L SATPS+ES
Sbjct: 290 SAILLPIPNLQMIVVDEEHDQSFKQDQGDFTYNARDLAIMRGKLFDIPVILSSATPSLES 349

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMR-GQTIAQGKSLSPEMIDGIRHTLARNEQ 423
             N   + +  + L  R+  + LP ++V+DMR  Q ++Q   +S E+ + ++ T     Q
Sbjct: 350 YYNVQKKGFVHLKLERRFGGAQLPDVKVVDMRKAQKVSQ--HISHELYEELKRTFDSGMQ 407

Query: 424 TLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCG 483
           +LLFLN+RGYA + +C  CG+R+KC  C  WLVEH+    L CH CG        C  C 
Sbjct: 408 SLLFLNKRGYASIIICSSCGHRMKCPDCIAWLVEHKQNNTLLCHLCGFKRPMITKCEEC- 466

Query: 484 SSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGT 543
           SS  +I+ G G+E+IAEE+ E FP  ++ I+SSD      ++   +  I KG++DI+IGT
Sbjct: 467 SSDTIISFGPGVEKIAEEIGEIFPSKKVVIMSSD-----TKITENIGKIEKGDVDIVIGT 521

Query: 544 QLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGL-KSLGLIQA 602
           Q++AKG++FPR++L+ ++D D+ +   DLR+SE++FQ+L Q  GR GR  +     ++Q+
Sbjct: 522 QIIAKGYDFPRLTLLAIIDSDVSMHAGDLRNSEKSFQILQQAIGRVGRRKVYPGRVVLQS 581

Query: 603 YQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE 662
           Y P   V++AL + D  +FYE E++ R +  +PPF RL ++IISG    EV   A  + +
Sbjct: 582 YSPDSVVIEALKNNDRQTFYEEELKMRLAEEMPPFSRLISIIISGLVENEVTKCAKKIAK 641

Query: 663 HAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ-MYDNTIKRSNALR- 720
                 +I VFGP  + + + + ++R+R+LI   +N     FFS+ +  + + R    + 
Sbjct: 642 AIVPMREINVFGPCPAAIGVKKNQFRYRILIVAPKN-----FFSRAILTDLLARFTTEKK 696

Query: 721 --VQFDIDPQNFL 731
             +Q D+DP  FL
Sbjct: 697 VGIQIDVDPMCFL 709


>gi|190571168|ref|YP_001975526.1| primosomal protein N [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018572|ref|ZP_03334380.1| primosomal protein N [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357440|emb|CAQ54874.1| primosomal protein N [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995523|gb|EEB56163.1| primosomal protein N [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 654

 Score =  429 bits (1102), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/528 (39%), Positives = 328/528 (62%), Gaps = 29/528 (5%)

Query: 218 FAVSLISGVTGSGKTEVYLEIVAAVLHL--GKQVLILLPEISLTSAILERFQKRFGVKPA 275
           ++V+L+ G TGSGKTEVYL ++A ++ +    QVLILLPEI LTS ++ R   +     A
Sbjct: 142 YSVTLLDGETGSGKTEVYLSVIARLIEIVNDAQVLILLPEIVLTSQLVNRVHSQISGNIA 201

Query: 276 EWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGIL 335
           EWHS L+   R   W  +A G+  +I+G RS+LFLP+K L LI++DEEHD S+KQE+GI+
Sbjct: 202 EWHSGLTPKARRNNWLNIANGSAQIIIGARSSLFLPYKNLKLIIVDEEHDSSFKQEQGII 261

Query: 336 YNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDM 395
           YNARDM+I+  K+E+ P++L SATP +E+  +     Y+ V L+ R+  + LPH++V++ 
Sbjct: 262 YNARDMAIILAKLENIPIILSSATPLLETIYHVKKGNYNHVKLTERFGGAELPHIKVVNN 321

Query: 396 RGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWL 455
           +       + +S E+ +GI+ T+ + +Q +LFLNRRGYA L +C+ CG ++ C +C+ WL
Sbjct: 322 K-------QWISNELFEGIKQTIEKKQQVMLFLNRRGYAQLAVCKKCGYKISCSNCTVWL 374

Query: 456 VEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILS 515
             H+ K  L CH C + +   + C  C S   +  CG GIER+ EE+ +  P A+ +I+S
Sbjct: 375 TYHKKKNVLLCHHCSYQSKLPEKCSNCQSEQSLSLCGIGIERLLEEIVKLLPNAKTAIIS 434

Query: 516 SDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSS 575
           SD +  G      + ++ K E++IIIGTQ++AKGHNFP+++LVGV++ DLGL N+DLR++
Sbjct: 435 SDQKSLGSV----IDSVLKEEVNIIIGTQVIAKGHNFPKLTLVGVINADLGLENSDLRAA 490

Query: 576 ERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLP 635
           E+T+QLL QV GR+GRF  K   ++Q   P   +++AL     D FYE E+ +R    +P
Sbjct: 491 EKTYQLLHQVAGRSGRFNEKGTVIVQTNNPESLIIKALQQQKRDLFYEIELESRRKAKMP 550

Query: 636 PFGRLAAVIISGTKY-------QEVENYAYNLKEHAPRS---SDIVVFGPAESPLFMVRG 685
           PF RL A+I+ G           E+ N+ +N      +     +  +FGP+ + +  +  
Sbjct: 551 PFSRLIALIVCGKDQFATQKAANEITNFLHNQFSTTSQHLTLKEFEIFGPSPAAINFLNN 610

Query: 686 RYRFRLL--IHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           +YR+R+L  IH K + +++    +   +    S+ + V  D+DP +F 
Sbjct: 611 KYRYRVLLKIHNKYSLSIK----KKLKHCCNLSSNIEVTIDVDPVSFF 654



 Score = 55.1 bits (131), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 62/112 (55%), Gaps = 5/112 (4%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +LL   +   + Y+V    +V +G  V VP   + ++GIVW  S +  +    +L+ I
Sbjct: 5   VDVLLPLPIDQLFSYAVEEDTEVSIGDYVVVPFGRKRLIGIVWKYSGKSDR----ELKCI 60

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFT 127
           E   + P +  ++ EF +WVA Y   P+G++A++++  + +  ++ +K+ FT
Sbjct: 61  EQKIELPSIRPKLIEFAEWVAQYNVIPIGMLAKVIMGGVLKVNQI-DKLVFT 111


>gi|148285048|ref|YP_001249138.1| primosome assembly protein PriA [Orientia tsutsugamushi str.
           Boryong]
 gi|146740487|emb|CAM81043.1| Primosomal protein N' [Orientia tsutsugamushi str. Boryong]
          Length = 646

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 220/515 (42%), Positives = 317/515 (61%), Gaps = 3/515 (0%)

Query: 216 KGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPA 275
           K    +L+ G+TGSGKTE+Y  ++A  L  G QVL+L+PEI+L   I  RF  RF     
Sbjct: 134 KTTGATLLQGITGSGKTEIYFHLIAEALRQGLQVLLLMPEINLAGHIAFRFASRFKFNAV 193

Query: 276 EWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGIL 335
            W+SS+S S+++K  R +    I V++G RS++FLP+  LGLI++DEEHD SYKQE  IL
Sbjct: 194 IWNSSVSKSLKKKTLRGILTNEIKVVIGTRSSIFLPYSSLGLIIVDEEHDQSYKQENNIL 253

Query: 336 YNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDM 395
           YNARDM+++RG I + PV+L SATPS+ES  N  +++Y  V L +R+ +S LP++ +IDM
Sbjct: 254 YNARDMAVMRGHIANIPVILASATPSLESIYNTYNKKYSLVKLKSRFGSSTLPNINIIDM 313

Query: 396 RGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWL 455
           + + +  G  LS  + + +  TL  N+Q LLFLNR+GYAP+ LC+ CG R  C  CS  L
Sbjct: 314 KKEHLPNGMWLSTSLKNAMEQTLKLNKQILLFLNRKGYAPIILCRNCGFRFMCSSCSSCL 373

Query: 456 VEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILS 515
           V H+SK KL CH CG    ++QSC  C     + A G GIERIAEEV  YFP  + +I+S
Sbjct: 374 VFHKSKNKLQCHHCGSFKPFAQSCPECNEQ-TLSAYGPGIERIAEEVKVYFPKYKTAIVS 432

Query: 516 SDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSS 575
            D           L  I   E+DIIIGTQ++ KG++FP + LVG++D DLG    DLR++
Sbjct: 433 RDTTNTIDNSTEILQQIINNEVDIIIGTQMLTKGYHFPNLKLVGIIDADLGY-GGDLRAN 491

Query: 576 ERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLP 635
           E+T+QLL+QV GRAGR   K    IQ Y P   +++ L++   D F   E+  R S N+P
Sbjct: 492 EKTYQLLNQVAGRAGREEDKGYVYIQTYYPDSSLLKYLINYKDDDFINYEMNLRISNNMP 551

Query: 636 PFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHG 695
           P  R  A+ +  T  Q  +  A N+   A   S + + GPA + L+ ++ +YRFR+L+  
Sbjct: 552 PATRFVAISVISTSEQNAQEVAKNIVRTAKPCSSLRILGPAPALLYKLKNKYRFRILLIF 611

Query: 696 KRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           +R  +++ +    ++     S  + ++ DIDP NF
Sbjct: 612 ERKLDIRSYIKH-WNILSFHSKRVSLKIDIDPYNF 645


>gi|225677218|ref|ZP_03788211.1| Primosomal protein N', superfamily II helicase [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225590742|gb|EEH11976.1| Primosomal protein N', superfamily II helicase [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 780

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 252/785 (32%), Positives = 412/785 (52%), Gaps = 84/785 (10%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +LL   +   + Y++  + ++ LG  V VP   + ++GIVW  S++  +    +L+ I
Sbjct: 11  VDVLLPLPIDQLFSYAIEESTEILLGDYVVVPFGKKRLIGIVWKYSDKSNR----ELKFI 66

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV---VSALSETEKM---EEKIQFTGI 129
           E   D P +  ++  F +WVA Y   P+G++A+++   V  ++  +K+   E+K + + I
Sbjct: 67  EQKIDLPNIRPKLIAFAEWVAQYNLIPIGMLAKVIMGGVLKVNHIDKLVCVEQKQEISEI 126

Query: 130 FPRIN---TVARLRVLDKIK-------DGKIWEKR---------DLIRASQVSSHVIDGL 170
             +++    VA  +++  +        DG+    +          LI+      +    L
Sbjct: 127 SCKLSPEQQVASDKIISNLNEYSVTLLDGETGSGKTEVYLSVIAQLIKNYTAVPNAAQTL 186

Query: 171 KAQGVIKQIFEVIS---PVVDSP---------------NLYFSLPILDKNQQDVVEQVVP 212
            +Q    Q++E      P    P               N+YF+L  +   Q   ++  V 
Sbjct: 187 PSQCPETQLYEHCDLGLPRGCYPSSLTLGSSFSYNLITNVYFNLKPIPNLQSKFLDSSVK 246

Query: 213 LCTKGFAVSLISGVTGS-------GKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILER 265
                F +     VT S         T  Y+E+ +       QVLILLPEI LTS ++ R
Sbjct: 247 HWNDTFVLKAKPTVTFSIPSLPRTSMTPEYVEMTSG--EGNAQVLILLPEIVLTSQLVNR 304

Query: 266 FQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHD 325
              +      EWHS L+   R   W  +A G   +I+G RSALFLP+K L LI++DEEHD
Sbjct: 305 IHGQISKNLVEWHSELTPKTRRNNWLSIANGNAQIIIGARSALFLPYKNLKLIIVDEEHD 364

Query: 326 ISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNS 385
            S+KQE+GI+YNARDM+I+  K E+ P++L SATP +E+  +  +  Y+ V L+ R+  +
Sbjct: 365 SSFKQEQGIIYNARDMAIILAKFENIPIILSSATPLLETIHHVKNGNYNHVKLTKRFGGA 424

Query: 386 ALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNR 445
            LP ++V+DMR       + +S E+ + I+ T+ + +Q +LFLNRRGYA L +C+ CG +
Sbjct: 425 ELPLIKVVDMRNNK----QWISSELFESIKQTIEKKQQVMLFLNRRGYAQLAICKKCGYK 480

Query: 446 LKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEY 505
           + CL+C+ WL  H+ K  L CH C +     + C  C S   +   G GIER+ EE+ + 
Sbjct: 481 ISCLNCAVWLTYHKKKNALLCHHCSYQLKLPEKCSNCQSEQPLSLYGIGIERLLEEMVKL 540

Query: 506 FPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDL 565
            P A+ +++SSD +     + L    I K E++IIIGTQ++AKGHNFP+++LVGV++ DL
Sbjct: 541 IPNAKTAMISSDQKSVSNVIDL----ILKEEVNIIIGTQIIAKGHNFPKLTLVGVMNADL 596

Query: 566 GLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESE 625
            L N+DLR++E+T+QLL QV GR+GRF  K + ++Q   P   +++AL+    DSFYE E
Sbjct: 597 SLENSDLRAAEKTYQLLHQVAGRSGRFNEKGMVIVQTNNPESSIIKALLHQKRDSFYEIE 656

Query: 626 IRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-----------------KEHAPRSS 668
           +++R    +PPF RL A+II G      +  A  +                 K       
Sbjct: 657 LKSRREAKMPPFSRLIALIICGKNQIATQKAANEIVKSLLCHPSSLTTCIQEKNVGVDKK 716

Query: 669 DIVVFGPAESPLFMVRGRYRFRLL--IHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
           +  + GP+ + +  +  +YR+R+L  IH K + ++Q        N    ++++ V  D+D
Sbjct: 717 EFEILGPSPAAINFLNNKYRYRVLLKIHNKHSLSIQKKLKYWIKNC-NLNSSIAVIIDVD 775

Query: 727 PQNFL 731
           P +F 
Sbjct: 776 PVSFF 780


>gi|95928230|ref|ZP_01310978.1| primosomal protein N' [Desulfuromonas acetoxidans DSM 684]
 gi|95135501|gb|EAT17152.1| primosomal protein N' [Desulfuromonas acetoxidans DSM 684]
          Length = 736

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 253/713 (35%), Positives = 384/713 (53%), Gaps = 23/713 (3%)

Query: 37  KVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSL-----KLRPIEYVFD-CPPLSRQMCE 90
           +V  G  V+VPL  R+ +G+V   + + + +D       +L+ I+ V D  P L  ++ E
Sbjct: 29  RVAPGIRVKVPLGRRSAVGVVV--ALKPFAVDDEAVQRERLKAIDAVLDEMPLLPERLLE 86

Query: 91  FVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLR------VLDK 144
           F++  + Y   P+GL  +  + A   + K   KI+ T ++   ++   LR      +L  
Sbjct: 87  FIERASRYYVHPLGLALKTALPAGLSSLKGAPKIRQTRVYRATDSSVNLRGTLQQQILSF 146

Query: 145 IKDGKIWEKRDLIRASQVSSHVIDGLKAQGVI--KQIFEVISPVVDSPNLYFSLPILDKN 202
           I   +  +   L         V+  L+  GVI   +   +  P V         P L++ 
Sbjct: 147 IVQHQPVDLTQLRDQFTSPYPVLKRLEELGVICCDEQESLRDPFVGCQVTADQPPTLNEA 206

Query: 203 QQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSA 261
           QQ  V  +      G F   L+ G+TGSGKTEVYL  +AAVL   KQ L+L+PEI+LT  
Sbjct: 207 QQSAVHSIAEGLDGGDFKPFLLHGITGSGKTEVYLHSIAAVLAADKQALVLVPEIALTPQ 266

Query: 262 ILERFQKRF---GVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLI 318
           ++ RF+ RF   G +    HS LS + R  +WR + R  +++++G RSA+F P  +LG+I
Sbjct: 267 LVARFRARFEQQGQRIGVLHSGLSAAERYDMWRAIVRDEVTIVIGARSAVFAPLTRLGMI 326

Query: 319 VIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHL 378
           V+DEEHD SYKQ EG  Y  RDM+++RG++E  PVVL SATPS+ S           V L
Sbjct: 327 VVDEEHDDSYKQGEGFRYQGRDMALLRGQMEQVPVVLGSATPSLTSYRRMQQGALSEVSL 386

Query: 379 STRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTL 438
            TR  +  LP +++IDMR   +  G  LS E+I+ ++  L R EQ+LL LNRRG++P  L
Sbjct: 387 PTRIGDRTLPEVRLIDMREAEVEHG--LSQELIEALQLRLERGEQSLLLLNRRGFSPYLL 444

Query: 439 CQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERI 498
           C+ CG   +C +C   L  HR    L CH C +     + C  CG +  +   G G ER+
Sbjct: 445 CRDCGASFRCPNCDITLTWHRQAGALRCHYCDYVEPPQELCPRCGGAA-IEPEGMGTERL 503

Query: 499 AEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLV 558
           A E+ E FP ARI+ +  D     G  Q  +S +  GE+DI++GTQ++AKGH+F  ++LV
Sbjct: 504 AAELQERFPEARIARMDRDSTAAKGAQQQLVSRMEAGEVDILVGTQMIAKGHDFGAVTLV 563

Query: 559 GVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDA 618
           G++D D  L   D R++ER+F LL+QV GRAGR  ++   L+Q Y P  PV++  V+ D 
Sbjct: 564 GILDADAALNFPDFRAAERSFSLLAQVAGRAGRGDVRGEVLVQTYAPDSPVLECAVTHDY 623

Query: 619 DSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAES 678
             F E E+  R+ +  PP+G L  +++SG     VE  A  L E    + D+ V GPA  
Sbjct: 624 KHFVELELPMRQLLVYPPYGYLVNLVVSGLDRPAVEGCARRLAERLMAAQDVEVLGPAPC 683

Query: 679 PLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           PLF +R RYR ++L+     + L+   ++           + +  D+DP + +
Sbjct: 684 PLFRLRNRYRVQILLKASTRAALRHMLNESPQWRSIFPATVSLAIDVDPADMM 736


>gi|58698211|ref|ZP_00373132.1| primosomal protein N` [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630867|ref|YP_002727658.1| Primosomal protein N', superfamily II helicase [Wolbachia sp. wRi]
 gi|58535292|gb|EAL59370.1| primosomal protein N` [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225592848|gb|ACN95867.1| Primosomal protein N', superfamily II helicase [Wolbachia sp. wRi]
          Length = 780

 Score =  422 bits (1085), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 248/785 (31%), Positives = 407/785 (51%), Gaps = 84/785 (10%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +LL   +   + Y++    ++ LG  V VP   + ++GIVW  S++  +    +L+ I
Sbjct: 11  VDVLLSLPIDQLFSYAIEENTEILLGDYVVVPFGKKRLIGIVWKYSDKSNR----ELKFI 66

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMV---------VSALSETEKMEEKIQF 126
           E   D P +  ++  F +WVA Y   P+G++A+++         +  L   E+ +E  + 
Sbjct: 67  EQKIDLPNIRPKLIAFAEWVAQYNLIPIGMLAKVIMGGVLKVNHIDKLVCVEQKQETSEI 126

Query: 127 TGIFPRINTVARLRVLDKIK-------DGKIWEKR---------DLIRASQVSSHVIDGL 170
           +        +A  +++  +        DG+    +          LI+      +    L
Sbjct: 127 SCQLSPEQQIASDKIISNLNEYSVTLLDGETGSGKTEVYLSVIAQLIKNYTAVPNAAQTL 186

Query: 171 KAQGVIKQIFEVIS---PVVDSP---------------NLYFSLPILDKNQQDVVEQVVP 212
            +Q    Q++E  +   P    P               N+YF+L  +   Q   ++  V 
Sbjct: 187 PSQCPETQLYEHCNLGLPRGCYPSSLTLGSSFSYNLITNVYFNLKPIPNLQSKFLDSSVK 246

Query: 213 LCTKGFAVSLISGVTGS-------GKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILER 265
                F +     VT S         T  Y+E+ +       Q+LILLPEI LTS ++ R
Sbjct: 247 HWNDTFILKAKPTVTFSIPSLPRTSMTPEYVEMTSG--EGNTQILILLPEIVLTSQLVNR 304

Query: 266 FQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHD 325
            + +      EWHS L+   R   W  +A G   +I+G RSALFLP+K L LI++DEEHD
Sbjct: 305 VRGQISKNLVEWHSGLTPKTRRNNWLNIANGNAQIIIGARSALFLPYKNLKLIIVDEEHD 364

Query: 326 ISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNS 385
            S+KQE+GI+YNARDM+I+  K E+ P++L SATP +E+  +  +  Y+ V L+ R+  +
Sbjct: 365 SSFKQEQGIIYNARDMAIILAKFENIPIILSSATPLLETIHHVKNGNYNHVKLTKRFGGA 424

Query: 386 ALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNR 445
            LP ++V+DMR       + +S E+ + I+ T+ + +Q +LFLNRRGYA L +C+ CG +
Sbjct: 425 ELPLIKVVDMRNNK----QWISSELFESIKQTIEKKQQVMLFLNRRGYAQLAICKKCGYK 480

Query: 446 LKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEY 505
           + CL+C+ WL  H+ K  L CH C +     + C  C S   +   G GIER+ EE+ + 
Sbjct: 481 ISCLNCAVWLTYHKKKNALLCHHCSYQLKLPEKCSNCQSEQPLSLYGIGIERLLEEMVKL 540

Query: 506 FPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDL 565
            P A+ +++SSD +     + L L    K E++IIIGTQ++AKGHNFP+++LVGV++ DL
Sbjct: 541 IPNAKTAMISSDQKSVSNIIDLVL----KEEVNIIIGTQIIAKGHNFPKLTLVGVINADL 596

Query: 566 GLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESE 625
            L N+DLR++E+T+QLL QV GR+GRF  K + ++Q   P   +++AL+    DSFYE E
Sbjct: 597 SLENSDLRAAEKTYQLLHQVAGRSGRFNEKGMVIVQTNNPESSIIKALLHQKRDSFYEIE 656

Query: 626 IRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL-----------------KEHAPRSS 668
           +++R    +PPF RL A+II G      +  A  +                 K  +    
Sbjct: 657 LKSRREAKMPPFSRLIALIICGKNRIATQKAANEIVKSLLCHPSSSTTCIQEKNVSADKK 716

Query: 669 DIVVFGPAESPLFMVRGRYRFRLL--IHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
           +  + GP+ + +  +  +YR+R+L  IH K + ++Q        N    ++++ V  D+D
Sbjct: 717 EFEILGPSPAAINFLNNKYRYRVLLKIHNKHSLSIQKKLKYWIKNC-NLNSSIAVIIDVD 775

Query: 727 PQNFL 731
           P +F 
Sbjct: 776 PVSFF 780


>gi|218679964|ref|ZP_03527861.1| primosome assembly protein PriA [Rhizobium etli CIAT 894]
          Length = 360

 Score =  422 bits (1084), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 200/358 (55%), Positives = 259/358 (72%), Gaps = 1/358 (0%)

Query: 151 WEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQV 210
           W +  L  A+ VS+ V+DGL   G+ + IF    PVV  P+  F+   L+  Q+   E++
Sbjct: 3   WTRSGLAHAAGVSTSVVDGLITLGIFETIFLPPPPVVAMPDPDFAAARLEGPQRAAAEEI 62

Query: 211 VPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKR 269
           V    KG F+VSLI GVTGSGKTEVY E +A  L  G+QVLILLPEI+LT++ +ERFQ R
Sbjct: 63  VSDIRKGEFSVSLIDGVTGSGKTEVYFEAIAETLKRGRQVLILLPEIALTASFMERFQDR 122

Query: 270 FGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYK 329
           FG KPAEWHS L+  MREK+WRQ   G + V+ G RSALFLPF+ LGLI++DEEHD +YK
Sbjct: 123 FGAKPAEWHSDLAPRMREKVWRQAVTGEVRVVAGARSALFLPFEDLGLIIVDEEHDPAYK 182

Query: 330 QEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPH 389
           QE+ + YNARDM++VRG+I  FPV+LVSATPS+ES+VNG S RY +VHL TR+ ++ALP 
Sbjct: 183 QEDRVFYNARDMAVVRGRIGDFPVILVSATPSVESQVNGQSGRYSTVHLPTRFGDAALPD 242

Query: 390 LQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCL 449
           L +IDMR     +G  LSP +I  I  T+ + +Q LLFLNRRGYAPLTLC+VCG+R +C 
Sbjct: 243 LHLIDMRRHAPERGGFLSPVLIRAIGKTVEKRQQALLFLNRRGYAPLTLCRVCGHRFQCP 302

Query: 450 HCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFP 507
            CS WLVEHR +K+L CHQCG++    ++C  CG+   ++ACG G+ERIAEEV  +FP
Sbjct: 303 QCSSWLVEHRFRKQLQCHQCGYAERTPEACPECGTLDHLVACGPGVERIAEEVERHFP 360


>gi|218458869|ref|ZP_03498960.1| primosome assembly protein PriA [Rhizobium etli Kim 5]
          Length = 304

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 196/304 (64%), Positives = 243/304 (79%)

Query: 318 IVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVH 377
           I++DEEHD +YKQE+ + YNARDM++VRG+I  FPVVLVSATPS+ES+VNG S RY +VH
Sbjct: 1   IIVDEEHDPAYKQEDRVFYNARDMAVVRGRIGDFPVVLVSATPSVESQVNGQSGRYSTVH 60

Query: 378 LSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLT 437
           L TR+ ++ALP L +IDMR     +G+ LSP +I  I  T+ R EQ LLFLNRRGYAPLT
Sbjct: 61  LPTRFGDAALPDLHLIDMRRHAPERGRFLSPVLIRAIGKTVERREQALLFLNRRGYAPLT 120

Query: 438 LCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIER 497
           LC+VCG+R +C  CS WLVEHR +K+L CHQCGH+    ++C  CG+   ++ACG G+ER
Sbjct: 121 LCRVCGHRFQCPQCSSWLVEHRFRKQLQCHQCGHAERTPEACPECGTLDHLVACGPGVER 180

Query: 498 IAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSL 557
           IAEEV  +FP AR  +LSSD+ GG  RL+L+L AIA+GE DI+IGTQLVAKGHNFP M+L
Sbjct: 181 IAEEVERHFPQARTIVLSSDIMGGVKRLRLELDAIARGEADIVIGTQLVAKGHNFPLMTL 240

Query: 558 VGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGD 617
           VG++D DLGL N D R++ERTFQLLSQVTGRAGR GLKS GL+Q YQP HPVMQA+VSGD
Sbjct: 241 VGIIDADLGLANGDPRAAERTFQLLSQVTGRAGRTGLKSHGLLQTYQPQHPVMQAIVSGD 300

Query: 618 ADSF 621
           +D+F
Sbjct: 301 SDAF 304


>gi|58617278|ref|YP_196477.1| primosomal protein N' [Ehrlichia ruminantium str. Gardel]
 gi|58416890|emb|CAI28003.1| Primosomal protein N' [Ehrlichia ruminantium str. Gardel]
          Length = 664

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 206/518 (39%), Positives = 334/518 (64%), Gaps = 9/518 (1%)

Query: 217 GFAVSLISGVTGSGKTEVYLEIVAAVLHLGK--QVLILLPEISLTSAILERFQKRFG-VK 273
            ++V L+ G TGSGKTEVY E++  ++      QVL+LLPEI LT  +++R +  F    
Sbjct: 153 SYSVILLDGETGSGKTEVYCEVIRELVTRDNTAQVLVLLPEIVLTLQLIKRIKYYFANYF 212

Query: 274 PAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEG 333
           P EWHS+L+   R + W  +A G  S+++G RSALFLPFK L +I++DEEHD S+KQ+ G
Sbjct: 213 PVEWHSNLTVKSRREYWLSIAYGQSSIVIGARSALFLPFKNLKMIIVDEEHDASFKQDYG 272

Query: 334 ILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVI 393
           ++YNARDMSIV  K  + PV+L SATPS+E+  N    +Y+ V L+ R+ ++ LP +++I
Sbjct: 273 VIYNARDMSIVLAKQFNIPVILSSATPSLETISNIQKSQYYHVRLTQRFGDARLPTVKII 332

Query: 394 DMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSC 453
           D+    +   + LS ++   +   L R +Q +LFLNRRGYA L LC+ CG +++C +C+ 
Sbjct: 333 DLCKSKMV-NRWLSYDLYSSMLEVLQRQDQVMLFLNRRGYATLRLCKTCGFKVQCKNCAT 391

Query: 454 WLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISI 513
           WL+EH+ +  L CH CG+S      C  C     +I+ G G+E++AE++    P A+I+I
Sbjct: 392 WLIEHKRRNVLLCHYCGYSCTIVDECYNCLDKSSVISYGIGVEKVAEDIMTLIPDAKIAI 451

Query: 514 LSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLR 573
           +SS  +     + + +  I + +++IIIGTQ++AKGHNFP+++LVGV+D DLGL N+DLR
Sbjct: 452 ISS--DISSKEIGVTIDLIMQNKVNIIIGTQVIAKGHNFPKLTLVGVIDADLGLNNSDLR 509

Query: 574 SSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVN 633
           ++ERT+QLL QV GR+GRF  +S  ++Q Y   + ++++L S + + FY+ E+++R    
Sbjct: 510 ATERTYQLLHQVAGRSGRFVDRSEVILQTYDANNALIKSLSSYNRELFYDLELKSRLLTQ 569

Query: 634 LPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLI 693
           +PP+ RL  +I++G    +V N +  + +  P  + + V GPA +P+ ++  +YR+R+LI
Sbjct: 570 MPPYTRLIGIIVTGKNEAKVINVSQQIVKSLP--TTLTVLGPAPAPISLLNRQYRYRILI 627

Query: 694 HGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
             + N  +Q   ++ Y      +  +++  D+DP NF+
Sbjct: 628 KVQNNVVIQKLLTR-YKEYYASTGKVKIIIDVDPINFM 664


>gi|88608231|ref|YP_506101.1| primosomal protein N' [Neorickettsia sennetsu str. Miyayama]
 gi|88600400|gb|ABD45868.1| primosomal protein N' [Neorickettsia sennetsu str. Miyayama]
          Length = 709

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 269/731 (36%), Positives = 409/731 (55%), Gaps = 42/731 (5%)

Query: 17  IILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWY---NSEEKYKIDSLKLR 73
           ++L L   SG ++YS      V +GS+V+V  R R + G+V      SE +Y I     +
Sbjct: 5   VVLPLPLDSG-FLYS-SGHFDVYVGSLVKVDFRGRKITGLVTSVVPESEHEYII-----K 57

Query: 74  PIEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSET--EKMEEKIQFTGIFP 131
            I  V    P S +  +F+ W+A Y F+ +GLV R   SAL +   +     +    I  
Sbjct: 58  EILAVEQVRPFSSEYVQFLSWIAYYNFTKLGLVLR---SALVKDIPDSAAYILTNNNIER 114

Query: 132 RINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPN 191
              T A  RVL   + G  +   D + A ++    +  L   G I++I   +S +   P 
Sbjct: 115 SCLTPAVCRVLALFR-GSQYITSDTLDAEKIQRKTVQKLIDIGAIERIHASVSEIKALPE 173

Query: 192 LYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH--LGKQV 249
               L     ++Q    +   +C +GF V L+ GVTGSGKT VYL     +L      QV
Sbjct: 174 ELKKLKFELSDEQSTARE--KICMEGFTVYLLDGVTGSGKTLVYLSAALEILQRDAAAQV 231

Query: 250 LILLPEISLTSAILERFQKRF--GVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           ++L  EI+L S I ER +K F   V+  EWHS LS + R K W +V      +I+G RSA
Sbjct: 232 IMLFSEIALASYIFERIKKSFLGMVEIVEWHSDLSPARRRKNWHKVVTNKARLIIGARSA 291

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEG-ILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           + LP   L +IV+DEEHD S+KQ++G   YNARD++I+RGK+ + PV+L SATPS+ES  
Sbjct: 292 ILLPIPNLQMIVVDEEHDQSFKQDQGDFTYNARDLAIMRGKLFNIPVILSSATPSLESYY 351

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMR-GQTIAQGKSLSPEMIDGIRHTLARNEQTL 425
           N   + +  + L  R+  + LP ++V+DMR  Q ++Q   +S E+ + +  T     Q+L
Sbjct: 352 NVQKKGFVHLTLERRFGGAQLPDVRVVDMRKAQKVSQ--HISHELYEELNCTFDSGMQSL 409

Query: 426 LFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSS 485
           LFLN+RGYA + +C  CG+R+KC  C  WLVEH+    L CH CG        C  C SS
Sbjct: 410 LFLNKRGYASIIICSSCGHRMKCPDCIAWLVEHKQNNTLLCHLCGFKRPMITKCEEC-SS 468

Query: 486 GKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQL 545
            K+I+ G G+E+IAEE+ E FP   + I+SSD      ++   +  I KG++DI+IGTQ+
Sbjct: 469 DKIISFGPGVEKIAEEIGELFPSKEVLIMSSD-----TKITENIQKIEKGDVDIVIGTQI 523

Query: 546 VAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGL-KSLGLIQAYQ 604
           +AKG++FPR++L+ ++D D+ +   DLR+SE++FQ+L Q  GR GR  +     ++Q+Y 
Sbjct: 524 IAKGYDFPRLTLLAIIDSDVSMHTGDLRNSEKSFQILQQAIGRVGRRKVYPGRVVLQSYS 583

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
               V++AL + D ++FY+ E++ R +  +PPF RL ++IISG   +EV  YA  + +  
Sbjct: 584 TDSVVVEALKNNDRETFYKEELKMRLAEEMPPFSRLISIIISGLIEREVIAYARKIAKTI 643

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ-MYDNTIKRSNA---LR 720
               +I VFGP  + + M + R+R+R+LI   +N     FFS+ M  + + +  A   + 
Sbjct: 644 IPIREINVFGPCPAAIGMRKKRFRYRILIVVPKN-----FFSRNMLTDLLTQFTAEKKVE 698

Query: 721 VQFDIDPQNFL 731
           VQ D DP  FL
Sbjct: 699 VQVDTDPLCFL 709


>gi|58696762|ref|ZP_00372300.1| primosomal protein N [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|58537047|gb|EAL60181.1| primosomal protein N [Wolbachia endosymbiont of Drosophila
           simulans]
          Length = 741

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 241/755 (31%), Positives = 393/755 (52%), Gaps = 84/755 (11%)

Query: 46  VPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQMCEFVKWVADYTFSPMGL 105
           VP   + ++GIVW  S++  +    +L+ IE   D P +  ++  F +WVA Y   P+G+
Sbjct: 2   VPFGKKRLIGIVWKYSDKSNR----ELKFIEQKIDLPNIRPKLIAFAEWVAQYNLIPIGM 57

Query: 106 VARMV---------VSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIK-------DGK 149
           +A+++         +  L   E+ +E  + +        +A  +++  +        DG+
Sbjct: 58  LAKVIMGGVLKVNHIDKLVCVEQKQETSEISCQLSPEQQIASDKIISNLNEYSVTLLDGE 117

Query: 150 IWEKR---------DLIRASQVSSHVIDGLKAQGVIKQIFEVIS---PVVDSP------- 190
               +          LI+      +    L +Q    Q++E  +   P    P       
Sbjct: 118 TGSGKTEVYLSVIAQLIKNYTAVPNAAQTLPSQCPETQLYEHCNLGLPRGCYPSSLTLGS 177

Query: 191 --------NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGS-------GKTEVY 235
                   N+YF+L  +   Q   ++  V      F +     VT S         T  Y
Sbjct: 178 SFSYNLITNVYFNLKPIPNLQSKFLDSSVKHWNDTFILKAKPTVTFSIPSLPRTSMTPEY 237

Query: 236 LEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVAR 295
           +E+ +       Q+LILLPEI LTS ++ R + +      EWHS L+   R   W  +A 
Sbjct: 238 VEMTSG--EGNTQILILLPEIVLTSQLVNRVRGQISKNLVEWHSGLTPKTRRNNWLNIAN 295

Query: 296 GAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVL 355
           G   +I+G RSALFLP+K L LI++DEEHD S+KQE+GI+YNARDM+I+  K E+ P++L
Sbjct: 296 GNAQIIIGARSALFLPYKNLKLIIVDEEHDSSFKQEQGIIYNARDMAIILAKFENIPIIL 355

Query: 356 VSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIR 415
            SATP +E+  +  +  Y+ V L+ R+  + LP ++V+DMR       + +S E+ + I+
Sbjct: 356 SSATPLLETIHHVKNGNYNHVKLTKRFGGAELPLIKVVDMRNNK----QWISSELFESIK 411

Query: 416 HTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIY 475
            T+ + +Q +LFLNRRGYA L +C+ CG ++ CL+C+ WL  H+ K  L CH C +    
Sbjct: 412 QTIEKKQQVMLFLNRRGYAQLAICKKCGYKISCLNCAVWLTYHKKKNALLCHHCSYQLKL 471

Query: 476 SQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKG 535
            + C  C S   +   G GIER+ EE+ +  P A+ +++SSD +     + L L    K 
Sbjct: 472 PEKCSNCQSEQPLSLYGIGIERLLEEMVKLIPNAKTAMISSDQKSVSNIIDLVL----KE 527

Query: 536 EIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLK 595
           E++IIIGTQ++AKGHNFP+++LVGV++ DL L N+DLR++E+T+QLL QV GR+GRF  K
Sbjct: 528 EVNIIIGTQIIAKGHNFPKLTLVGVINADLSLENSDLRAAEKTYQLLHQVAGRSGRFNEK 587

Query: 596 SLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVEN 655
            + ++Q   P   +++AL+    DSFYE E+++R    +PPF RL A+II G      + 
Sbjct: 588 GMVIVQTNNPESSIIKALLHQKRDSFYEIELKSRREAKMPPFSRLIALIICGKNRIATQK 647

Query: 656 YAYNL-----------------KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLL--IHGK 696
            A  +                 K  +    +  + GP+ + +  +  +YR+R+L  IH K
Sbjct: 648 AANEIVKSLLCHPSSSTTCIQEKNVSADKKEFEILGPSPAAINFLNNKYRYRVLLKIHNK 707

Query: 697 RNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
            + ++Q        N    ++++ V  D+DP +F 
Sbjct: 708 HSLSIQKKLKYWIKNC-NLNSSIAVIIDVDPVSFF 741


>gi|308274050|emb|CBX30649.1| hypothetical protein N47_E41610 [uncultured Desulfobacterium sp.]
          Length = 820

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 212/545 (38%), Positives = 326/545 (59%), Gaps = 13/545 (2%)

Query: 195 SLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLP 254
           S P+    Q++V+  V+    KGF+  L++GVTGSGKTEVY+++ +A +  G  VL+L+P
Sbjct: 273 SAPVPTHEQENVISNVLNFLGKGFSPFLLNGVTGSGKTEVYMKLASAAIDRGYSVLVLVP 332

Query: 255 EISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKK 314
           EI+L S I +RF+ RFG   A  HS LS+  +   W ++  G IS+ +G RSA+F P   
Sbjct: 333 EIALISQIEKRFRARFGECVAILHSGLSSGEKFDQWNRITDGRISITIGARSAVFAPLSN 392

Query: 315 LGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYH 374
           +GLIV+DEEHD SYKQE G+ YNARD+++VR K+E+  V+L SATPS++S  N +S+++ 
Sbjct: 393 IGLIVVDEEHDSSYKQEGGLRYNARDLAVVRAKLENCIVLLGSATPSLQSHQNVLSKKFS 452

Query: 375 SVHLSTRYRNSALPHLQVIDMRGQTIAQG--KSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
            + L+ R  N  +P + ++D++     +G  +  S E+IDGI++TL R EQ LLFLNRRG
Sbjct: 453 GLTLTKRVENRMMPEVSIVDLKDNRDNRGVRRFFSQELIDGIKNTLVRKEQVLLFLNRRG 512

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +A   +C VCG  +KC +C   L  H+++    CH CG++   + +C  CGSS   +  G
Sbjct: 513 FAGFPVCSVCGEAVKCKNCDISLTLHKAENSYKCHYCGYTKTAASNCSKCGSSAIQLL-G 571

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++   V   FP AR++ + +D     G +   L  + +  IDI+IGTQ+V KGH++
Sbjct: 572 LGTEKVEAAVKSLFPKARVARMDADTTIRKGSVLNILKDLNEHNIDILIGTQMVVKGHDY 631

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LVG++  DL L   D R+ ERTFQLL+QV GRAGR  LK   ++Q Y P H  + A
Sbjct: 632 PNITLVGIICADLSLAFPDFRACERTFQLLAQVAGRAGRGDLKGRVILQTYNPDHFTILA 691

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL--------KEHA 664
               D  SFY+ EI  R+ ++ PPF ++  + +SG   ++    A  L         E+ 
Sbjct: 692 AKKQDFKSFYQKEILFRKDLDYPPFSKMIMIRLSGKDKKKTHECAIALGKCCNELKAENK 751

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKR--SNALRVQ 722
                ++V GP E+ +  + GRYR+++L+ G   + +Q F  ++     K+       + 
Sbjct: 752 SFQKSVIVLGPVEASVTKIAGRYRWQILLKGHSFNPIQQFARKIIFEKAKKICGKDTSIF 811

Query: 723 FDIDP 727
            D+DP
Sbjct: 812 IDVDP 816



 Score = 41.2 bits (95), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 41  GSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SRQMCEFVKWVADYT 99
           G  V VP   R   G V   SE   + D+ +++ I  V D  PL    M  F KW++DY 
Sbjct: 39  GKRVAVPFGQRKATGYVLCESEYSSEYDNKEIKSIFDVLDETPLFPPSMVPFFKWISDYY 98

Query: 100 FSPMGLVARMVV 111
             P+G V +  +
Sbjct: 99  IFPLGTVIKTAL 110


>gi|158520042|ref|YP_001527912.1| primosomal protein N' [Desulfococcus oleovorans Hxd3]
 gi|158508868|gb|ABW65835.1| primosomal protein N' [Desulfococcus oleovorans Hxd3]
          Length = 679

 Score =  412 bits (1059), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 250/718 (34%), Positives = 372/718 (51%), Gaps = 79/718 (11%)

Query: 28  YIYSVPSAMKVE--LGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL- 84
           Y YSVP  + ++   G  V+VP   + V G V     E    D+ +++P+  V D  PL 
Sbjct: 19  YTYSVPEPLLLQAVCGRRVQVPFGRQMVAGTVL---GEATACDNAEIKPVAAVLDDGPLF 75

Query: 85  SRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDK 144
              M  F +WVADY   P+G     + +AL   +  ++     G  P+          D 
Sbjct: 76  PATMIPFFRWVADYYLYPLG---ETIANALPAGDLPKKSAPPVGKIPK----------DA 122

Query: 145 IKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVV-DSPNLYFSLPILDKNQ 203
           + D                                     P++ D+P      P L  +Q
Sbjct: 123 VGD-------------------------------------PILPDTP------PDLTTDQ 139

Query: 204 QDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAIL 263
           + VV  +V     GF   L++G+TGSGKTEVY+ +VAA L +GK  L+L+PEI+L +   
Sbjct: 140 EAVVADLVSRLDAGFCSCLLAGITGSGKTEVYMRVVAAALAMGKTALVLVPEIALIAQAE 199

Query: 264 ERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEE 323
            RF  RFG   A  HS LS + R   W ++ARG  ++ +G RSA+F P  + G+I++DEE
Sbjct: 200 HRFCARFGHTVAVLHSGLSRTERWHQWSKIARGEAAIAIGTRSAVFAPLDRPGIIIVDEE 259

Query: 324 HDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVH-LSTRY 382
           HD SYKQE G+ YNA D+++VR K+    VVL SATPS++S  N  + ++   + +  R 
Sbjct: 260 HDTSYKQESGLRYNACDLAVVRAKLSDAVVVLGSATPSVQSLHNATTGKFSKTYRMDRRI 319

Query: 383 RNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQ 440
               LP + V+D+R Q   +G    +S E+   +  TLA+  Q LLFLNRRG+A L +C 
Sbjct: 320 NRQPLPAITVVDLREQQARRGPRAYISDELHRAMAETLAQGNQVLLFLNRRGFASLPVCA 379

Query: 441 VCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG-KMIACGFGIERIA 499
            CGN +KC HC   L  H+      CH CG+S   ++ C +CGSS  K++  G G E++ 
Sbjct: 380 ACGNTIKCKHCDISLTLHKGANAFRCHFCGYSRAAARGCDICGSSSIKLL--GLGTEKVE 437

Query: 500 EEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVG 559
           E V + FP A ++ L  D     G +   L  +   +IDI++GTQ++AKGH+FP ++L+G
Sbjct: 438 EAVKQLFPEASVARLDRDTTTRKGAMLRILKDLKNRKIDILVGTQMIAKGHDFPGITLIG 497

Query: 560 VVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDAD 619
           V+  DL L   D R+ ERTFQLL+QV GRAGR       ++Q Y P H  + A    D  
Sbjct: 498 VICADLSLNFPDFRAGERTFQLLAQVAGRAGRGVDPGRVILQTYNPDHLCIAAATRQDGS 557

Query: 620 SFYESEIRARESVNLPPFGRLAAVIISGTK-------YQEVENYAYNLKEHAPRSSDIV- 671
           +FY+ EI  R  +  PPF R+  + IS T         +E  +    LK  AP     V 
Sbjct: 558 AFYDQEIAFRRQLGYPPFSRMVHLHISATDPAKAKARAREAGDCCTALKNSAPAVFGAVE 617

Query: 672 VFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMY--DNTIKRSNALRVQFDIDP 727
           V GP E+P+  +  RYR+++L+  +  + ++ F +++   D    R   +R+  D+DP
Sbjct: 618 VLGPVEAPIHKLASRYRWQILLKSRSAAAVKSFAARLLAQDGQRLRKGGVRLVVDVDP 675


>gi|297183584|gb|ADI19711.1| hypothetical protein [uncultured bacterium EB000_36F02]
          Length = 652

 Score =  412 bits (1058), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 244/721 (33%), Positives = 375/721 (52%), Gaps = 76/721 (10%)

Query: 15  RVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP 74
           +V ILL    + P+ Y   S + +++G  V VP     + G+VW N  EK       ++ 
Sbjct: 2   KVPILLPNIFNHPFTYE-SSDLNLKIGDYVIVPFGKSKITGVVW-NQFEKDTKKKYVIKK 59

Query: 75  IEYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRIN 134
           +      P L +   EF+ W ++Y   P G+  ++++ + S  EK          FP+  
Sbjct: 60  VIEKLKIPSLKKTTIEFLNWFSEYNIVPKGMALKLLLLSSSAIEK----------FPK-- 107

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                            +K +L + SQ+ ++ I                           
Sbjct: 108 -----------------KKYELFK-SQLKNNNIK-------------------------- 123

Query: 195 SLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLP 254
               L K+Q+  ++++     K F V ++ G TGSGKT VY E +  ++  G Q L++LP
Sbjct: 124 ----LSKDQKISLKKMNEYNEK-FRVHVLQGTTGSGKTMVYFEALKQLIKKGFQGLVMLP 178

Query: 255 EISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKK 314
           EI LT    ++F + FG KPA WHS +S   +E IW  +  G I  ++G RS+LFLPFKK
Sbjct: 179 EIGLTGQFEKKFVEFFGFKPAVWHSGVSKKNKEIIWSGITNGEIKAVIGARSSLFLPFKK 238

Query: 315 LGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYH 374
           LGLI++DEE+D SYKQ+EG++YNARDM+I R   E+ PV L++A PSIE+  N    +Y 
Sbjct: 239 LGLIIVDEEYDQSYKQDEGVIYNARDMAISRASFENIPVNLITAVPSIETYDNIKKGKYS 298

Query: 375 SVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYA 434
              L  RY++++LP+ ++I++    +     LS E+I  +   L R +Q L FLNRRG++
Sbjct: 299 FSKLDKRYQDASLPNYEIINLNNTKLEAQSWLSKEIIQKVNLHLERKDQILFFLNRRGFS 358

Query: 435 PLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGF- 493
           P  LC+ C     C +CS  LV H+ K+ L CH CG+ A   ++C   G      AC F 
Sbjct: 359 PYVLCKKCLKSYSCPNCSINLVYHKHKQNLLCHYCGYKAKLDRACNKEG------ACDFA 412

Query: 494 ----GIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
               G+ERI EEV + FP  +  I SSD        ++ L  I   EI I+IGTQL++KG
Sbjct: 413 FSGPGVERILEEVKKKFPTKKSIIFSSDTMNKKSSSEI-LEKILNNEIQILIGTQLISKG 471

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
            +FP ++ + V+D DL     DLR +E+  QL  Q++GRAGR G  +    Q Y     +
Sbjct: 472 FHFPSLNCIVVIDIDLSSQGHDLRGAEKNLQLYHQLSGRAGRTGKPATVYFQTYNLNTKM 531

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           +  + + + D F   E+  R+  NLPPF R  A+II+G K   +E  A   K     S +
Sbjct: 532 ISDITNKNPDIFLNKELEVRKLNNLPPFQRFVALIITGNKENFLEQEAIKFKNFIQNSVE 591

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQN 729
             V GP  +P+F ++ ++R RLLI GK++  +Q   + +  +  K  + +++  D+DP N
Sbjct: 592 GKVLGPVSAPIFRLKRKFRVRLLIRGKKSLKVQNSLANVI-SKYKFPSGIKLTVDVDPIN 650

Query: 730 F 730
           F
Sbjct: 651 F 651


>gi|310819501|ref|YP_003951859.1| primosomal protein n' [Stigmatella aurantiaca DW4/3-1]
 gi|309392573|gb|ADO70032.1| Primosomal protein N' [Stigmatella aurantiaca DW4/3-1]
          Length = 777

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 258/745 (34%), Positives = 396/745 (53%), Gaps = 45/745 (6%)

Query: 22  QAVSGPYIYSVPSAMKVEL--GSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVF 79
           + V G + Y VP  +   L  G  V VP    T LG     +    + + +KL+PI+ V 
Sbjct: 43  RPVRGEFTYVVPDVLSGRLVPGQRVLVPFGRGTALGFFLGPASPPAE-EGVKLKPIQRVL 101

Query: 80  D-CPPLSRQMCEFVKWVADYTFSPMGLVARMVVS-ALSETEKMEEKIQFTGIFPRINTVA 137
           +  P L   +   +++ A++   P+G V R  +   LS+ E  EEK       P +   A
Sbjct: 102 EESPSLPPDLIALLRFAAEHYRYPLGEVIRSALPPGLSKAE--EEK----AARPDVQQFA 155

Query: 138 RLRVLDKIKDGKIWEKRDLI---------RAS-QVSSHVIDG-------LKAQGVIKQIF 180
             RV +   + +    +  +         RA  +  +H I G       L ++G++    
Sbjct: 156 VARVAEPPAELRRAPAQSAVLNYLLAVGGRAPLEEVAHAIPGARETLKKLASRGLVHIEE 215

Query: 181 EVISPVVDSPNLYFSLPILDKNQQDVVEQVVP--LCTKGFAVSLISGVTGSGKTEVYLEI 238
           +V+ P V    L    P L   +Q V  + +   L   GF   L+ GVTGSGKTEVYL  
Sbjct: 216 QVLQPGVRE-GLEQGRPALLTPEQGVAVKSLHAVLEAGGFQTVLLHGVTGSGKTEVYLRA 274

Query: 239 VAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAI 298
           V   L  GK  L+L+PEI+LT  ++ RF+ RFG + A  HS L    R   W+ + +G +
Sbjct: 275 VEHALSQGKGSLVLVPEIALTPQLVGRFRSRFGAEVAVLHSGLKDRERLFHWQALRKGTV 334

Query: 299 SVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSA 358
            + VGVRSA++ P + LGL+V+DEEHD S+KQE+ + YNARDM++VRGK     VVL SA
Sbjct: 335 RIAVGVRSAIWAPVENLGLVVVDEEHDPSFKQEDKLRYNARDMAVVRGKQAGALVVLGSA 394

Query: 359 TPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMR-------GQTIAQGKSLSPEMI 411
           TPS+ES  N    RY  + + +R  +  +P ++++D+R       G  + +   LSP ++
Sbjct: 395 TPSLESLENVRRGRYGVLEMKSRVDDRPMPGIELVDLRIERPREGGPILEEAPILSPPLL 454

Query: 412 DGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGH 471
           D ++ TL R +QT+LFLNRRG++   LC+VCG  LKC  C   L  HRS  ++ CH CG 
Sbjct: 455 DAMQETLERGQQTILFLNRRGHSTFLLCEVCGLTLKCSDCDVCLTLHRSSARVVCHYCGL 514

Query: 472 SAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSA 531
           ++     C  C  +G ++  G G ER+  EV E  P AR++ L  D      R+   L+A
Sbjct: 515 NSPVPDHCREC--TGPLLKLGIGTERVEAEVAERLPHARVARLDRDSATSAERVTELLAA 572

Query: 532 IAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGR 591
            A+ EID+++GTQ+VAKGH+FP ++LV VV  D  L   D R++ERTF LL+QV GRAGR
Sbjct: 573 FARREIDVLVGTQMVAKGHDFPGVTLVCVVMADTSLAIPDFRAAERTFHLLTQVAGRAGR 632

Query: 592 FGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQ 651
                  L+Q Y P    ++ +++ D D F + E+  R ++  PP+ RL A+ + G   +
Sbjct: 633 GKDPGRVLVQTYNPESEPVKRVLAHDFDGFAQQELEWRRALAYPPYTRLVAIRLEGEHPE 692

Query: 652 EVENYAYNL-----KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFS 706
           +    A  L     +   P S+ + + GPA +P+  VRGR R+++L+    ++ L    +
Sbjct: 693 QTARVARMLGDFLSRRMPPASAGVRMLGPALAPIAKVRGRTRWQMLLKAPTHAALAPLLT 752

Query: 707 QMYDNTIKRSNALRVQFDIDPQNFL 731
           ++     +    ++V  D+DP   L
Sbjct: 753 RLEVKLEEVPAGVKVTIDVDPGAML 777


>gi|148262457|ref|YP_001229163.1| primosomal protein N' [Geobacter uraniireducens Rf4]
 gi|146395957|gb|ABQ24590.1| replication restart DNA helicase PriA [Geobacter uraniireducens
           Rf4]
          Length = 754

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 270/748 (36%), Positives = 388/748 (51%), Gaps = 59/748 (7%)

Query: 28  YIYSVPSAMK--VELGSIVRVPLRSRT----VLGIVWYNSEEKYKIDSLKLRPIEYVFDC 81
           + Y+VP  +      G  V VP   R     V+GIV  + EE        L+PI  V D 
Sbjct: 22  FHYAVPPELAPLATTGVRVLVPFGRRKLTGYVIGIVAESEEE--------LKPISAVLDP 73

Query: 82  PPL-SRQMCEFVKWVADYTFSPMGLVARMVVSALSETE------------KMEEKIQFTG 128
            PL + +  EF +W A Y   P+G V +  + A    E            + EE++   G
Sbjct: 74  EPLFTSEELEFFRWSASYYLHPLGEVIKTALPAGINVESRKRQVCSADGMETEEEVLIGG 133

Query: 129 ----------IFPRINTVARLR--------VLDKIKDGKIWEKRDLIRASQVSSHVIDGL 170
                       P +   A LR         L  I +    + R    A+   +H    L
Sbjct: 134 KGVKRETFYRAVPSLELPANLRGKGLRIAEFLRTISEAAAGQLRREFGAT--PAHFRRLL 191

Query: 171 KAQGVIKQIFEVI-SPVVDSPNLYFSLPILDKNQQDVVEQVVPLCT-KGFAVSLISGVTG 228
           +   V     EV   P  +    + +  +L+ +Q + +E+++     + FA  L+ GVTG
Sbjct: 192 ELGLVEASEREVYRDPFREEVFAHDTPLVLNDSQSEALERIIAATDGRAFAPFLLHGVTG 251

Query: 229 SGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREK 288
           SGKTEVYL+ +A VL  GK  L+L+PEI+LT  +++RF+ RF    A  HS LS   R  
Sbjct: 252 SGKTEVYLQSIAHVLDAGKTALVLVPEIALTPQLVKRFKSRFTCGIAVLHSGLSDGERYD 311

Query: 289 IWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKI 348
            WR++ R  +S+++G RSALF P   +G+IV+DEEH+ SYKQ EG  YNARD+++VRGK+
Sbjct: 312 EWRRIRRKEVSIVIGARSALFAPLSAIGIIVVDEEHEASYKQSEGFRYNARDLALVRGKM 371

Query: 349 ESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSP 408
               V+L SATP + +       +   +HL  R RN  +P  +++D RG    +G +  P
Sbjct: 372 SKAVVILGSATPLLTTYHAAQEGKLGYLHLPHRVRNLPMPATELLDARGH---KGDTFLP 428

Query: 409 EMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQ 468
           ++   I   LA   QTLLFLNRRG+A   +CQ CG+ L+C +CS  L  HR +++ +CH 
Sbjct: 429 QLTSAIAKNLAAGGQTLLFLNRRGFATYLVCQDCGHVLRCPNCSVTLTYHRRRERHFCHY 488

Query: 469 CGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQ 528
           C +S      C  C S    +  G G ER+ EEV E FPLAR+  +  D   G G     
Sbjct: 489 CDYSIPAPSVCPECDSQAIGL-LGRGTERVEEEVRELFPLARVGRMDRDTTSGRGGHARV 547

Query: 529 LSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGR 588
           L  +  G IDI+IGTQ++AKGH+FP ++LVGVV  D  L   D RSSERTFQL+SQV GR
Sbjct: 548 LKGLEDGTIDILIGTQMIAKGHDFPGVTLVGVVSADATLNIPDFRSSERTFQLISQVMGR 607

Query: 589 AGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGT 648
           AGR       LIQ+  P H  +   V+ D + FY  EI  R  V  PPF  LAA+ +SG 
Sbjct: 608 AGRGDAPGKVLIQSLAPDHYAITHAVAHDFEGFYAEEISFRREVGYPPFTHLAALTLSGN 667

Query: 649 KYQEVENYAYNLKE--HAPR---SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQG 703
              EVE  A  +    H+ +    S + + GP  +PL  +RGRYR+++L+     + L  
Sbjct: 668 SVAEVEKGAEAVAGVLHSTKRELKSRVEILGPVSAPLGKIRGRYRWQILLKSTGRAELHR 727

Query: 704 FFSQMYDNTIKRSNALRVQFDIDPQNFL 731
             ++ +   +K    +R+  D+DP + L
Sbjct: 728 LLAR-FKAGVKLPAVVRMAVDVDPVDML 754


>gi|115372434|ref|ZP_01459743.1| primosomal protein N' [Stigmatella aurantiaca DW4/3-1]
 gi|115370647|gb|EAU69573.1| primosomal protein N' [Stigmatella aurantiaca DW4/3-1]
          Length = 810

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 258/745 (34%), Positives = 396/745 (53%), Gaps = 45/745 (6%)

Query: 22  QAVSGPYIYSVPSAMKVEL--GSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVF 79
           + V G + Y VP  +   L  G  V VP    T LG     +    + + +KL+PI+ V 
Sbjct: 76  RPVRGEFTYVVPDVLSGRLVPGQRVLVPFGRGTALGFFLGPASPPAE-EGVKLKPIQRVL 134

Query: 80  D-CPPLSRQMCEFVKWVADYTFSPMGLVARMVVS-ALSETEKMEEKIQFTGIFPRINTVA 137
           +  P L   +   +++ A++   P+G V R  +   LS+ E  EEK       P +   A
Sbjct: 135 EESPSLPPDLIALLRFAAEHYRYPLGEVIRSALPPGLSKAE--EEK----AARPDVQQFA 188

Query: 138 RLRVLDKIKDGKIWEKRDLI---------RAS-QVSSHVIDG-------LKAQGVIKQIF 180
             RV +   + +    +  +         RA  +  +H I G       L ++G++    
Sbjct: 189 VARVAEPPAELRRAPAQSAVLNYLLAVGGRAPLEEVAHAIPGARETLKKLASRGLVHIEE 248

Query: 181 EVISPVVDSPNLYFSLPILDKNQQDVVEQVVP--LCTKGFAVSLISGVTGSGKTEVYLEI 238
           +V+ P V    L    P L   +Q V  + +   L   GF   L+ GVTGSGKTEVYL  
Sbjct: 249 QVLQPGVRE-GLEQGRPALLTPEQGVAVKSLHAVLEAGGFQTVLLHGVTGSGKTEVYLRA 307

Query: 239 VAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAI 298
           V   L  GK  L+L+PEI+LT  ++ RF+ RFG + A  HS L    R   W+ + +G +
Sbjct: 308 VEHALSQGKGSLVLVPEIALTPQLVGRFRSRFGAEVAVLHSGLKDRERLFHWQALRKGTV 367

Query: 299 SVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSA 358
            + VGVRSA++ P + LGL+V+DEEHD S+KQE+ + YNARDM++VRGK     VVL SA
Sbjct: 368 RIAVGVRSAIWAPVENLGLVVVDEEHDPSFKQEDKLRYNARDMAVVRGKQAGALVVLGSA 427

Query: 359 TPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMR-------GQTIAQGKSLSPEMI 411
           TPS+ES  N    RY  + + +R  +  +P ++++D+R       G  + +   LSP ++
Sbjct: 428 TPSLESLENVRRGRYGVLEMKSRVDDRPMPGIELVDLRIERPREGGPILEEAPILSPPLL 487

Query: 412 DGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGH 471
           D ++ TL R +QT+LFLNRRG++   LC+VCG  LKC  C   L  HRS  ++ CH CG 
Sbjct: 488 DAMQETLERGQQTILFLNRRGHSTFLLCEVCGLTLKCSDCDVCLTLHRSSARVVCHYCGL 547

Query: 472 SAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSA 531
           ++     C  C  +G ++  G G ER+  EV E  P AR++ L  D      R+   L+A
Sbjct: 548 NSPVPDHCREC--TGPLLKLGIGTERVEAEVAERLPHARVARLDRDSATSAERVTELLAA 605

Query: 532 IAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGR 591
            A+ EID+++GTQ+VAKGH+FP ++LV VV  D  L   D R++ERTF LL+QV GRAGR
Sbjct: 606 FARREIDVLVGTQMVAKGHDFPGVTLVCVVMADTSLAIPDFRAAERTFHLLTQVAGRAGR 665

Query: 592 FGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQ 651
                  L+Q Y P    ++ +++ D D F + E+  R ++  PP+ RL A+ + G   +
Sbjct: 666 GKDPGRVLVQTYNPESEPVKRVLAHDFDGFAQQELEWRRALAYPPYTRLVAIRLEGEHPE 725

Query: 652 EVENYAYNL-----KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFS 706
           +    A  L     +   P S+ + + GPA +P+  VRGR R+++L+    ++ L    +
Sbjct: 726 QTARVARMLGDFLSRRMPPASAGVRMLGPALAPIAKVRGRTRWQMLLKAPTHAALAPLLT 785

Query: 707 QMYDNTIKRSNALRVQFDIDPQNFL 731
           ++     +    ++V  D+DP   L
Sbjct: 786 RLEVKLEEVPAGVKVTIDVDPGAML 810


>gi|108763692|ref|YP_629685.1| primosomal protein N' [Myxococcus xanthus DK 1622]
 gi|108467572|gb|ABF92757.1| primosomal protein N' [Myxococcus xanthus DK 1622]
          Length = 795

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 253/761 (33%), Positives = 404/761 (53%), Gaps = 38/761 (4%)

Query: 3   SSGSSVEGVVCSRVI--ILLLQAVSGPYIYSVPS--AMKVELGSIVRVPLRSRTVLGIVW 58
           ++ ++V   V + V+  I + + V G + Y++P   A ++E G  V VP    T LG  +
Sbjct: 41  AAAATVRAEVSTPVLASIAVGRPVRGEFTYTLPDELAGRLEPGQRVLVPFGRGTALGF-Y 99

Query: 59  YNSEEKYKIDSLKLRPIEYVF-DCPPLSRQMCEFVKWVADYTFSPMGLVARMVV-----S 112
                    + ++L+ ++ V  D P L + +   +++ A +   P+G V R  +      
Sbjct: 100 LGPASPPTGEKVRLKAVQRVLEDSPSLPKDLIALLRFAAVHYRYPLGEVIRGALPPGLSK 159

Query: 113 ALSETEKMEEKIQF-----TGIFPRINTV----ARLRVLDKIKDGKIWEKRDLIRASQVS 163
           A+ E E   +   F       + P ++      A L  L  +      E  ++  A   +
Sbjct: 160 AVDEKEARPDVQHFAVALVNEVPPELSRAPAQSAALAYLLAVGGSAPLE--EVAHAIPGA 217

Query: 164 SHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVV--PLCTKGFAVS 221
              +  L  +G  +   + +   V    L    P     +QD    V+   L    F   
Sbjct: 218 RETLKKLATRGFARLEEKTVEASVKE-GLIQGRPDHLTPEQDAAGVVLRAALDAATFQPF 276

Query: 222 LISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSL 281
           L+ GVTGSGKTEVYL      L LGK  LIL+PEI+LT  ++ RF+ RFG + A  HS+L
Sbjct: 277 LLHGVTGSGKTEVYLRAAEHALSLGKGSLILVPEIALTPQLVGRFRSRFGAEVAVLHSAL 336

Query: 282 STSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDM 341
               R   W+ + RG + + VGVRSA+F P   LGLIV+DEEHD S+KQEE + Y ARD+
Sbjct: 337 KDRERLFHWQALRRGDVKIAVGVRSAVFAPVDNLGLIVVDEEHDPSFKQEEKLRYQARDL 396

Query: 342 SIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMR----- 396
           ++VRGK     VVL SATP++E+  N    RY  + L  R  +  +P ++++D+R     
Sbjct: 397 AVVRGKQAGAVVVLGSATPALETLENVKRGRYQLLELKHRVDDRPMPTIELVDLRVERPR 456

Query: 397 -GQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWL 455
            G    +   LSP +++ +  T+ R +Q +LFLNRRG++ + LC+VCG  LKC  C   L
Sbjct: 457 EGVVTEEAPILSPPLLEAMAETIGRGQQVILFLNRRGHSTVLLCEVCGLSLKCSECDVCL 516

Query: 456 VEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILS 515
             HRS+ ++ CH CG +    + C+ C  +G M+  G G ER+  EV E  P AR++ L 
Sbjct: 517 THHRSQNRVVCHYCGLAMPVPEQCLEC--TGPMLKLGIGTERVEAEVLERIPTARVARLD 574

Query: 516 SDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSS 575
            D      RL   L++ A+ E+D+++GTQ+VAKGH+FP ++LV VV  D  L+  D R++
Sbjct: 575 RDSASSAERLTEMLASFARRELDVLVGTQMVAKGHDFPGVTLVCVVMADTSLSIPDFRAA 634

Query: 576 ERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLP 635
           ERTF LL+QV+GRAGR       L+Q Y P    ++ +++ D D F   E+  R+++  P
Sbjct: 635 ERTFHLLTQVSGRAGRGKDPGRVLVQTYNPDAEPVRRVLAHDFDGFANQELEWRKALAYP 694

Query: 636 PFGRLAAVIISGTKYQEVENYAYNL-----KEHAPRSSDIVVFGPAESPLFMVRGRYRFR 690
           P+ R+AAV + G   ++  + A +L     +   P S+ + + GPA +P+  +RG+ R++
Sbjct: 695 PYSRMAAVRLEGEHPEQTASVARSLGNIVSRHMPPASAGVRMLGPALAPISRIRGKTRWQ 754

Query: 691 LLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           LL+ G  ++ L    +++    +   +A++V  D+DP   L
Sbjct: 755 LLLKGPTHTALAPLLARLEAALVDVPSAVKVVIDVDPGAML 795


>gi|330813460|ref|YP_004357699.1| helicase PriA essential for oriC/DnaA-independent DNA replication
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486555|gb|AEA80960.1| helicase PriA essential for oriC/DnaA-independent DNA replication
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 477

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/479 (40%), Positives = 293/479 (61%), Gaps = 2/479 (0%)

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI+LT  I ERF+  F  +PA WHSS+    ++ IW+ V+   I +++G RS++FLPF
Sbjct: 1   MPEIALTKQIAERFKDYFDAEPALWHSSIGEKKKKNIWKGVSENKIKLVLGARSSIFLPF 60

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
           + L LIVIDEEHD SYKQEEG+ YNARDMSI+R  IE FP++L+SATPSIES  N  +++
Sbjct: 61  QNLKLIVIDEEHDSSYKQEEGVSYNARDMSILRASIEKFPILLISATPSIESYYNSKNKK 120

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  V L+ RY+N +LP+++++D+      +GK +S ++I  ++  +   +Q L FLNRRG
Sbjct: 121 YFYVSLTERYKNISLPNIEIVDLINAPADKGKFISNQLIPKLKKIIKEKQQVLFFLNRRG 180

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           ++   +C  C  RL C +CS  LV H++ KK  CH C +    +Q C       +    G
Sbjct: 181 HSTYIMCYECKKRLVCPNCSIGLVFHQTSKKAICHYCDYKTSLTQKC-TNNKDCEFTFYG 239

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            GIER+ EEV   FP  +I I SSD        +  ++ I K +I I++GTQL++KG +F
Sbjct: 240 LGIERVFEEVQLIFPEIKIQIFSSDSINNNKNSEQIINDIEKNKIPILVGTQLISKGFHF 299

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++ + V++ D     +D+R+SE+ FQLL Q++GRAGR   K+   +Q   P + ++ +
Sbjct: 300 PSLNYIVVINSDTNFLGSDIRASEKNFQLLQQLSGRAGREENKAKVFLQTNDPNNKILHS 359

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           L + D   FYE E+  RE   LPPF +L ++I+SG    EVE  +  LK+       I +
Sbjct: 360 LSNSDPKVFYEEELLFRERAYLPPFSKLVSIIVSGANQFEVEKISKKLKQSFLLQEKIKI 419

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           +GP  +P+F +RG+YR RLL+    +   Q F     D  I   N ++++ D+DP +FL
Sbjct: 420 YGPVTAPIFKIRGKYRMRLLLKYDVSLFPQKFIKNWLDMNIVSKN-IKLEVDVDPVSFL 477


>gi|253698821|ref|YP_003020010.1| primosomal protein N' [Geobacter sp. M21]
 gi|251773671|gb|ACT16252.1| primosomal protein N' [Geobacter sp. M21]
          Length = 752

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 250/747 (33%), Positives = 387/747 (51%), Gaps = 50/747 (6%)

Query: 24  VSGPYIYSVPSAM--KVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDC 81
           + G + Y VP  +  +   G  V VP   R V G +  +++      + +L+ +  + D 
Sbjct: 17  LEGSFHYLVPERLSPQAAAGKRVLVPFGRRKVTGYLLGDADAP---GAGELKEVLDILDE 73

Query: 82  PPL-SRQMCEFVKWVADYTFSPMGLVARMVVSA---LSETEKMEEKIQFTGIFPRI---- 133
            PL +    +F +W+A Y   P+G V +M + A   L    + E+    T +        
Sbjct: 74  EPLFTASELDFYRWIAGYYLHPLGEVIKMALPAGINLVSRYRCEQGEDGTPVLKEFLAGG 133

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVID-GLKAQGVIKQIFEVISPV------ 186
             V   R    + D    E+R   +  ++  ++++ G      +++ F   +P       
Sbjct: 134 RNVRTERYFLPVAD---EERRPRGKGLEILEYLLEMGESPAADLRKRFGNCTPQLNRLVQ 190

Query: 187 -----VDSPNLYFS------------LPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGS 229
                V++  +Y              LP+     + +      +  + F+  L+ GVTGS
Sbjct: 191 LGCARVEAREVYRDPFRSQQYQHDGPLPLNPAQSEALTRLTASIKARAFSPFLLHGVTGS 250

Query: 230 GKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKI 289
           GKTEVYL+ +A  L  G+  L+++PEI+LT  ++ RF++RF    A  HS LS   R   
Sbjct: 251 GKTEVYLQTIAVALAAGRSALVMVPEIALTPQLVGRFKRRFDCGIAVLHSGLSDGERYDE 310

Query: 290 WRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIE 349
           WR++ RG  S+++G RSALF P  ++G+IV+DEEH+ SYKQ EG+ YNARD+++VRGK+ 
Sbjct: 311 WRRIRRGEASIVIGARSALFAPLTEVGVIVVDEEHEGSYKQSEGVRYNARDLALVRGKLA 370

Query: 350 SFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPE 409
              V+L SATP + S    ++ +   + L  R R   +P  Q++D R Q   +G+   P 
Sbjct: 371 GGVVILGSATPLVTSYHAAMNGKLGYLQLPDRVRELPMPQTQMLDARRQ---KGEVFLPP 427

Query: 410 MIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQC 469
           +I+ +   L    QTLLFLNRRG+A   +C+ CG+ L+C +C   L  HR K K  CH C
Sbjct: 428 LIEAMGENLDNGGQTLLFLNRRGFATYLVCESCGHVLRCPNCEVTLTFHRLKGKHVCHYC 487

Query: 470 GHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQL 529
             S +  +SC  CG  G++   G G ER+ E+V + FP AR+S +  D   G G     L
Sbjct: 488 DFSMLPPKSCPHCG-DGEITLLGRGTERVEEQVQQLFPHARVSRMDRDTTRGKGGHARVL 546

Query: 530 SAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRA 589
             + +GE+DI+IGTQ++AKGH+FP ++LVGV+  D  L   D RS+ERTFQL++QV GRA
Sbjct: 547 KELEEGEVDILIGTQMIAKGHDFPGVTLVGVLSADASLNLPDFRSAERTFQLVTQVMGRA 606

Query: 590 GRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTK 649
           GR       L+Q   P H  +   VS D   FY  EI  RE V  PPF  LA++ IS   
Sbjct: 607 GRGDKPGRVLVQTLAPEHYALTHAVSHDFQGFYREEIAFREEVGYPPFAHLASLTISAVA 666

Query: 650 YQEVE---NYAYNLKEHAPRSS--DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGF 704
             + E   + A  L +   R     + V GP  +PL  VRGR+R+++L+ G+  ++L   
Sbjct: 667 ASQGEHSADEAAALLQKIKRECRLRVEVLGPVTAPLGKVRGRFRWQILLKGRERADLHRL 726

Query: 705 FSQMYDNTIKRSNALRVQFDIDPQNFL 731
               +       + +R+  D+DP + L
Sbjct: 727 LFH-FRGGFSHPSTVRLTIDVDPVDML 752


>gi|189425866|ref|YP_001953043.1| primosomal protein N' [Geobacter lovleyi SZ]
 gi|189422125|gb|ACD96523.1| primosomal protein N' [Geobacter lovleyi SZ]
          Length = 758

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 251/737 (34%), Positives = 387/737 (52%), Gaps = 46/737 (6%)

Query: 28  YIYSVPS--AMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL- 84
           + Y VP   A +++ G  V VP   R V   V   S      +  +L+ +  V D  PL 
Sbjct: 35  FHYRVPEDLAPRIQPGVRVFVPFGRRKVTAYVLRFSTPP---EGQQLKGLLDVLDPEPLW 91

Query: 85  SRQMCEFVKWVADYTFSPMGLVARMVV--------------SALSETEKMEEKIQFTGIF 130
           +     F +W+ADY   P+G V +  +               A+S  +K+  +  F+ + 
Sbjct: 92  TEAELTFFQWIADYYLHPLGEVLKTALPTGINLQSRSSVDGEAVSGGKKVRHERVFSALP 151

Query: 131 PRINTVARLRVLDKI----KDGKIWEKRDLIRASQVSSHV-------IDGLKAQGVIKQI 179
                  R + LD +    + G +      +R  + S ++       +  +    V +  
Sbjct: 152 ADAPVKLRGKGLDILAFLRQSGSVSSAELKVRFGECSPNLRRLVELGLVRMSEHEVYRDP 211

Query: 180 FEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIV 239
           F  +S   DSP      P+    QQ +   +  L ++ F+  L+ G+TGSGKTEVYL+ +
Sbjct: 212 FAGLSVTKDSPK-----PLTLHQQQALTTILTALDSRYFSPFLLHGITGSGKTEVYLQGI 266

Query: 240 AAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAIS 299
           A  L  G+  L+L+PEISLT  +++RF+ RF    A  HS+LS   R   WR++ RG + 
Sbjct: 267 AHTLAAGRNALVLVPEISLTPQLVQRFRARFCDGIAVLHSALSDGERYDEWRRIRRGEVR 326

Query: 300 VIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSAT 359
           +++G RSA+F P +++G+IV+DEEH+ S+KQ +G+ YNARD+++VRG+ E   V+L SAT
Sbjct: 327 IVIGARSAIFAPLERIGIIVVDEEHEASFKQSDGLRYNARDLALVRGQQEQAVVLLGSAT 386

Query: 360 PSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLA 419
           P I +R      +   + L  R  N  LP   +I+ R   +     LSP++I+ +   L 
Sbjct: 387 PLITTRFAAQQGKLGYLSLPERVGNRPLPATSIINTR---MTAESPLSPQLIEALADNLE 443

Query: 420 RNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSC 479
           R EQ+LLFLNRRG+A   +C  CG  L+C +CS  L  HR ++K  CH C +       C
Sbjct: 444 RGEQSLLFLNRRGFASWLVCPACGADLQCPNCSVSLTYHRQRRKSLCHYCDYQVPAPCIC 503

Query: 480 VVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDI 539
             CG   ++   G G ERI  E+ E FP ARI+ + SD   G G     L  + +GE+DI
Sbjct: 504 PSCGEL-ELKEMGVGTERIEHELLEQFPGARIARMDSDTTSGKGGHARILDKVGRGEVDI 562

Query: 540 IIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGL 599
           ++GTQ++AKGH+FP ++LVGV+  +  L   D R++ERTFQ+LSQV GRAGR  L    L
Sbjct: 563 LVGTQMIAKGHDFPGVTLVGVLQAEGSLYLPDFRATERTFQVLSQVIGRAGRGELPGRVL 622

Query: 600 IQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEV----EN 655
           +QA  P H  +      D + FY+ E+  R+ +N PP+G LAA+ +S T  + +    E 
Sbjct: 623 LQAMTPDHYGIAYAADHDFERFYQEELLFRQELNYPPYGFLAAIKLSATSEKSLTSAAEQ 682

Query: 656 YAYNLKEHAPR-SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIK 714
            A  L+    R    + + GPA +PL+ +RGR+R ++L+     + L+      Y     
Sbjct: 683 SAAVLRSIKSRLGLRVEILGPAPAPLYRLRGRFRQQILLKDSSRAALRRLLI-AYRREQS 741

Query: 715 RSNALRVQFDIDPQNFL 731
               +R+  DIDP + L
Sbjct: 742 LPATVRMAIDIDPVDLL 758


>gi|149197290|ref|ZP_01874342.1| primosome assembly protein PriA [Lentisphaera araneosa HTCC2155]
 gi|149139836|gb|EDM28237.1| primosome assembly protein PriA [Lentisphaera araneosa HTCC2155]
          Length = 735

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 250/725 (34%), Positives = 381/725 (52%), Gaps = 27/725 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLSRQ 87
           + Y +P+ M + LG  VR+P       G V  +  +K      +L+ I  V +   +  +
Sbjct: 17  FDYKIPAGMDLRLGCRVRIPFGRTERTGYV-VDLVDKSDFPENRLKAIA-VNEGHLIPEK 74

Query: 88  MCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEK----------IQFTGIFPRINT-- 135
           M +  +W+ADY  + M    R ++ A    +K++EK          IQ   + P +    
Sbjct: 75  MMQLGQWIADYYCTGMIQSVRNMLPAPVRKDKVKEKTQKLLSFAEGIQPPSLVPELEKKY 134

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVI--SPVVDSPNLY 193
             R  V+  +   K   +  L++ + VS+  I  L   G++++    +   P  D   + 
Sbjct: 135 PPRAAVVKALLGLKEAPQALLMKVANVSASPIKSLLKAGILEEEVRHVERDPFGDE-EVI 193

Query: 194 FSLPI-LDKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
            S P+ L   Q D  + +   +  +  A  ++ G+TGSGKTEVYL+ +A  L  GKQ ++
Sbjct: 194 ISKPLELTDEQTDAFKLITNEMDEEKPATVVLYGITGSGKTEVYLQAIAEALSRGKQAIV 253

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           L+PEISLT   + RF+ RFG + +  HS LS   R   W+ ++RG   ++VG RSALF P
Sbjct: 254 LVPEISLTPQTVHRFRSRFGKQVSVLHSGLSEGERYDQWKLISRGETQIVVGARSALFAP 313

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           F   G+IV+DEEH+ SYKQ+    YNARD++++RG ++  PVVL SATPS E+  N    
Sbjct: 314 FHNPGIIVVDEEHEPSYKQDSHPRYNARDIAVMRGIMDKCPVVLGSATPSFETMNNANQG 373

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLARNEQTLLFLN 429
           +Y    L+ R   + +P ++++DMR +  A G +   S E+I+ ++  L    QT+LFLN
Sbjct: 374 KYKMAKLTQRPSTAVVPSIKLVDMRTEAAATGSNQIFSRELIESVKQQLHDRMQTILFLN 433

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGY+    C+ C    KC  CS     HR    L CH CG        C  CG    + 
Sbjct: 434 RRGYSTHLTCEKCQYTSKCGDCSTSHTYHRKSNVLICHLCGDIKEPPTKCPDCGHK-DLS 492

Query: 490 ACGFGIERIAEEVCE-YFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAK 548
             G G E+I E +C   FP ARI+ + SD        +  L    +G+ DI+IGTQ++AK
Sbjct: 493 FSGLGTEKI-ERLCRGVFPNARIARMDSDTMTRKDSHKTMLGDFQQGKYDILIGTQMIAK 551

Query: 549 GHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHP 608
           G +FPR++LVGVV  D GL  AD R++ERTFQLL+QV+GR+GR       LIQ Y PTHP
Sbjct: 552 GLHFPRVTLVGVVFADAGLNMADFRAAERTFQLLAQVSGRSGRGDDAGRVLIQTYNPTHP 611

Query: 609 VMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR-- 666
            +Q  + GD D+FYE E   RE +  PPF ++  +   G +   + + A +  +H  +  
Sbjct: 612 ALQCALEGDFDAFYEDEKMGREVMKFPPFSKMVLIHFRGPEEGPLASLASDFSQHLSKAC 671

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
           + D  +     SP+  VRG+YR++L I       L    + +  N  K     ++  D+D
Sbjct: 672 TKDDRLMPAVPSPIEKVRGQYRYQLTIFSDNIRRLVRVLNWLRLN-YKAPKEYKIIIDVD 730

Query: 727 PQNFL 731
           PQ+ +
Sbjct: 731 PQSLM 735


>gi|117922105|ref|YP_871297.1| primosomal protein N' [Shewanella sp. ANA-3]
 gi|117614437|gb|ABK49891.1| primosomal protein N' [Shewanella sp. ANA-3]
          Length = 736

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 241/722 (33%), Positives = 388/722 (53%), Gaps = 39/722 (5%)

Query: 34  SAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP------IEYVFDCPPLSRQ 87
           SA + ++G  V+VP   + ++G+V   +      DS  L P      IE++ D P L   
Sbjct: 30  SAQQPQIGIRVKVPFGRQQLIGLVTAIT------DSCDLAPTQLKSVIEFIDDAPLLPES 83

Query: 88  MCEFVKWVADYTFSPMG--LVARMVVSALSETEKMEEKIQFTGIFPRINTVA-------- 137
           + +   W A Y F   G  L   + V+     +   +KIQ+  I    N +A        
Sbjct: 84  LYKLTLWAARYYFCSQGQMLTQALPVALRKGLDAAPQKIQYWQITELGNNIAPETLKRAP 143

Query: 138 -RLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSL 196
            + R+L++++   + ++ D+I + +++   +  L+ +G I +  ++    +D    + S 
Sbjct: 144 AQKRLLERLQQACLTQE-DVI-SLELNKAALKTLEDKGWIARHEKLAELNLD----WRSQ 197

Query: 197 PILDK-----NQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
             LD+     N++  V   +    +G+  +L+ G+TGSGKTEVYL ++  +L  GKQ LI
Sbjct: 198 LELDEAPHRLNKEQAVAVTLLTQQQGYHCTLLEGITGSGKTEVYLAVLEHILKQGKQALI 257

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           L+PEI LT   + RF++RF V  A  HS L+ + R + WRQ   G  ++I+G RSALF P
Sbjct: 258 LVPEIGLTPQTINRFKRRFKVNVAVLHSGLTDNQRLEAWRQARCGQAAIIIGTRSALFTP 317

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
               G+I++DEEHD S+KQ+EG+ Y+ARD++++RG +ES PV+L SATPS+E+  N +S 
Sbjct: 318 MAFPGVIILDEEHDSSFKQQEGVGYHARDLAVMRGHLESIPVILGSATPSLETLQNALSG 377

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           RYH + L  R  N+      +ID++   +  G  +S  +I+ IR  L    Q LLFLNRR
Sbjct: 378 RYHHLQLGERAGNAKKVRQGIIDIKNLPLKAG--MSAPLINEIRSHLEAGNQVLLFLNRR 435

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIAC 491
           G+AP  LC  CG+  +C  C  +   H+S  ++ CH CG+     + C  CGS+  ++  
Sbjct: 436 GFAPALLCHECGHLHECDRCDAFFTVHQSLGEIRCHHCGNQYAIPRQCHNCGST-MLMGQ 494

Query: 492 GFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHN 551
           G G E++AE + + FP   +  +  D     G L+  LSAI KGE  I++GTQ++AKGH+
Sbjct: 495 GIGTEQLAEALQQEFPKYPVVRIDRDTTRLKGSLESHLSAIHKGEYKILVGTQMLAKGHH 554

Query: 552 FPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQ 611
           FP ++LVG++D D  L +AD R+ ER  QL +QV GRAGR       L+Q +Q  +P+++
Sbjct: 555 FPDVTLVGLLDVDGALFSADFRAPERFGQLYTQVAGRAGRANKPGTVLLQTHQSDNPILR 614

Query: 612 ALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIV 671
            L+      F  S+++ R+   LPP   +  V        + +N+        P+  +  
Sbjct: 615 DLLHRGYGEFARSQLKERQMALLPPAWHMVLVRAEAHSAVDADNFLNAFAALLPQDKEFE 674

Query: 672 VFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDIDPQN 729
           + GP  +PL    G++R +L+   K    LQ  F ++Y     +  +   R   D DPQ+
Sbjct: 675 IIGPMPAPLDRKAGKFRRQLMFQAKHRHRLQQEFERIYPLVEQLPEAKRCRWSLDRDPQD 734

Query: 730 FL 731
            L
Sbjct: 735 LL 736


>gi|289578512|ref|YP_003477139.1| primosomal protein N' [Thermoanaerobacter italicus Ab9]
 gi|289528225|gb|ADD02577.1| primosomal protein N' [Thermoanaerobacter italicus Ab9]
          Length = 732

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 248/728 (34%), Positives = 383/728 (52%), Gaps = 37/728 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLG-IVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           Y Y +P  M V++G  V VP  +R + G ++    +  Y +D  K++ I  + D   +  
Sbjct: 18  YTYHIPEGMNVKIGMRVSVPFNNRYIEGYVISITDKASYSVD--KIKDIHRILDSYSIFD 75

Query: 86  RQMCEFVKWVADY----------TFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINT 135
            +M E  KW+ DY          T  P+G+        + +    E   Q +   P+   
Sbjct: 76  EKMIELAKWMRDYYKCYFSEALQTIMPVGIKQGEKKVKVVKINIDEIPFQLSKRAPK--- 132

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
             +  +L  +K+       +L++   +   VI  L+ +G I +I+E         ++  +
Sbjct: 133 --QYEILQYLKNRSPIRLSELVKVLNIDYGVIRSLQNKGYI-EIYEEEVLRFSVKDIEKT 189

Query: 196 LPIL-DKNQQDVVEQV-VPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
            P+L  + QQ  VE+V   + T  F   L+ GVTGSGKTEVYL+++   + +GK  ++L+
Sbjct: 190 KPLLLTEEQQKAVEEVKSSILTGTFDKYLLFGVTGSGKTEVYLQLIDEAIKIGKSAIVLV 249

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEISLT   +ERF  RFG + A  HS LS   R   WR+V  G + V+VGVR+A+F PF 
Sbjct: 250 PEISLTPQTIERFVSRFGNRVAVIHSGLSPGERFDEWRKVKNGLVDVVVGVRNAVFAPFN 309

Query: 314 KLGLIVIDEEHDISYKQEE-GILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
            LGLI+IDEEH+ +YKQ +    YNA++++  R +I+   +V+ SATPS+E+        
Sbjct: 310 NLGLIIIDEEHETTYKQSDLRPKYNAKEVAEKRCEIQKAVLVMASATPSLETYYKANKGE 369

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLARNEQTLLFLNR 430
           Y  + L+ R  N ++P ++V++M  + +A G +   S ++   I+  L R EQT+LFLNR
Sbjct: 370 YKLIRLTKRI-NVSMPQIEVVNM-SEELASGNTSIFSRKLFSYIKENLKRREQTILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGY+    C+ CG   KC +C   L  H   KKL CH CG+      +C  CGS  ++  
Sbjct: 428 RGYSSFVSCRDCGYVPKCSNCDISLTYHFEDKKLVCHYCGYEEPMKDTCPKCGSK-RIRY 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G ER+  ++ ++FP AR+  +  D     G  +        G+ DI+IGTQ+++KG 
Sbjct: 487 LGIGTERVENDIKKFFPNARVLRMDVDTTRKKGSHEKIFYDFRNGKADILIGTQMISKGF 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           + P ++LVGV+  D+ L   D RSSERTFQLL+QV GRAGR       +IQ Y+  H  +
Sbjct: 547 DIPNVTLVGVILADITLNLPDFRSSERTFQLLTQVAGRAGRGEKPGRVVIQTYEEDHYSI 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYN-------LKEH 663
            A    +   FY  EI+ RE    PPF  L  V+ISG K +EV+N A N       L   
Sbjct: 607 VAAKQQNYGKFYNEEIKYREIFKYPPFSHLMNVVISGEKEEEVKNMAANAYLTCQKLINK 666

Query: 664 APRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQF 723
               S   + GPA +P+  +  RYR+++++  +  S L     ++    +K    +R+  
Sbjct: 667 LQNKSYNKILGPAPAPISKINNRYRWQVILKSEDRSILAKIAEEI--QKMKYPKDIRISI 724

Query: 724 DIDPQNFL 731
           DIDP N +
Sbjct: 725 DIDPLNIM 732


>gi|42520997|ref|NP_966912.1| primosomal protein N [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410738|gb|AAS14846.1| primosomal protein N [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 780

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 212/568 (37%), Positives = 327/568 (57%), Gaps = 39/568 (6%)

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGS-------GKTEVYLEIVAAVL 243
           N+YF+L  +   Q   ++  V      F +     VT S         T  Y+E+ +   
Sbjct: 225 NVYFNLKPIPNLQSKFLDSSVKRWNDTFILKAKPTVTFSIPSLPRTSMTPEYVEMTSG-- 282

Query: 244 HLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVG 303
               Q+LILLPEI LTS ++ R + +      EWHS L+   R   W  +A G   +I+G
Sbjct: 283 EGNTQILILLPEIVLTSQLVNRVRGQISKNLVEWHSGLTPKTRRNNWLNIASGNAQIIIG 342

Query: 304 VRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIE 363
            RSALFLP+K L LI++DEEHD S+KQE+GI+YNARDM+I+  K E+ P++L SATP +E
Sbjct: 343 ARSALFLPYKNLKLIIVDEEHDSSFKQEQGIIYNARDMAIILAKFENIPIILSSATPLLE 402

Query: 364 SRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQ 423
           +  +  +  Y+ V L+ R+  + LP ++V+DMR       + +S E+ + I+ T+ + +Q
Sbjct: 403 TIHHVKNGNYNHVKLTKRFGGAELPLIKVVDMRNNK----QWISSELFESIKQTIEKKQQ 458

Query: 424 TLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCG 483
            +LFLNRRGYA L +C+ CG ++ CL+C+ WL  H+ K  L CH C +     + C  C 
Sbjct: 459 VMLFLNRRGYAQLAICKKCGYKISCLNCAVWLTYHKKKNALLCHHCSYQLKLPEKCSNCQ 518

Query: 484 SSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGT 543
           S   +   G GIER+ EE+ +  P A+ +++SSD +     + L    I K E++IIIGT
Sbjct: 519 SEQPLSLYGIGIERLLEEMVKLIPNAKTAMISSDQKSVSNVIDL----ILKEEVNIIIGT 574

Query: 544 QLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAY 603
           Q++AKGHNFP+++LVGV++ DL L N+DLR++E+T+QLL QV GR+GRF  K + ++Q  
Sbjct: 575 QIIAKGHNFPKLTLVGVMNADLSLENSDLRAAEKTYQLLHQVAGRSGRFNEKGMVIVQTN 634

Query: 604 QPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYN---- 659
            P   +++AL+    DSFYE E+++R    +PPF RL A+II G K Q     A N    
Sbjct: 635 NPESSIIKALLHQKRDSFYEIELKSRREAKMPPFSRLIALIICG-KNQIATQKAANEIVK 693

Query: 660 -LKEHAPRSS-------------DIVVFGPAESPLFMVRGRYRFRLL--IHGKRNSNLQG 703
            L  H+  S+             +  + GP+ + +  +  +YR+R+L  IH K + ++Q 
Sbjct: 694 SLLCHSSSSTICIQEKNVGVDKKEFEILGPSPAAINFLNNKYRYRVLLKIHNKHSLSIQK 753

Query: 704 FFSQMYDNTIKRSNALRVQFDIDPQNFL 731
                  N    ++++ V  D+DP +F 
Sbjct: 754 KLKYWIKNC-NLNSSIAVIIDVDPVSFF 780



 Score = 54.7 bits (130), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 96/228 (42%), Gaps = 65/228 (28%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +LL   +   + Y++    ++ LG  V VP   + ++GIVW  S++  +    +L+ I
Sbjct: 11  VDVLLPLPIDQLFSYAIEENTEILLGDYVVVPFGKKRLIGIVWKYSDKSNR----ELKFI 66

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINT 135
           E   D P +  ++  F +WVA Y   P+G               M  K+   G+      
Sbjct: 67  EQKIDLPNIRPKLIAFAEWVAQYNLIPVG---------------MLAKVIMGGVL----- 106

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
             ++  +DK+   K  +K+++   S++S                   +SP          
Sbjct: 107 --KVNHIDKLVCAK--QKQEI---SEISCQ-----------------LSP---------- 132

Query: 196 LPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVL 243
                  +Q V    +      ++V+L+ G TGSGKTEVYL ++A ++
Sbjct: 133 -------EQQVASDKIISSLNEYSVTLLDGETGSGKTEVYLSVIAQLI 173


>gi|113971825|ref|YP_735618.1| primosomal protein N' [Shewanella sp. MR-4]
 gi|113886509|gb|ABI40561.1| primosomal protein N' [Shewanella sp. MR-4]
          Length = 736

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 241/722 (33%), Positives = 388/722 (53%), Gaps = 39/722 (5%)

Query: 34  SAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP------IEYVFDCPPLSRQ 87
           SA + ++G  V+VP   + ++G+V   +      DS  L P      IE++ D P L   
Sbjct: 30  SAQQPQIGIRVKVPFGRQQLIGLVTAIT------DSCDLAPTQLKSVIEFIDDAPLLPES 83

Query: 88  MCEFVKWVADYTFSPMG--LVARMVVSALSETEKMEEKIQF-------TGIFPRI--NTV 136
           + +   W A Y F   G  L   + V+     +   +KIQ+       + I P       
Sbjct: 84  LYKLTLWAARYYFCSQGQMLTQALPVALRKGLDAAPQKIQYWQITELGSNIAPETLKRAP 143

Query: 137 ARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSL 196
           A+ R+L++++   + ++ D+I + +++   +  L+ +G I +  ++    +D    + S 
Sbjct: 144 AQKRLLERLQQTSLTQE-DVI-SLELNKAALKTLEDKGWIARHEKLAELNLD----WRSQ 197

Query: 197 PILDK-----NQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
             LD+     N++  V   +    +G+  +L+ G+TGSGKTEVYL ++  +L  GKQ LI
Sbjct: 198 LELDEAPHRLNKEQAVAVTLLTQQQGYHCTLLEGITGSGKTEVYLAVLEHILKQGKQALI 257

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           L+PEI LT   + RF++RF V  A  HS L+ + R + WRQ   G  ++I+G RSALF P
Sbjct: 258 LVPEIGLTPQTINRFKRRFKVNVAVLHSGLTDNQRLEAWRQARCGQAAIIIGTRSALFTP 317

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
               G+I++DEEHD S+KQ+EG+ Y+ARD++++RG +ES PV+L SATPS+E+  N +S 
Sbjct: 318 MAFPGVIILDEEHDSSFKQQEGVGYHARDLAVMRGHLESIPVILGSATPSLETLQNALSG 377

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           RYH + L  R  N+      +ID++   +  G  +S  +I+ IR  L    Q LLFLNRR
Sbjct: 378 RYHHLQLGERAGNAKKVRQGIIDIKNLPLKAG--MSAPLINEIRSHLEAGNQVLLFLNRR 435

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIAC 491
           G+AP  LC  CG+  +C  C  +   H+S  ++ CH CG+     + C  CGS+  ++  
Sbjct: 436 GFAPALLCHECGHLHECDRCDAFFTVHQSLGEIRCHHCGNQYAIPRQCHNCGST-MLMGQ 494

Query: 492 GFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHN 551
           G G E++AE + + FP   +  +  D     G L+  LSAI KGE  I++GTQ++AKGH+
Sbjct: 495 GIGTEQLAEALQQEFPKYPVVRIDRDTTRLKGSLESHLSAIHKGEYKILVGTQMLAKGHH 554

Query: 552 FPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQ 611
           FP ++LVG++D D  L +AD R+ ER  QL +QV GRAGR       L+Q +Q  +P+++
Sbjct: 555 FPDVTLVGLLDVDGALFSADFRAPERFGQLYTQVAGRAGRANKPGTVLLQTHQSDNPILR 614

Query: 612 ALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIV 671
            L+      F  S+++ R+   LPP   +  V        + +N+        P+  +  
Sbjct: 615 DLLHRGYGEFARSQLKERQMALLPPAWHMVLVRAEAHSALDADNFLNAFAALLPQDKEFE 674

Query: 672 VFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDIDPQN 729
           + GP  +PL    G++R +L+   K    LQ  F ++Y     +  +   R   D DPQ+
Sbjct: 675 IIGPMPAPLDRKAGKFRRQLMFQAKHRHRLQQEFERIYPLVEQLPEAKRCRWSLDRDPQD 734

Query: 730 FL 731
            L
Sbjct: 735 LL 736


>gi|24375608|ref|NP_719651.1| primosomal protein N' [Shewanella oneidensis MR-1]
 gi|24350505|gb|AAN57095.1|AE015843_7 primosomal protein N' [Shewanella oneidensis MR-1]
          Length = 737

 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 242/719 (33%), Positives = 383/719 (53%), Gaps = 39/719 (5%)

Query: 37  KVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP------IEYVFDCPPLSRQMCE 90
           K ++G  V+VP   + ++G+V   +      DS  L P      IE++ D P L   + +
Sbjct: 34  KPQIGVRVKVPFGRQQLIGLVTAIT------DSCDLAPTQLKSVIEFIDDAPLLPESLYK 87

Query: 91  FVKWVADYTFSPMG--LVARMVVSALSETEKMEEKIQF-------TGIFPRI--NTVARL 139
              W A Y F   G  L   + V+     +   +KIQ+       + I P       A+ 
Sbjct: 88  LTLWAARYYFCSQGQMLTQALPVALRKGLDAAPQKIQYWQITTIGSNIAPETLKRAPAQK 147

Query: 140 RVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPIL 199
           ++L+ +K   + ++   + + +++   +  L+ +G I Q  ++    +D    + S   L
Sbjct: 148 KLLEHLKQTSLTQEE--VISLELNKTALKTLEEKGWIAQHEKIAQLNLD----WRSQLEL 201

Query: 200 DK-----NQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLP 254
           D+     N++  V   V    +G+  +L+ G+TGSGKTEVYL ++  +L  GKQ LIL+P
Sbjct: 202 DETPHRLNKEQAVAVTVLTQQQGYHCTLLEGITGSGKTEVYLALLEHILKQGKQALILVP 261

Query: 255 EISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKK 314
           EI LT   + RF++RF V  A  HS L+ + R + WRQ   G  ++I+G RSALF P   
Sbjct: 262 EIGLTPQTINRFKRRFRVNVAVLHSGLTDNQRLEAWRQARCGQAAIIIGTRSALFTPMAF 321

Query: 315 LGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYH 374
            G+I++DEEHD S+KQ+EG+ Y+ARD++++RG +ES PVVL SATPS+ES  N +S RYH
Sbjct: 322 PGVIILDEEHDSSFKQQEGVGYHARDLAVMRGHLESIPVVLGSATPSLESLQNALSGRYH 381

Query: 375 SVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYA 434
            + L  R  N+      +ID++   +  G  +S  +I+ IR  L    Q LLFLNRRG+A
Sbjct: 382 HLQLGERAGNAKKVRQGIIDIKNLPLKAG--MSAPLINEIRSHLDAGNQVLLFLNRRGFA 439

Query: 435 PLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFG 494
           P  LC  CG+  +C  C  +   H+S  ++ CH CG+     + C  CGS+  ++  G G
Sbjct: 440 PALLCHECGHLHECDRCDAFFTVHQSLGEIRCHHCGNQYAIPRQCHNCGST-MLMGQGIG 498

Query: 495 IERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPR 554
            E++AE +   FP   +  +  D     G L+  LSAI KGE  I++GTQ++AKGH+FP 
Sbjct: 499 TEQLAEALQLEFPKYPVVRIDRDTTRLKGSLESHLSAIHKGEYKILVGTQMLAKGHHFPD 558

Query: 555 MSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALV 614
           ++LVG++D D  L +AD R+ ER  QL +QV GRAGR       L+Q +Q  +P+++ L+
Sbjct: 559 VTLVGLLDVDGALFSADFRAPERFGQLYTQVAGRAGRANKLGTVLLQTHQSDNPILRDLL 618

Query: 615 SGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFG 674
                 F  S+++ R+   LPP   +  V        + +N+  +     P+  +  + G
Sbjct: 619 HRGYGEFARSQLKERQMALLPPAWHMVLVRAEAHSALDADNFLNSFASLLPQDKEFEIIG 678

Query: 675 PAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDIDPQNFL 731
           P  +PL    G++R +L+   K    LQ  F ++Y     +  +   R   D DPQ+ L
Sbjct: 679 PMPAPLDRKAGKFRRQLMFQAKHRHRLQQEFERIYPLVEQLPEAKRCRWSLDRDPQDLL 737


>gi|297544787|ref|YP_003677089.1| primosomal protein N' [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296842562|gb|ADH61078.1| primosomal protein N' [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 732

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 247/728 (33%), Positives = 384/728 (52%), Gaps = 37/728 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLG-IVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           Y Y +P  M V++G  V VP  +R + G ++    +  Y +D  K++ I  + D   +  
Sbjct: 18  YTYHIPEGMNVKIGMRVSVPFNNRYIEGYVISITDKASYSVD--KIKDIYRILDSYSIFD 75

Query: 86  RQMCEFVKWVADY----------TFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINT 135
            +M E  KW+ DY          T  P+G+        + +    E   Q +   P+   
Sbjct: 76  EKMIELAKWMRDYYKCYFSEALQTIMPVGIKQGEKKVKVVKINIDEIPFQLSKRAPK--- 132

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
             +  +L  +K+       +L++   +   VI  L+ +G IK ++E      +  ++  +
Sbjct: 133 --QYEILQYLKNRSPIRLSELVKVLNIDYSVIKNLQNKGYIK-VYEEEVLRFNIKDIERT 189

Query: 196 LPI-LDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
            P+ L + Q+  VE+V   + T  F   L+ GVTGSGKTEVYL+++   + +GK  ++L+
Sbjct: 190 KPLSLTEEQKRAVEEVKKSILTGTFDKYLLFGVTGSGKTEVYLQLIDEAIKIGKSAIVLV 249

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEISLT   +ERF  RFG + A  HS LS   R   WR+V  G + V+VGVR+A+F PF 
Sbjct: 250 PEISLTPQTIERFVSRFGNRVAVIHSGLSPGERFDEWRKVKNGLVDVVVGVRNAVFAPFN 309

Query: 314 KLGLIVIDEEHDISYKQEE-GILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
            LGLI+IDEEH+ +YKQ +    YNA++++  R +I+   +V+ SATPS+E+        
Sbjct: 310 NLGLIIIDEEHETTYKQSDLRPKYNAKEVAEKRCEIQKAVLVMASATPSLETYYKANKGE 369

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLARNEQTLLFLNR 430
           Y  + L+ R  N ++P ++V++M  + +A G +   S ++   I+  L R EQT+LFLNR
Sbjct: 370 YKLIRLTKRI-NVSMPKIEVVNM-SEELASGNTSIFSRKLFSYIKENLKRREQTILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGY+    C+ CG   KC +C   L  H   KKL CH CG+      +C  CGS  ++  
Sbjct: 428 RGYSSFVSCRDCGYVPKCPNCDISLTYHFEDKKLVCHYCGYEEPMKDTCPKCGSK-RIRY 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G ER+  ++ ++FP AR+  +  D     G  +        G+ DI+IGTQ+++KG 
Sbjct: 487 LGIGTERVENDIKKFFPNARVLRMDVDTTRKKGSHEKIFYDFRNGKADILIGTQMISKGF 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           + P ++LVGV+  D+ L   D RSSERTFQLL+QV GRAGR       +IQ Y+  H  +
Sbjct: 547 DIPNVTLVGVILADITLNLPDFRSSERTFQLLTQVAGRAGRGEKPGRVVIQTYEEDHYSI 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYN-------LKEH 663
            A    +   FY  EI+ RE    PPF  L  V+ISG K +EV+N A N       L   
Sbjct: 607 IAAKQQNYGKFYNEEIKYREIFKYPPFSHLMNVVISGEKDEEVKNMAANAYLTCQKLINK 666

Query: 664 APRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQF 723
               S   + GPA +P+  +  RYR+++++  +  S L     ++    +K    +R+  
Sbjct: 667 LQNKSYNKILGPAPAPISKINNRYRWQVILKSEDRSILAEIAEEI--QKMKYPKDIRISI 724

Query: 724 DIDPQNFL 731
           DIDP N +
Sbjct: 725 DIDPLNIM 732


>gi|114045967|ref|YP_736517.1| primosomal protein N' [Shewanella sp. MR-7]
 gi|113887409|gb|ABI41460.1| primosomal protein N' [Shewanella sp. MR-7]
          Length = 736

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 240/721 (33%), Positives = 388/721 (53%), Gaps = 39/721 (5%)

Query: 35  AMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP------IEYVFDCPPLSRQM 88
           A + ++G  V+VP   + ++G+V   +      DS +L P      IE++ D P L   +
Sbjct: 31  AQQPQIGIRVKVPFGRQQLIGLVTAIT------DSCELVPTQLKSVIEFIDDAPLLPESL 84

Query: 89  CEFVKWVADYTFSPMG--LVARMVVSALSETEKMEEKIQF-------TGIFPRI--NTVA 137
            +   W A Y F   G  L   + V+     +   +KIQ+       + I P       A
Sbjct: 85  YKLTLWAARYYFCSQGQMLTQALPVALRKGLDAAPQKIQYWQITELGSNIAPETLKRAPA 144

Query: 138 RLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLP 197
           + R+L++++   + ++ D+I + +++   +  L+ +G I +  ++    +D    + S  
Sbjct: 145 QKRLLERLQQTSLTQE-DVI-SLELNKAALKTLEDKGWIARHEKLAELNLD----WRSQL 198

Query: 198 ILDK-----NQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
            LD+     N++  V   +    +G+  +L+ G+TGSGKTEVYL ++  +L  GKQ LIL
Sbjct: 199 ELDEAPHRLNKEQAVAVTLLTQQQGYHCTLLEGITGSGKTEVYLAVLEHILKQGKQALIL 258

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI LT   + RF++RF V  A  HS L+ + R + WRQ   G  ++I+G RSALF P 
Sbjct: 259 VPEIGLTPQTINRFKRRFKVNVAVLHSGLTDNQRLEAWRQARCGQAAIIIGTRSALFTPM 318

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
              G+I++DEEHD S+KQ+EG+ Y+ARD++++RG +ES PV+L SATPS+E+  N +S R
Sbjct: 319 AFPGVIILDEEHDSSFKQQEGVGYHARDLAVMRGHLESIPVILGSATPSLETLQNALSGR 378

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           YH + L  R  N+      +ID++   +  G  +S  +I+ IR  L    Q LLFLNRRG
Sbjct: 379 YHHLQLGERAGNAKKVRQGIIDIKNLPLKAG--MSAPLINEIRSHLEAGNQVLLFLNRRG 436

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +AP  LC  CG+  +C  C  +   H+S  ++ CH CG+     + C  CGS+  ++  G
Sbjct: 437 FAPALLCHECGHLHECDRCDAFFTVHQSLGEIRCHHCGNQYAIPRQCHHCGST-MLMGQG 495

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++AE + + FP   +  +  D     G L+  LSAI KGE  I++GTQ++AKGH+F
Sbjct: 496 IGTEQLAEALQQEFPKYPVVRIDRDTTRLKGSLESHLSAIHKGEYKILVGTQMLAKGHHF 555

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LVG++D D  L +AD R+ ER  QL +QV GRAGR       L+Q +Q  +P+++ 
Sbjct: 556 PDVTLVGLLDVDGALFSADFRAPERFGQLYTQVAGRAGRANKPGTVLLQTHQSDNPILRD 615

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVV 672
           L+      F  S+++ R+   LPP   +  V        + +N+        P+  +  +
Sbjct: 616 LLHRGYGEFARSQLKERQMALLPPAWHMVLVRAEAHSAVDADNFLNAFAALLPQDKEFEI 675

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDIDPQNF 730
            GP  +PL    G++R +L+   K    LQ  F ++Y     +  +   R   D DPQ+ 
Sbjct: 676 IGPMPAPLDKKAGKFRRQLMFQAKHRHRLQQEFERIYPLVEQLPEAKRCRWSLDRDPQDL 735

Query: 731 L 731
           L
Sbjct: 736 L 736


>gi|254496623|ref|ZP_05109488.1| primosomal protein N (replication factor Y) [Legionella drancourtii
           LLAP12]
 gi|254354145|gb|EET12815.1| primosomal protein N (replication factor Y) [Legionella drancourtii
           LLAP12]
          Length = 726

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 251/723 (34%), Positives = 371/723 (51%), Gaps = 34/723 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y   + +   +G+ V VP R +T LGI+   +E +    SLK   I  V D  PL  R
Sbjct: 17  FDYEAEAGLNPCVGARVWVPFRKQTRLGIILAKNEFQEVTSSLKC--ISAVIDEEPLIQR 74

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQF-TGIFPRIN-TVARLRVLDK 144
            +     W++ Y  SP+  V  +   AL +  ++ +  Q   G F ++   V   + L  
Sbjct: 75  DILALCAWISSYYQSPLSEVLPL---ALPKKYRLGQDCQLPMGDFYQLALPVTNAKQLVP 131

Query: 145 IKDGKIWEKRDLI--RASQVSSHVIDG-----------LKAQGVIKQIFEVISPVVDSPN 191
           ++  K  E  D +  +   VS H +             L AQ +      ++    D+P 
Sbjct: 132 VRARKQLELIDFLATQTEPVSKHCLTQRGFTSSQLQKLLAAQIIFLSQQSMVPECADTP- 190

Query: 192 LYFSLPILDKNQQDVVEQVVPLCTK--GFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
                P L  N +   E V  +  +   +   L+ GVTGSGKTEVYL+++A VL  GKQV
Sbjct: 191 ---MSPALSLNPEQA-EAVTAISEQLQQYQCFLLQGVTGSGKTEVYLQVIANVLQQGKQV 246

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           L+L+PEI LT  +L RF  RF    A  HSSL+ S R+  W+      + +++G R+A+F
Sbjct: 247 LVLVPEIGLTPQLLARFTARFNQAIAVIHSSLNESERQIAWQLAKENKVKMVIGTRAAIF 306

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
            P   LGLIVIDEEHD S KQ EG+ Y+ARD +++R  + + P++L SATPS+ES  N  
Sbjct: 307 TPMPDLGLIVIDEEHDTSLKQMEGVRYSARDTALMRAHLANIPIILGSATPSLESVHNSK 366

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
             +Y  + L+ +  ++   H Q+ID+R QT+  G  L+   +  I+  L +  Q L+F+N
Sbjct: 367 QGKYKLLRLTHKALSTTPLHYQLIDLRAQTLQHG--LAIPTLHLIKEHLQKKNQVLVFIN 424

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRG+AP+ LC  CG    C  C   L  H+   ++ CH CG +      C  C  S ++I
Sbjct: 425 RRGFAPVLLCHQCGWMADCRACDSHLTLHKQAGQMICHHCGLTQRTPTYCRSC-QSNELI 483

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
             G G +R+ E +  YFP   +  +  D       L   L  I +GE  +I+GTQ++AKG
Sbjct: 484 PVGAGTQRVHEFLSSYFPETHVVRIDRDAVRKKNALDEHLEMIHRGEAQLIVGTQMLAKG 543

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           H+FPR+SLV V+D D GL N D R+ E+  QLL+QV GRAGR       LIQ + P HP+
Sbjct: 544 HHFPRLSLVVVLDADAGLYNQDFRALEQLGQLLTQVAGRAGRAEHAGQVLIQTHLPDHPL 603

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD 669
           +  L+    D F E+ +  R+   LPPF  LA +   G     V  +    KEH  +S  
Sbjct: 604 LNVLIQQGYDDFAEALLTTRQQAQLPPFHYLAVIRAQGKIAGSVLKFLQAAKEHM-QSHP 662

Query: 670 IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQM--YDNTIKRSNALRVQFDIDP 727
           + V GPA +PL     +YR +LLI       L+   +Q+  +    K SN +R   D+DP
Sbjct: 663 LTVMGPAPAPLPRKANQYRMQLLIKSSSRKVLKTSLTQLRTWLTINKLSNGVRWNVDVDP 722

Query: 728 QNF 730
            + 
Sbjct: 723 MDL 725


>gi|261346860|ref|ZP_05974504.1| primosomal protein [Providencia rustigianii DSM 4541]
 gi|282565040|gb|EFB70575.1| primosomal protein [Providencia rustigianii DSM 4541]
          Length = 732

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 230/705 (32%), Positives = 384/705 (54%), Gaps = 25/705 (3%)

Query: 40  LGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SRQMCEFVKWVADY 98
           +GS V VP   R  LG+V  N  +K +    +L+ IE + D   L    + + + W + Y
Sbjct: 29  VGSRVMVPFGKRQALGVV-VNHSDKSEFPEDQLKTIELILDAQTLFPDDLWQLLLWSSQY 87

Query: 99  TFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRV-LDKIKDGKIWE----- 152
              P+G V   +  A+    +  +  +FT I+    T+A   V L+++K     +     
Sbjct: 88  YHYPIGEV---LFHAMPTLLRQGKPAEFTPIWQWQATIAGQEVDLNELKRSPKQQQALAL 144

Query: 153 -KRDLIRASQVSSHVIDGLKAQGVIKQIF---EVISPVVDSPNLYFSL---PILDKNQQD 205
            +R  I   QV+   I+    Q + K+ +     + PV++    +F++    +   ++Q 
Sbjct: 145 LRRRPIYRHQVAELEINESALQSLKKKQYAELHPVQPVMEQWQSHFTVCGERLRLNSEQA 204

Query: 206 VVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILER 265
                +      F+  L++G+TGSGKTEVYL ++  +L  GKQ L+L+PEI LT   + R
Sbjct: 205 TAVGAIRAEDDNFSPWLLAGITGSGKTEVYLSVLENILAKGKQALVLVPEIGLTPQTINR 264

Query: 266 FQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHD 325
           F++RF V     HS+L+ S R  +W +  +G+  +I+G RSALF PF  LG+I+IDEEHD
Sbjct: 265 FRERFNVPVDVLHSALNDSERLAVWLRAKQGSNGIIIGTRSALFTPFAHLGIIIIDEEHD 324

Query: 326 ISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNS 385
            SYKQ++G  Y+ARD+++ R K E+ P+++ +ATPS+E+  N    +Y  ++L+ R  N+
Sbjct: 325 SSYKQQDGWRYHARDLAVFRAKKENIPIIMGTATPSLETLSNVQQNKYRQLNLTIRAGNA 384

Query: 386 ALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNR 445
                 +ID++GQ +  G  LS  +I  I++ LA+N Q +LFLNRRGY+P  +C  CG  
Sbjct: 385 RPADQHLIDLKGQPLKFG--LSHLLIQHIKNHLAQNNQVILFLNRRGYSPALICHECGWI 442

Query: 446 LKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEY 505
            +C  C  +   H++  +L CH C         C  CGS+  ++  G G E++ E + E 
Sbjct: 443 AECQRCDHYYTLHQNFHQLRCHHCDSQRPVPHQCPHCGSTN-LVPVGMGTEQLEEGISEL 501

Query: 506 FPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDL 565
           FP   ++ +  D     G L+  L+A+ +G   I+IGTQ++AKGH+FP ++LV ++D D 
Sbjct: 502 FPDVPVTRIDRDTTSRKGELEQHLNAVHEGGARILIGTQMLAKGHHFPDVTLVALLDVDG 561

Query: 566 GLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESE 625
            L ++D R++ER  QL  QV+GRAGR G +    +Q + P HP++  L+    ++F +  
Sbjct: 562 ALFSSDFRAAERFAQLYVQVSGRAGRAGKQGEVFLQTHHPEHPLLLTLLENGYNAFTQEA 621

Query: 626 IRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLK----EHAPRSSDIVVFGPAESPLF 681
           +  R    LPPF     +       Q+  N+ +N++    +H    S + + GPA S   
Sbjct: 622 LEERRVAMLPPFTSHILIRSEDHNNQDARNFLHNVRQYISQHPQSDSRLWILGPAPSIQA 681

Query: 682 MVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
              GR+R++LL+     + LQ F +Q+    +K+  + +V+++ID
Sbjct: 682 KRGGRFRWQLLLQHPSRAYLQQFMAQLLPELLKQPESRKVKWNID 726


>gi|222054411|ref|YP_002536773.1| primosomal protein N' [Geobacter sp. FRC-32]
 gi|221563700|gb|ACM19672.1| primosomal protein N' [Geobacter sp. FRC-32]
          Length = 754

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 268/757 (35%), Positives = 386/757 (50%), Gaps = 77/757 (10%)

Query: 28  YIYSVPSAMKVELGSIVRV--PLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL- 84
           + Y VP  +   + + VRV  P   R + G +  N  E  +    K+R I  V D  PL 
Sbjct: 22  FHYGVPPELVCRMKTGVRVLIPFGRRKITGYMIGNVPESAE----KIRDIIDVLDEEPLF 77

Query: 85  SRQMCEFVKWVADYTFSPMGLVARMVVSA-----------------LSETEKME-----E 122
           + +  +F++W A Y F P+G V +  + A                 LS  E ++     +
Sbjct: 78  TEKELDFLRWSAGYYFHPLGEVIKAALPAGINLASRTRSVETADGTLSREEVLKGGRTVK 137

Query: 123 KIQFTGIFPRINTVARLR--------VLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQG 174
           +  F    P +     LR         L ++ +      R    A+  + H +  L   G
Sbjct: 138 RETFYRALPDVELPVNLRGKGLRLLEYLRRVDEAPAGLLRREFAATTANFHRLQEL---G 194

Query: 175 VI----KQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTK-GFAVSLISGVTGS 229
           ++    ++I+    P  +    + +  +L+ +Q   +EQ+     K  FA  L+ GVTGS
Sbjct: 195 LVEFSEREIYR--DPFREEVFTHDAPLVLNFHQAAALEQLTAAGIKEQFAPFLLHGVTGS 252

Query: 230 GKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKI 289
           GKTEVYL+ +A VL  G+  L+L+PEI+LT  ++ RF+ RF    A  HS LS   R   
Sbjct: 253 GKTEVYLQAIAQVLERGRTALVLVPEIALTPQLVRRFKSRFRCGIAVLHSGLSDGERYDE 312

Query: 290 WRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIE 349
           WR++ R  +S+++G RSALF P   +G+IV+DEEH+ SYKQ EG  YNARD+++VRGK+E
Sbjct: 313 WRRIRRREVSIVIGARSALFAPLSHMGIIVVDEEHESSYKQSEGFHYNARDLALVRGKME 372

Query: 350 SFPVVLVSATPSIESRVNGISRRYHSV--------HLSTRYRNSALPHLQVIDMRGQTIA 401
              VVL SATP + +        YH+V         L  R RN  +P  +++D RG+   
Sbjct: 373 GAVVVLGSATPLVTT--------YHAVQQGKIGYLQLPERVRNLPMPGTELLDARGR--- 421

Query: 402 QGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSK 461
           +G +  PE+I  I   LA   QTLLFLNRRG+A   +C+ CG  L C +CS  L  HR +
Sbjct: 422 KGATFLPELIKAIGDNLAAGGQTLLFLNRRGFATYLVCEECGTVLSCPNCSVTLTYHRRR 481

Query: 462 KKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGG 521
           ++ +CH C +S      C  C S   +   G G ER+ EEV E +  ARI  +  D   G
Sbjct: 482 ERHFCHYCDYSIPAPSVCPKCDSQ-SIALLGRGTERVEEEVREIYVDARIGRMDRDTTTG 540

Query: 522 GGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQL 581
            G     L  +  G IDI++GTQ++AKGH+FP ++LVGV+  D  L   D RSSERT+QL
Sbjct: 541 RGGHARVLKGLENGTIDILVGTQMIAKGHDFPGVTLVGVISADATLNIPDFRSSERTYQL 600

Query: 582 LSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLA 641
           +SQV GRAGR       LIQ   P H  +   V+ D   FY  EI  R     PPF  LA
Sbjct: 601 ISQVMGRAGRGDAPGRVLIQTLNPEHYAITRAVAHDFAGFYGDEIIFRRETGYPPFAYLA 660

Query: 642 AVIISGTKYQEVENYA-------YNLKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIH 694
            ++ SG    EVE  A       + LK  A   S + + GP  SPL M+RGRYR ++L+ 
Sbjct: 661 VLVFSGNSAPEVEKGATTAAALLHRLKREA--KSRVEILGPVSSPLAMIRGRYRRQILLK 718

Query: 695 GKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
             +   L    ++ +   +K    +R+  DIDP + L
Sbjct: 719 SGQRPELHRMIAR-FRGQVKLPAVVRIAIDIDPLDML 754


>gi|99035105|ref|ZP_01314891.1| hypothetical protein Wendoof_01000265 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 717

 Score =  394 bits (1013), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 211/568 (37%), Positives = 327/568 (57%), Gaps = 39/568 (6%)

Query: 191 NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGS-------GKTEVYLEIVAAVL 243
           N+YF+L  +   Q   ++  V      F +     VT S         T  Y+E+ +   
Sbjct: 162 NVYFNLKPIPNLQSKFLDSSVKRWNDTFILKAKPTVTFSIPSLPRTSMTPEYVEMTSG-- 219

Query: 244 HLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVG 303
               Q+LILLPEI LTS ++ R + +      EWHS L+   R   W  +A G   +I+G
Sbjct: 220 EGNTQILILLPEIVLTSQLVNRVRGQISKNLVEWHSGLTPKTRRNNWLNIASGNAQIIIG 279

Query: 304 VRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIE 363
            RSALFLP+K L LI++DEE+D S+KQE+GI+YNARDM+I+  K E+ P++L SATP +E
Sbjct: 280 ARSALFLPYKNLKLIIVDEEYDSSFKQEQGIIYNARDMAIILAKFENIPIILSSATPLLE 339

Query: 364 SRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQ 423
           +  +  +  Y+ V L+ R+  + LP ++V+DMR       + +S E+ + I+ T+ + +Q
Sbjct: 340 TIHHVKNGNYNHVKLTKRFGGAELPLIKVVDMRNNK----QWISSELFESIKQTIEKKQQ 395

Query: 424 TLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCG 483
            +LFLNRRGYA L +C+ CG ++ CL+C+ WL  H+ K  L CH C +     + C  C 
Sbjct: 396 VMLFLNRRGYAQLAICKKCGYKISCLNCAVWLTYHKKKNALLCHHCSYQLKLPEKCSNCQ 455

Query: 484 SSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGT 543
           S   +   G GIER+ EE+ +  P A+ +++SSD +     + L    I K E++IIIGT
Sbjct: 456 SEQPLSLYGIGIERLLEEMVKLIPNAKTAMISSDQKSVSNVIDL----ILKEEVNIIIGT 511

Query: 544 QLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAY 603
           Q++AKGHNFP+++LVGV++ DL L N+DLR++E+T+QLL QV GR+GRF  K + ++Q  
Sbjct: 512 QIIAKGHNFPKLTLVGVMNADLSLENSDLRAAEKTYQLLHQVAGRSGRFNEKGMVIVQTN 571

Query: 604 QPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYN---- 659
            P   +++AL+    DSFYE E+++R    +PPF RL A+II G K Q     A N    
Sbjct: 572 NPESSIIKALLHQKRDSFYEIELKSRREAKMPPFSRLIALIICG-KNQIATQKAANEIVK 630

Query: 660 -LKEHAPRSS-------------DIVVFGPAESPLFMVRGRYRFRLL--IHGKRNSNLQG 703
            L  H+  S+             +  + GP+ + +  +  +YR+R+L  IH K + ++Q 
Sbjct: 631 SLLCHSSSSTICIQEKNVGVDKKEFEILGPSPAAINFLNNKYRYRVLLKIHNKHSLSIQK 690

Query: 704 FFSQMYDNTIKRSNALRVQFDIDPQNFL 731
                  N    ++++ V  D+DP +F 
Sbjct: 691 KLKYWIKNC-NLNSSIAVIIDVDPVSFF 717


>gi|326389547|ref|ZP_08211114.1| primosomal protein N' [Thermoanaerobacter ethanolicus JW 200]
 gi|325994552|gb|EGD52977.1| primosomal protein N' [Thermoanaerobacter ethanolicus JW 200]
          Length = 732

 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 244/728 (33%), Positives = 384/728 (52%), Gaps = 37/728 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLG-IVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           Y Y +P  M V++G  V VP  +R + G ++    +  Y +D  K++ I  + D   +  
Sbjct: 18  YTYRIPEGMNVKIGMRVSVPFNNRFIEGYVISITDKASYSVD--KIKDIHRILDSYSIFD 75

Query: 86  RQMCEFVKWVADY----------TFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINT 135
            +M E  KW+ +Y          T  P+G+        + +    E   Q +   P+   
Sbjct: 76  EKMIELAKWMKEYYKCYFSEALQTIMPVGIKQGEKKVKVVKINIDEIPFQLSKRAPK--- 132

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
             +  +L  +K+       +L++   +   VI  L+ +G I +I+E         ++  +
Sbjct: 133 --QYEILQYLKNRSPIRLSELVKVLNIDYGVIRSLQKKGYI-EIYEEEVLRFSVKDIERT 189

Query: 196 LPIL-DKNQQDVVEQV-VPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
            P+L  + QQ  VE+V   + T  F   L+ GVTGSGKTEVYL+++   + +GK  ++L+
Sbjct: 190 KPLLLTEEQQRAVEEVKSSILTGTFDKYLLFGVTGSGKTEVYLQLIDEAIKIGKSAIVLV 249

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEISLT   +ERF  RFG + A  HS LS   R   WR+V  G + V+VGVR+A+F PF 
Sbjct: 250 PEISLTPQTIERFVSRFGNRVAVIHSGLSPGERFDEWRKVKNGLVDVVVGVRNAVFAPFN 309

Query: 314 KLGLIVIDEEHDISYKQEE-GILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
            +GLI+IDEEH+ +YKQ +    YNA++++  R +IE   +V+ SATPS+E+        
Sbjct: 310 NIGLIIIDEEHETTYKQSDLRPKYNAKEVAEKRCEIEKAVLVMASATPSLETYYKANKGE 369

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLARNEQTLLFLNR 430
           Y  + L+ R  N ++P ++V++M  + +A G +   S ++   I+  L R EQT+LFLNR
Sbjct: 370 YKLIRLTKRI-NVSMPQIEVVNM-SEELASGNTSIFSRKLFSYIKENLKRKEQTILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGY+    C+ CG   KC +C   L  H   KKL CH CG+     ++C  CGS  ++  
Sbjct: 428 RGYSSFVSCRDCGYVPKCPNCDISLTYHFEDKKLVCHYCGYEETMKETCPKCGSK-RIRY 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G ER+  ++ ++FP AR+  +  D     G  +        G+ DI+IGTQ+++KG 
Sbjct: 487 LGIGTERVENDIKKFFPNARVLRMDVDTTRKKGSHEKIFYDFRNGKADILIGTQMISKGF 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           + P ++LVGV+  D+ L   D RSSERTFQLL+QV GRAGR       +IQ Y+  H  +
Sbjct: 547 DIPNVTLVGVILADITLNLPDFRSSERTFQLLTQVAGRAGRGEKPGRVVIQTYEDDHYSI 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYN-------LKEH 663
                 +   FY  EI+ RE    PPF  L  ++ISG + +EV+N A N       L   
Sbjct: 607 VTAKQQNYVKFYNEEIKYREIFRYPPFSHLMNIVISGEEEEEVKNTAANTYLTCQKLINK 666

Query: 664 APRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQF 723
               S   + GPA +P+  +  RYR+++++  +  + L     ++    +K S  +R+  
Sbjct: 667 LQNKSYNKILGPAPAPISKINNRYRWQVILKSEDRNILTEIAEEI--QKMKYSKDIRIAV 724

Query: 724 DIDPQNFL 731
           DIDP N +
Sbjct: 725 DIDPLNIM 732


>gi|223938508|ref|ZP_03630400.1| primosomal protein N' [bacterium Ellin514]
 gi|223892770|gb|EEF59239.1| primosomal protein N' [bacterium Ellin514]
          Length = 773

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 256/775 (33%), Positives = 405/775 (52%), Gaps = 79/775 (10%)

Query: 23  AVSGPYIYSVPS--AMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFD 80
           A+   + Y +PS  A +V++GS V+VP  +R VLG V   +EE    +   LRPI  V  
Sbjct: 10  ALRKEFDYLIPSELASQVDVGSRVQVPFGARKVLGCVTAMAEESAHAN---LRPILKVIG 66

Query: 81  CPPL-SRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKM--EEKIQFTGIFPRINTVA 137
              L + ++ +  +W+ +Y   P  +  + V+      E+    E++ F    P+   + 
Sbjct: 67  AQTLVTPKILKLARWIGEYYCCPPEIALKSVLPDAVRKEQAGWRERL-FVRALPQTEPLP 125

Query: 138 RL--------RVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVIS----- 184
           +L        R+L++ K+  + E   LI  ++ ++  +  L+ +G++    E+       
Sbjct: 126 KLPKRQQEVYRILEERKELPLQE---LIDLAETTAATVRSLEDKGLVTITTEISERDPYA 182

Query: 185 --------PVVDSPNLYFSL-----------------------PILDKN----QQDVVEQ 209
                   P+  +P    +L                       P+   N    Q D V Q
Sbjct: 183 HEHILPSQPLPLNPQQARALERIIAAMDGQQAKPSTASAGDMTPVSSSNNFRLQSDDVPQ 242

Query: 210 VVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKR 269
             P      +V L+ GVTGSGKTEVYL+ +A  L  GK  ++L+PEISLT   +ERF+ R
Sbjct: 243 TEP--KNASSVFLLHGVTGSGKTEVYLQALAHALEQGKGAIVLVPEISLTPQTVERFKAR 300

Query: 270 FGVKP-----AEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEH 324
           F   P     A  HS LS   R   W ++ +G   +++G RSA+F P   LGLI++DEEH
Sbjct: 301 FSSGPLQTLVAVLHSHLSAGERHDEWHKIRQGRARIVIGARSAIFAPVDPLGLIIVDEEH 360

Query: 325 DISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRN 384
           + +YKQEE   Y+ARD++IVRG++E   VVL SATPS+ES  N    +Y  + +  R   
Sbjct: 361 EHTYKQEESPRYHARDVAIVRGRMEGATVVLGSATPSMESFYNCSRGKYILLEMLERVDA 420

Query: 385 SALPHLQVIDMRGQTIAQGKSL---SPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQV 441
             +P ++V+DMR Q + +GKS+   SP++ + I+  L R EQT+LFLNRRGY+    C +
Sbjct: 421 KKMPLVRVVDMR-QAMRKGKSIPIYSPQLKEAIQQRLERKEQTILFLNRRGYSTSLQCPL 479

Query: 442 CGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV--VCGSSGKMIACGFGIERIA 499
           CG   +C +CS  L  HR  + L CH CGH+      C    CG+     A G G E++ 
Sbjct: 480 CGFVAQCPNCSVSLTYHRRAQILCCHVCGHTEPVPSFCPGPKCGNPDIRYA-GLGTEKVE 538

Query: 500 EEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVG 559
           + + + FP ARI  + SD        +  L     G+IDI++GTQ++AKG +FP ++LVG
Sbjct: 539 DTLLKLFPHARIKRMDSDTLKKKDDYRRILGDFRLGKIDILVGTQMIAKGLHFPNVTLVG 598

Query: 560 VVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDAD 619
           +V  D+ L  AD R+ ERTFQLL+QV GRAGR  ++    +Q++ P HP +Q     D  
Sbjct: 599 IVYADMALHLADFRAGERTFQLLTQVAGRAGRGDIEGEVFVQSFTPFHPAIQYARRHDFA 658

Query: 620 SFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS----SDIVVFGP 675
            FYE E+  RE +  PP  R+A + + G   ++V+  A +L+    ++     ++++ GP
Sbjct: 659 GFYEQELEFREQLKYPPVSRVAMLTLKGRNEEKVKLSADHLRRELEKALAGIKELIIAGP 718

Query: 676 AESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNF 730
           A +PL      YR+++++  ++ S +    + M + ++     + +  DIDP N 
Sbjct: 719 APAPLARAESLYRYQIMLRARQMSEVSKRLAVM-NQSLSLPEDVSLSIDIDPVNL 772


>gi|197116585|ref|YP_002137012.1| primosomal protein N', ATP-dependent helicase [Geobacter
           bemidjiensis Bem]
 gi|197085945|gb|ACH37216.1| primosomal protein N', ATP-dependent helicase [Geobacter
           bemidjiensis Bem]
          Length = 752

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 251/752 (33%), Positives = 385/752 (51%), Gaps = 60/752 (7%)

Query: 24  VSGPYIYSVPSAM--KVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDC 81
           + G + Y VP+ +  +V  G  V VP   R V G +  +++      + +L+ +  + D 
Sbjct: 17  LEGSFHYLVPARLSPQVASGKRVLVPFGRRKVTGYLLGDTDAP---GAGELKEVLDILDE 73

Query: 82  PPL-SRQMCEFVKWVADYTFSPMGLVARMVVSA---LSETEKMEEKIQFTGIF------- 130
            PL +    +F +W+A Y   P+G V +M + A   L    + E+    T +        
Sbjct: 74  EPLFTASELDFYRWIAGYYLHPLGEVIKMALPAGINLVSRYRCEQGEDGTPVLKEFLAGG 133

Query: 131 ------------------PRINTVARLRVLDKIKDGKIWEKR--------DLIRASQVSS 164
                             PR   +  L  L +I +    + R         L R  Q+  
Sbjct: 134 RNVRTERYFLPVADEERRPRGKGLEILEYLLEIGECPAADLRKRFGNCTPQLNRLVQLGC 193

Query: 165 HVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLIS 224
             ++   A+ V +  F       D P     LP+     + +      +    F+  L+ 
Sbjct: 194 ARVE---AREVYRDPFRSQEYQHDGP-----LPLNLAQSESLTRLTAAIEASAFSPFLLH 245

Query: 225 GVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTS 284
           GVTGSGKTEVYL+ +A  L  G+  L+++PEI+LT  ++ RF++RF    A  HS LS  
Sbjct: 246 GVTGSGKTEVYLQSIAVALAAGRSALVMVPEIALTPQLVGRFKRRFDCGIAVLHSGLSDG 305

Query: 285 MREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIV 344
            R   WR++ RG  S+++G RSALF P  ++G+IV+DEEH+ SYKQ EG+ YNARD+++V
Sbjct: 306 ERYDEWRRIRRGEASIVIGARSALFAPLTEVGVIVVDEEHEGSYKQSEGVRYNARDLALV 365

Query: 345 RGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGK 404
           RGK+    V+L SATP + S    ++ +   + L  R R   +P  +++D R Q   +G+
Sbjct: 366 RGKLAGAVVILGSATPLVTSYHAAMNGKLGYLQLPDRVRELPMPQTEMLDARRQ---KGE 422

Query: 405 SLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKL 464
              P +I+ +   L    QTLLFLNRRG+A   +C+ CG+ L+C +C   L  HR K K 
Sbjct: 423 VFLPPLIEAMGENLDNGGQTLLFLNRRGFATYLVCESCGHVLRCPNCEVTLTFHRLKGKH 482

Query: 465 YCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGR 524
            CH C  S +  ++C  CG  G++   G G ER+ E+V + FP AR+S +  D   G G 
Sbjct: 483 VCHYCDFSMLPPKNCPHCG-DGEITLLGRGTERVEEQVQQLFPHARVSRMDRDTTRGKGG 541

Query: 525 LQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQ 584
               L  + +GE+DI+IGTQ++AKGH+F  ++LVGV+  D  L   D RS+ERTFQL++Q
Sbjct: 542 HARVLKELEEGEVDILIGTQMIAKGHDFHGVTLVGVLSADASLNLPDFRSAERTFQLVTQ 601

Query: 585 VTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVI 644
           V GRAGR       L+Q   P H  +   VS D   FY+ EI  RE V  PPF  LA++ 
Sbjct: 602 VMGRAGRGDKPGRVLVQTLAPEHYALTRAVSHDFQGFYQEEIAFREEVGYPPFAHLASLT 661

Query: 645 ISGTKYQEVE---NYAYNLKEHAPRSS--DIVVFGPAESPLFMVRGRYRFRLLIHGKRNS 699
           +S     + E   + A  L +   R     + V GP  +PL  VRGR+R+++L+ G+  +
Sbjct: 662 LSAVAASQGEHSADEAAALLQKIKRECRLRVEVLGPVTAPLGKVRGRFRWQILLKGRERA 721

Query: 700 NLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           +L       +       + +R+  D+DP + L
Sbjct: 722 DLHRLLFH-FRGGFSHPSTVRLTIDVDPVDML 752


>gi|167037733|ref|YP_001665311.1| primosomal protein N' [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|167040395|ref|YP_001663380.1| primosomal protein N' [Thermoanaerobacter sp. X514]
 gi|300914479|ref|ZP_07131795.1| primosomal protein N' [Thermoanaerobacter sp. X561]
 gi|307724285|ref|YP_003904036.1| primosomal protein N' [Thermoanaerobacter sp. X513]
 gi|320116148|ref|YP_004186307.1| primosomal protein N' [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|166854635|gb|ABY93044.1| primosomal protein N' [Thermoanaerobacter sp. X514]
 gi|166856567|gb|ABY94975.1| primosomal protein N' [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|300889414|gb|EFK84560.1| primosomal protein N' [Thermoanaerobacter sp. X561]
 gi|307581346|gb|ADN54745.1| primosomal protein N' [Thermoanaerobacter sp. X513]
 gi|319929239|gb|ADV79924.1| primosomal protein N' [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 732

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 246/719 (34%), Positives = 383/719 (53%), Gaps = 27/719 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLG-IVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           Y Y +P  M V++G  V VP  +R + G ++    +  Y +D  K++ I  + D   +  
Sbjct: 18  YTYRIPEGMNVKIGMRVSVPFNNRFIEGYVISITDKASYSVD--KIKDIHRILDSYSIFD 75

Query: 86  RQMCEFVKWVADY--TFSPMGLVARMVVSALSETEKMEE-KIQFTGIFPRINTVA--RLR 140
            +M E  KW+ DY   +    L   M V      +K++  KI    I  +++  A  +  
Sbjct: 76  EKMIELAKWMKDYYKCYFSEALQTIMPVGIKQGEKKVKVVKINIDEIPSQLSKKAPKQYE 135

Query: 141 VLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPIL- 199
           +L  +K+       +L++   +   VI  L+ +G I +I+E         ++  + P+L 
Sbjct: 136 ILQYLKNRSPIRLSELVKVLNIDYGVIKSLQNKGYI-EIYEEEVLRFSVKDIEKTKPLLL 194

Query: 200 DKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISL 258
            + QQ  VE+V   + T  F   L+ GVTGSGKTEVYL+++   + +GK  ++L+PEISL
Sbjct: 195 TEEQQRAVEEVKRSILTGTFDKYLLFGVTGSGKTEVYLQLIDEAIKIGKSAIVLVPEISL 254

Query: 259 TSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLI 318
           T   +ERF  RFG + A  HS LS   R   WR+V  G + V+VGVR+A+F PF  LGLI
Sbjct: 255 TPQTIERFVSRFGNRVAVIHSGLSPGERFDEWRKVKNGLVDVVVGVRNAVFAPFNNLGLI 314

Query: 319 VIDEEHDISYKQEE-GILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVH 377
           +IDEEH+ +YKQ +    YNA++++  R +IE   +V+ SATPS+E+        Y  + 
Sbjct: 315 IIDEEHETTYKQSDLRPKYNAKEVAEKRCEIEKAVLVMASATPSLETYYKANKGEYKLIR 374

Query: 378 LSTRYRNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLARNEQTLLFLNRRGYAP 435
           L+ R  N ++P ++V++M  + +A G +   S ++   I+  L R EQT+LFLNRRGY+ 
Sbjct: 375 LTKRI-NVSMPQIEVVNM-SEELASGNTSIFSRKLFSYIKENLKRKEQTILFLNRRGYSS 432

Query: 436 LTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGI 495
              C+ CG   KC +C   L  H   KKL CH CG+      +C  CGS  ++   G G 
Sbjct: 433 FVSCRDCGYVPKCPNCDISLTYHFEDKKLVCHYCGYEETMKDTCPKCGSK-RIRYLGIGT 491

Query: 496 ERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRM 555
           ER+  ++ ++FP AR+  +  D     G  +        G+ DI+IGTQ+++KG + P +
Sbjct: 492 ERVENDIKKFFPNARVLRMDVDTTRKKGSHEKIFYDFRNGKADILIGTQMISKGFDIPNV 551

Query: 556 SLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVS 615
           +LVGV+  D+ L   D RSSERTFQLL+QV GRAGR       +IQ Y+  H  +     
Sbjct: 552 TLVGVILADITLNLPDFRSSERTFQLLTQVAGRAGRGEKPGRVVIQTYEDDHYSIVTAKQ 611

Query: 616 GDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYN-------LKEHAPRSS 668
            +   FY  EI+ RE    PPF  L  +++SG K +EV+N A +       L       S
Sbjct: 612 QNYVKFYNEEIKYREIFRYPPFSHLMNIVVSGEKEEEVKNTAVSTYLTCQKLINKLQNKS 671

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDP 727
              + GPA +P+  +  RYR+++++  +    L     ++    +K S  +R+  DIDP
Sbjct: 672 YNKILGPAPAPISKINNRYRWQVILKSEDRDILTEIAEEI--QKMKYSKDIRIAVDIDP 728


>gi|58585002|ref|YP_198575.1| primosomal protein N' [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
 gi|58419318|gb|AAW71333.1| Primosomal protein N', superfamily II helicase, PriA [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 786

 Score =  392 bits (1007), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 202/512 (39%), Positives = 300/512 (58%), Gaps = 40/512 (7%)

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           QVLILLPEI LTS ++ R + +     AEWHS L+   R   W   A G   +I+G RSA
Sbjct: 287 QVLILLPEIVLTSQLVNRIRSQTSRNLAEWHSGLTLKTRRNNWLNTANGNAQIIIGARSA 346

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LFLP+K L LI++DEEHD S+KQE+G +YNARDM+I+  KIE+ P++L SATP +E+  +
Sbjct: 347 LFLPYKNLKLIIVDEEHDSSFKQEQGTIYNARDMAIILAKIENIPIILSSATPLLETIYH 406

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             +  Y+ V L+ R+  + LP ++V+D R       + +S E+ +GI+ T+ + +Q +LF
Sbjct: 407 VKNGNYNYVKLAKRFGGAELPLIKVVDTRNNK----QWISNELFEGIKQTIEKKQQVMLF 462

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRGYA L +C+ CG ++ C +C+ WLV H+ K  L CH C +     + C  C S   
Sbjct: 463 LNRRGYAQLAVCKKCGYKIPCSNCAVWLVYHKKKNALLCHHCSYQLKLPEKCSNCQSKQS 522

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           +   G GIER+ EE  +  P A+ +I+SSD +     + L L    K E++IIIGTQ++A
Sbjct: 523 LFLYGIGIERLLEETVKLIPNAKTAIISSDQKSVSNVIDLVL----KEELNIIIGTQIIA 578

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGHNFP+++LVGV++ DL L NADLR++E+T+QLL QV GR+GRF  K + ++Q   P  
Sbjct: 579 KGHNFPKLTLVGVINADLSLENADLRAAEKTYQLLHQVAGRSGRFNEKGMVIVQTNHPES 638

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKY-------QEVENYAYN- 659
            V++AL     DSFYE E+ +R    +PPF RL A+II G           E+ ++ +N 
Sbjct: 639 SVIKALQHQKRDSFYEIELESRYKAKMPPFSRLIALIICGKNQIATQKAANEIASFLHNQ 698

Query: 660 ------------------LKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLL--IHGKRNS 699
                             LK    R  +  + GP+ + +  +  +YR+R+L  I+ K + 
Sbjct: 699 CLSKKLPSSSSLSFQCLTLKS---RKKEFEILGPSPAAISFLNNKYRYRVLLKIYNKHSL 755

Query: 700 NLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           ++Q        N     N + V  D+DP +F 
Sbjct: 756 SVQKKLKYWIKNCNLSPNII-VTIDVDPISFF 786



 Score = 48.5 bits (114), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 55/107 (51%), Gaps = 4/107 (3%)

Query: 16  VIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPI 75
           V +LL   +   + Y+V     V +G  V VP   + ++GIVW  S +    +  +L+ I
Sbjct: 5   VNVLLPLPIDQLFSYAVKENTDVSVGDYVVVPFGKKRLIGIVWKYSNK----NDQELKFI 60

Query: 76  EYVFDCPPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEE 122
           E   + P +  ++  F +WVA Y    +G++A++++  + +   +++
Sbjct: 61  EQKINLPNIRLKLIAFAEWVAQYNVISIGMLAKVIMGGVLKVNHLDK 107


>gi|113461266|ref|YP_719335.1| primosome assembly protein PriA [Haemophilus somnus 129PT]
 gi|112823309|gb|ABI25398.1| replication restart DNA helicase PriA [Haemophilus somnus 129PT]
          Length = 730

 Score =  392 bits (1007), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 242/723 (33%), Positives = 381/723 (52%), Gaps = 35/723 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPP-LSR 86
           + Y +P+A+   +G  V VP   + ++GIV     EK +ID  +L+PI  V D     + 
Sbjct: 16  FDYLIPNALSTAVGCRVLVPFGRQKLIGIV-TELPEKTEIDISQLKPIISVLDHHSVFTP 74

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLD--K 144
           ++   + W ADY   P+G V  ++ S  S+  + E  ++ +  F ++    + + LD  K
Sbjct: 75  ELWRLLHWGADYYQFPLGEV--LISSLPSKLRRGESAVEKSTFFFQLTEQGQ-QALDNNK 131

Query: 145 IKDGK------------IWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNL 192
           +K  K            I EK +    +QV S     LK++G I +  E+    +     
Sbjct: 132 LKRAKKQLEALHYLQNNITEKNNNPFHNQVWS----TLKSKGYISEQ-EIHKTSISWQQK 186

Query: 193 YFSLPILDKNQQDVVEQVVPLC------TKGFAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
                I+  N +  + Q   L         GF   L+ GVTGSGKTE+YL+ +  +L   
Sbjct: 187 LNHQSIVKTNDRLPLNQEQALALSQLTFQSGFICWLLEGVTGSGKTEIYLQFIEEILQQE 246

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           KQ+L+L+ EI LT   ++RFQ RF ++    HS+L+ + R K+W++   G  +VI+G RS
Sbjct: 247 KQILVLVSEIGLTPQTVQRFQARFNIEIDVLHSNLNDNQRLKVWQRSKNGESAVIIGTRS 306

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           ALF PFK+LGLI++DEEHD+S+KQ++   Y+ARD+++V  K    P+VL SATPS+ES  
Sbjct: 307 ALFTPFKQLGLIIVDEEHDLSFKQQDNWRYHARDLAVVYAKQLDIPIVLGSATPSLESIN 366

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N    +Y  + L  R RN+      VID++ Q +  G  LS  ++  +++ L +  Q LL
Sbjct: 367 NVRQGKYRHITLKKRARNTTALRHSVIDLKRQIVHNG--LSETLLTMMKNHLKKGNQVLL 424

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRG+AP+ LC  CG  ++C HC      H+ ++ L CH CG        CV CGS+ 
Sbjct: 425 FLNRRGFAPVLLCHECGWIVECQHCEKPYTYHQHQRVLRCHHCGTQKPIPMQCVNCGST- 483

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
            ++  G G E++ E + + FP  +I+ +  D     G+L+  L  I  G+  I+IGTQ++
Sbjct: 484 HLVTTGLGTEQLEESLNQRFPNYKITRIDRDSTARKGKLEQYLRDIQLGKSQILIGTQML 543

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGH+FP ++LV +++ D  L + D R+ ER  QL  QV GRAGR   +   ++Q + P 
Sbjct: 544 AKGHHFPNVTLVALLNVDSALFSTDFRAEERLAQLYVQVAGRAGREEKQGEVVLQTHYPE 603

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE--HA 664
           HP++ +L+S     F +  +  R  + LPPF   A         Q+ E   + +    H 
Sbjct: 604 HPLLVSLLSQGYPYFAQQALTLRNQMGLPPFSAQALFKARSRHSQKAEEVLHQIAAYFHN 663

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFD 724
             S ++ + GP ++P     G+YR+ LL+  K  + LQ            R   +R+  D
Sbjct: 664 TSSKNLQILGPIQAPFSKKAGQYRWHLLLQHKSKAELQQILHSFQQENFLRLQQVRLVLD 723

Query: 725 IDP 727
           IDP
Sbjct: 724 IDP 726


>gi|320353715|ref|YP_004195054.1| primosomal protein N' [Desulfobulbus propionicus DSM 2032]
 gi|320122217|gb|ADW17763.1| primosomal protein N' [Desulfobulbus propionicus DSM 2032]
          Length = 767

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 250/756 (33%), Positives = 389/756 (51%), Gaps = 49/756 (6%)

Query: 24  VSGPYIYSVPSA--MKVELGSIVRVPLRSRTVLGIVWYN---SEEKYKIDSLKLRPIEYV 78
           ++ P  YS P+     +  G  VRVPL  R V+G V      ++      +  ++ I  V
Sbjct: 13  LATPLTYSQPAGRTTPIPAGCCVRVPLGRRKVIGYVLGPASLTDPAGAEPAFAVKAIAEV 72

Query: 79  FDCPPLSRQ-MCEFVKWVADYTFSPMGLVARMV------------VSALSE--------- 116
            D  PL  Q +  F +W+A Y   P+G V R              VSA +          
Sbjct: 73  IDETPLFPQTLIPFYRWIARYYHHPLGNVLRTALPLAPTSRSGRRVSAKTRKTLTPGPVL 132

Query: 117 ---------TEKMEEKIQFT--GIFPRINTVARLRVLDKIKDG--KIWEKRDLIRASQVS 163
                    TE++   ++++  G        A    LD ++ G  +   +  L+R    +
Sbjct: 133 LSPLQSGGTTEEVLAAVEYSLDGRLKNAEHKALSLFLDDLRSGGNRPVPRSLLLRRYPGA 192

Query: 164 SHVIDGLKAQGVIKQIFEVI--SPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKG-FAV 220
              +  L   GV+  + E +   P   +P  +     L   QQ V+E ++P   +  FA 
Sbjct: 193 GPRLTRLVDLGVLCSVNERVYRDPFGQTPVFHPRPAQLTDEQQQVLEALLPAMDRAAFAP 252

Query: 221 SLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSS 280
            ++ GVTG GKTEVYL +V   L  GK  L+L+PEI+L S +   F  RFG + A  HS 
Sbjct: 253 FVLFGVTGCGKTEVYLRLVEHALTRGKTALVLVPEIALASQLEAHFYSRFGARLAVLHSG 312

Query: 281 LSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARD 340
           LS   R   W  V  G   V++G RSA+F P + +G++++DEEH+ +YKQE+G+ YN RD
Sbjct: 313 LSDGERFDQWHNVLTGEARVVLGARSAVFAPLEHVGVVIVDEEHEPAYKQEDGLRYNGRD 372

Query: 341 MSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTI 400
           ++++R K+   P VL SATPS+ S  + +  +Y  + +  R     LP ++++D+     
Sbjct: 373 LAVLRAKMAECPAVLGSATPSVVSYHHCLHGKYTLLTMRKRVAEQPLPTVELVDLAATER 432

Query: 401 AQGK-SLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHR 459
           ++   + S  +I+ +  TL + +QTLLF+NRRG++   LC+ CG  L+C HC   +  HR
Sbjct: 433 SRPDLAFSDRLINAMAQTLEQGQQTLLFVNRRGFSSSMLCRDCGAILQCRHCQVSMTLHR 492

Query: 460 SKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLE 519
           S+  L CH CG +   S  C  CGS  ++   G G ERI EEV + FP ARI+ L SD  
Sbjct: 493 SRNLLMCHYCGSTQHPSTLCPACGSP-RLSGVGIGSERIEEEVRQLFPEARIARLDSDTT 551

Query: 520 GGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTF 579
                    L A+   ++D++IGTQ++AKG +FP M+LVGVV  D GL   D +++ERT+
Sbjct: 552 ANRRHYLATLQAVRTRQVDMLIGTQMIAKGLHFPHMTLVGVVWADAGLAMPDYKAAERTY 611

Query: 580 QLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGR 639
            LL+QVTGRAGR       +IQ YQP+H  ++     D ++F+  EI  R  +  PPF R
Sbjct: 612 SLLAQVTGRAGRGADPGRVIIQTYQPSHYSVRLAQHHDYEAFFAQEIAVRRPLGYPPFSR 671

Query: 640 LAAVIISGTKYQEVENYAYNLKEHAPR---SSDIVVFGPAESPLFMVRGRYRFRLLIHGK 696
           L  +  SG K Q+V   A  + E   R   ++ + V GP+ +PL  ++ R R++LL+   
Sbjct: 672 LVNIRFSGLKEQQVAQAAGRVAEFLRRQYGNNQVDVLGPSPAPLVKLKDRTRWQLLLKSG 731

Query: 697 RNSNLQGFFSQMYDNTIKR-SNALRVQFDIDPQNFL 731
            ++ LQ     +     +    ++ +  D+DP+N +
Sbjct: 732 SSALLQAMCEALLAEKAELCPRSVSMSLDVDPENMM 767


>gi|170717269|ref|YP_001784384.1| primosome assembly protein PriA [Haemophilus somnus 2336]
 gi|168825398|gb|ACA30769.1| primosomal protein N' [Haemophilus somnus 2336]
          Length = 730

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 241/722 (33%), Positives = 383/722 (53%), Gaps = 33/722 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPP-LSR 86
           + Y +P+A+   +G  V VP   + ++GIV     EK +ID  +L+PI  V D     + 
Sbjct: 16  FDYLIPNALSTAVGCRVLVPFGRQKLIGIV-TELPEKTEIDISQLKPIISVLDHHSVFTP 74

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLD--K 144
           ++   + W ADY   P+G V  ++ S  S+  + E  ++ +  F ++    + + LD  K
Sbjct: 75  ELWRLLHWGADYYQFPLGEV--LISSLPSKLRRGESAVEKSTFFFQLTEQGQ-QALDNNK 131

Query: 145 IKDGK------------IWEKRDLIRASQVSSHVIDGLKAQGVI--KQIFEVISPVVDSP 190
           +K  K            I EK +    +QV S     LK++G I  ++I +         
Sbjct: 132 LKRAKKQLEALHYLQKNITEKNNNPFHNQVWS----TLKSKGYISEQEIHKTSISWQQKL 187

Query: 191 NLYFSLPILDK---NQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
           N    +   D+   NQ+  +     +   GF   L+ GVTGSGKTE+YL+ +  +L   K
Sbjct: 188 NHQSIVKTNDRLPLNQEQALALSQLIFQSGFICWLLEGVTGSGKTEIYLQFIEEILQQEK 247

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           Q+L+L+ EI LT   ++RFQ RF ++    HS+L+ + R K+W++   G  +VI+G RSA
Sbjct: 248 QILVLVSEIGLTPQTVQRFQARFNIEIDVLHSNLNDNQRLKVWQRSKNGESAVIIGTRSA 307

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LF PFK+LGLI++DEEHD+S+KQ++   Y+ARD+++V  K    P+VL SATPS+ES  N
Sbjct: 308 LFTPFKQLGLIIVDEEHDLSFKQQDNWRYHARDLAVVYAKQLDIPIVLGSATPSLESINN 367

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
               +Y  + L  R +N+      VID++ Q +  G  LS  ++  +++ L +  Q LLF
Sbjct: 368 VRQGKYRHITLKKRAKNTTALRHSVIDLKRQIVHNG--LSETLLTMMKNHLKKGNQVLLF 425

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRG+AP+ LC  CG  ++C HC      H+ ++ L CH CG        CV CGS+  
Sbjct: 426 LNRRGFAPVLLCHECGWIVECQHCEKPYTYHQHQRVLRCHHCGTQKPIPMQCVNCGST-H 484

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           ++  G G E++ E + + FP  +I+ +  D     G+L+  L  I  G+  I+IGTQ++A
Sbjct: 485 LVTTGLGTEQLEESLNQRFPNYKITRIDRDSTARKGKLEQYLRDIQLGKSQILIGTQMLA 544

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGH+FP ++LV +++ D  L + D R+ ER  QL  QV GRAGR   +   ++Q + P H
Sbjct: 545 KGHHFPNVTLVALLNVDSALFSTDFRAEERLAQLYVQVAGRAGREEKQGEVVLQTHYPEH 604

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE--HAP 665
           P++ +L+S     F +  +  R  + LPPF   A         Q+ E   + +    H  
Sbjct: 605 PLLVSLLSQGYPYFAQQALTLRNQMGLPPFSAQALFKAQSRHSQKAEEVLHQIAAYFHNT 664

Query: 666 RSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDI 725
            S ++ + GP ++P     G+YR+ LL+  K  + LQ            R   +R+  DI
Sbjct: 665 SSKNLQILGPIQAPFSKKAGQYRWHLLLQHKSKAELQQILHSFQQENFLRLQQVRLVLDI 724

Query: 726 DP 727
           DP
Sbjct: 725 DP 726


>gi|256752268|ref|ZP_05493131.1| primosomal protein N' [Thermoanaerobacter ethanolicus CCSD1]
 gi|256748836|gb|EEU61877.1| primosomal protein N' [Thermoanaerobacter ethanolicus CCSD1]
          Length = 732

 Score =  391 bits (1004), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 245/719 (34%), Positives = 383/719 (53%), Gaps = 27/719 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLG-IVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           Y Y +P  M V++G  V VP  +R + G ++    +  Y +D  K++ I  + D   +  
Sbjct: 18  YTYRIPEGMNVKIGMRVSVPFNNRFIEGYVISITDKASYSVD--KIKDIHRILDSYSIFD 75

Query: 86  RQMCEFVKWVADY--TFSPMGLVARMVVSALSETEKMEE-KIQFTGIFPRINTVA--RLR 140
            +M +  KW+ DY   +    L   M V      +K++  KI    I  +++  A  +  
Sbjct: 76  EKMIKLAKWMKDYYKCYFSEALQTIMPVGIKQGEKKVKVVKINIDEIPSQLSKKAPKQYE 135

Query: 141 VLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPIL- 199
           +L  +K+       +L++   +   VI  L+ +G I +I+E         ++  + P+L 
Sbjct: 136 ILQYLKNRSPIRLSELVKVLNIDYGVIKSLQNKGYI-EIYEEEVLRFSVKDIEKTKPLLL 194

Query: 200 DKNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISL 258
            + QQ  VE+V   + T  F   L+ GVTGSGKTEVYL+++   + +GK  ++L+PEISL
Sbjct: 195 TEEQQRAVEEVKRSILTGTFDKYLLFGVTGSGKTEVYLQLIDEAIKIGKSAIVLVPEISL 254

Query: 259 TSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLI 318
           T   +ERF  RFG + A  HS LS   R   WR+V  G + V+VGVR+A+F PF  LGLI
Sbjct: 255 TPQTIERFVSRFGNRVAVIHSGLSPGERFDEWRKVKNGLVDVVVGVRNAVFAPFNNLGLI 314

Query: 319 VIDEEHDISYKQEE-GILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVH 377
           +IDEEH+ +YKQ +    YNA++++  R +IE   +V+ SATPS+E+        Y  + 
Sbjct: 315 IIDEEHETTYKQSDLRPKYNAKEVAEKRCEIEKAVLVMASATPSLETYYKANKGEYKLIR 374

Query: 378 LSTRYRNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLARNEQTLLFLNRRGYAP 435
           L+ R  N ++P ++V++M  + +A G +   S ++   I+  L R EQT+LFLNRRGY+ 
Sbjct: 375 LTKRI-NVSMPQIEVVNM-SEELASGNTSIFSRKLFSYIKENLKRKEQTILFLNRRGYSS 432

Query: 436 LTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGI 495
              C+ CG   KC +C   L  H   KKL CH CG+      +C  CGS  ++   G G 
Sbjct: 433 FVSCRDCGYVPKCPNCDISLTYHFEDKKLVCHYCGYEETMKDTCPKCGSK-RIRYLGIGT 491

Query: 496 ERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRM 555
           ER+  ++ ++FP AR+  +  D     G  +        G+ DI+IGTQ+++KG + P +
Sbjct: 492 ERVENDIKKFFPNARVLRMDVDTTRKKGSHEKIFYDFRNGKADILIGTQMISKGFDIPNV 551

Query: 556 SLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVS 615
           +LVGV+  D+ L   D RSSERTFQLL+QV GRAGR       +IQ Y+  H  +     
Sbjct: 552 TLVGVILADITLNLPDFRSSERTFQLLTQVAGRAGRGEKPGRVVIQTYEDDHYSIVTAKQ 611

Query: 616 GDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYN-------LKEHAPRSS 668
            +   FY  EI+ RE    PPF  L  +++SG K +EV+N A +       L       S
Sbjct: 612 QNYVKFYNEEIKYREIFRYPPFSHLMNIVVSGEKEEEVKNTAVSTYLTCQKLINKLQNKS 671

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDP 727
              + GPA +P+  +  RYR+++++  +    L     ++    +K S  +R+  DIDP
Sbjct: 672 YNKILGPAPAPISKINNRYRWQVILKSEDRDILTEIAEEI--QKMKYSKDIRIAVDIDP 728


>gi|307264798|ref|ZP_07546360.1| primosomal protein N' [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306920056|gb|EFN50268.1| primosomal protein N' [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 732

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 243/728 (33%), Positives = 385/728 (52%), Gaps = 37/728 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE-KYKIDSLKLRPIEYVFDCPPL-S 85
           Y Y +P  M +++G  V VP  +R + G V   +++  Y +D  K++ I  + D   +  
Sbjct: 18  YTYRIPEGMDIKVGMRVSVPFNNRFIEGYVISTTDKASYSVD--KIKDIHRILDSYSIFD 75

Query: 86  RQMCEFVKWVADY----------TFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINT 135
            +M E  KW+ +Y          T  P+G+        + +    E   Q +   P+   
Sbjct: 76  EKMIELAKWMKEYYKCYFSEALQTIMPVGIKQGEKKVKVVKINIDEIPFQLSKRAPK--- 132

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
             +  +L  +K+       +L++   +   VI  L+ +G I +I+E      +  ++  +
Sbjct: 133 --QYEILQYLKNRSPIRLSELVKVLNIDYGVIRSLQNKGYI-EIYEEEVLRFNIKDIERT 189

Query: 196 LPI-LDKNQQDVVEQVVP-LCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
            P+ L + Q+  VE+V   + T  F   L+ GVTGSGKTEVYL+++   + +GK  ++L+
Sbjct: 190 KPLSLTEEQKRAVEEVKKSILTGTFDKYLLFGVTGSGKTEVYLQLIDEAIKIGKSAIVLV 249

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEISLT   +ERF  RFG + A  HS LS   R   WR+V  G + V+VGVR+A+F PF 
Sbjct: 250 PEISLTPQTIERFVGRFGNRVAVIHSGLSPGERFDEWRKVKNGLVDVVVGVRNAVFAPFN 309

Query: 314 KLGLIVIDEEHDISYKQEE-GILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
            LGLI+IDEEH+ +YKQ +    YNA++++  R +IE   +V+ SATPS+E+        
Sbjct: 310 NLGLIIIDEEHETTYKQSDLRPKYNAKEVAEKRCEIEKAVLVMASATPSLETYYKANKGE 369

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLARNEQTLLFLNR 430
           Y  + L+ R  N ++P ++V++M  + +A G +   S ++   I+  L R EQT+LFLNR
Sbjct: 370 YKLIRLTKRI-NVSMPQIEVVNM-SEELASGNTSIFSRKLFSYIKENLKRKEQTILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RGY+    C+ CG   KC +C   L  H   KKL CH CG+     ++C  CGS  ++  
Sbjct: 428 RGYSSFVSCRDCGYVPKCPNCDISLTYHFEDKKLVCHYCGYEETMKETCPKCGSK-RIRY 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G ER+  ++ ++FP AR+  +  D     G  +        G+ DI+IGTQ+++KG 
Sbjct: 487 LGIGTERVENDIKKFFPNARVLRMDVDTTRKKGSHEKIFYDFRNGKADILIGTQMISKGF 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           + P ++LVGV+  D+ L   D RSSERTFQLL+QV GRAGR       +IQ Y+  H  +
Sbjct: 547 DIPNVTLVGVILADITLNLPDFRSSERTFQLLTQVAGRAGRGEKPGRVVIQTYEDDHYSI 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYN-------LKEH 663
                 +   FY  EI+ RE    PPF  L  ++ISG + +EV+N A N       L   
Sbjct: 607 VTAKQQNYVKFYNEEIKYREIFRYPPFSHLMNIVISGEEEEEVKNTAANTYLTCQKLINK 666

Query: 664 APRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQF 723
               S   + GPA +P+  +  RYR+++++  +  + L     ++    +K    +R+  
Sbjct: 667 LQNKSYNKILGPAPAPISKINNRYRWQVILKSEDRNILTEIAEEI--QKMKYPKDIRIAV 724

Query: 724 DIDPQNFL 731
           DIDP N +
Sbjct: 725 DIDPLNIM 732


>gi|288553115|ref|YP_003425050.1| primosome assembly protein PriA [Bacillus pseudofirmus OF4]
 gi|288544275|gb|ADC48158.1| primosome assembly protein PriA [Bacillus pseudofirmus OF4]
          Length = 803

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 202/515 (39%), Positives = 302/515 (58%), Gaps = 6/515 (1%)

Query: 222 LISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSL 281
           L+ GVTGSGKTE+YL+ +   L  GK+ ++L+PEI+LT  ++ RF+ RFG K A  HS L
Sbjct: 290 LLHGVTGSGKTEIYLQAIDRTLKDGKEAIVLVPEIALTPQMVNRFKGRFGSKVAVLHSGL 349

Query: 282 STSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDM 341
           S   +   WR++ R  + V+VG RSA+F PFK LG+I+IDEEH+ SYKQEE   Y+ARD+
Sbjct: 350 SMGEKYDEWRKIHRDEVKVVVGARSAIFAPFKNLGIIIIDEEHESSYKQEENPRYHARDV 409

Query: 342 SIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIA 401
           ++ RG+    PV+L SATPS+ES       RY  + L+ R  N A+P + V+DMR +  A
Sbjct: 410 AMFRGRYHQCPVILGSATPSLESYARAKKGRYTLLPLTERVNNRAMPEVNVVDMREELRA 469

Query: 402 QGKSL-SPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRS 460
             +S+ S  +++ ++  + RNEQT+LFLNRRGY+   +C+ CG    C HC   L  HRS
Sbjct: 470 GNRSMFSAALLEKMQERMDRNEQTVLFLNRRGYSTFVMCRDCGYVATCDHCDISLTYHRS 529

Query: 461 KKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEG 520
           + +L CH CGH       C  CGS   +   G G +++ EE+    P AR+  +  D   
Sbjct: 530 QNQLKCHYCGHEEAMPTVCESCGSE-HIRFFGTGTQKVEEEIARVLPSARVIRMDVDTTR 588

Query: 521 GGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQ 580
             G  +  L++  KGE DI++GTQ++AKG +FP ++LVGV+  D  L   D R+SERTFQ
Sbjct: 589 KKGSHERLLTSFGKGEADILLGTQMIAKGLDFPNITLVGVLAADSMLHIPDFRASERTFQ 648

Query: 581 LLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRL 640
           L+ QV+GRAGR  L    +IQ Y P H  ++ + S + ++++E E+  R+    PP+  L
Sbjct: 649 LMEQVSGRAGRHELSGEVVIQTYTPEHYSIELVKSHNYEAYFEMEMAQRKHAGYPPYFYL 708

Query: 641 AAVIISGTKYQEVENYAYNLKEHAPR--SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRN 698
             + +S  +  +V      +     R  S + VV GP  SP+  ++ RYR++ +I  K  
Sbjct: 709 TLINVSHPEITKVIGVTEKITSFLKREFSDETVVLGPTASPIARIKDRYRYQCMIKYKNE 768

Query: 699 SNLQGFFSQMYDNTIKRSN--ALRVQFDIDPQNFL 731
             L     ++  + +K  N   L +  D+ P  F+
Sbjct: 769 PKLVNTLREIQQHYLKEMNQGQLNISIDLHPYLFM 803


>gi|224367649|ref|YP_002601812.1| PriA [Desulfobacterium autotrophicum HRM2]
 gi|223690365|gb|ACN13648.1| PriA [Desulfobacterium autotrophicum HRM2]
          Length = 815

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 214/542 (39%), Positives = 307/542 (56%), Gaps = 12/542 (2%)

Query: 197 PILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEI 256
           P L   Q  VV QV+    KGF+  L+SGVTGSGKTEVYL +V   +  G+  L+L+PEI
Sbjct: 271 PELMDEQAGVVNQVISEMDKGFSRYLLSGVTGSGKTEVYLRLVTEAMDRGQGALVLVPEI 330

Query: 257 SLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLG 316
           SL S    RF+ RFG K A  HS L+   R   W ++  G   +++GVRS++F P   LG
Sbjct: 331 SLISQTERRFRARFGKKIAVLHSGLTMGERLDQWNRIMTGDAVIVIGVRSSVFAPINNLG 390

Query: 317 LIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSV 376
           +I++DEEHD SYKQE G+ YNARD+++VR KIE+ PVVL SATPS++S  N    R+  +
Sbjct: 391 IIIVDEEHDTSYKQETGLRYNARDIAVVRAKIENIPVVLGSATPSVQSYYNVCEGRFKEL 450

Query: 377 HLSTRYRNSALPHLQVIDMRGQTIAQG--KSLSPEMIDGIRHTLARNEQTLLFLNRRGYA 434
            L+ R     LP ++++D++     +G  + ++PE+  GI H L R EQ L+FLNRRG+A
Sbjct: 451 KLTKRVNCHPLPEIELVDLKRYKDFRGIERIITPELSRGIGHCLERGEQALIFLNRRGFA 510

Query: 435 PLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFG 494
              +CQ C   +KC  C   +  H    +  CH CG S   +Q C  C +  ++   GFG
Sbjct: 511 TYPVCQACNEPVKCKFCDLTMTLHMDTNEFRCHLCGFSMSMNQPCPNCNAR-RIKPLGFG 569

Query: 495 IERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPR 554
            ERI   +   FP AR++ L  D     G +   L  +    +DIIIGTQ++AKGH+FP 
Sbjct: 570 TERIENMLQVLFPDARVARLDQDTGSKKGAMVSILKKVKHRTVDIIIGTQMLAKGHDFPF 629

Query: 555 MSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALV 614
           ++LVGV+  DL L   D R+ ERTFQLL+QV GRAGR   K   ++Q Y P H  ++A  
Sbjct: 630 ITLVGVICADLSLNFPDFRAGERTFQLLAQVAGRAGRGDRKGRVVMQTYNPEHFSIEASK 689

Query: 615 SGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSD----- 669
           + D   FY  EI  R+ +  PP  R+  + ISG    +V+ +A  + E   R  D     
Sbjct: 690 NQDFVEFYHKEIPFRKGLGYPPVSRIIQLKISGLDKDKVKVHALFVGEECKRLVDQDREN 749

Query: 670 ---IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMY-DNTIKRSNALRVQFDI 725
              + + GP E+ +  +  RYR+++L+   R + L      M  +  +  +  + V  D+
Sbjct: 750 GHLVQILGPIEAGIPKIAMRYRWQILLKSPRATLLNRLVRAMLAEKKVFANREVTVGIDV 809

Query: 726 DP 727
           DP
Sbjct: 810 DP 811



 Score = 43.9 bits (102), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 24  VSGPYIYSVPSAMKVEL--GSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDC 81
           V G + Y++P  +  E   G  V VP  +R V G V     E  +    K +PI+ + D 
Sbjct: 15  VHGTFTYTLPLDLAAEAIPGMRVLVPFGNRRVTGYVLGPGHENTE---FKAKPIQGLLDE 71

Query: 82  PPL-SRQMCEFVKWVADYTFSPMGLVAR 108
            PL    M E  +WV+DY   P+G V +
Sbjct: 72  APLFPPAMIELFRWVSDYYIHPLGEVIK 99


>gi|78486326|ref|YP_392251.1| primosomal protein N' (replication factor Y) [Thiomicrospira
           crunogena XCL-2]
 gi|78364612|gb|ABB42577.1| replication restart DNA helicase PriA [Thiomicrospira crunogena
           XCL-2]
          Length = 774

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 243/734 (33%), Positives = 389/734 (52%), Gaps = 54/734 (7%)

Query: 40  LGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFD-CPPLSRQMCEFVKWVADY 98
           +G  V+VP R+++++GIV   S++   + + KL+ +E V D  P  S Q    + W + Y
Sbjct: 51  VGGRVKVPFRNKSLIGIVMALSDDA-TVATQKLKALEDVIDEMPIFSEQEMALLSWASHY 109

Query: 99  TFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKI-----KDGKIWE- 152
              P+G V   V +AL +  +  E +   G+     T A     ++I     +   +W+ 
Sbjct: 110 YHEPIGNV---VQTALPKRLREGEAVDVAGVSAWQLTEAGREADEQIPSRATQQKALWQL 166

Query: 153 --KRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLP----------ILD 200
             ++D    ++V +  ++  +    +K+  E         +   ++P          IL+
Sbjct: 167 LQQQDEALTAEVLNRSLNQWRLP--MKRFQEKGWVAETEKSCLHAMPVREKTARPGHILN 224

Query: 201 KNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTS 260
             QQ  V+ V  L T GF   L+ GVTGSGKTEVYL ++ +V+  GKQVL+L+PEI LT 
Sbjct: 225 AEQQAAVDAV--LATSGFDAFLVEGVTGSGKTEVYLGMIESVIAQGKQVLVLVPEIGLTP 282

Query: 261 AILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVI 320
             ++RF+       A  HS L+   R   W  V    ++V++G RSA+F PF  LGL ++
Sbjct: 283 QTVKRFEAYLQAPVAVMHSGLNDKERHCAWSLVKTHQVNVLLGTRSAIFTPFADLGLCIM 342

Query: 321 DEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLST 380
           DEEHD+S+KQ++G  Y+ARD  + R ++E+ PVVL SATPS+E+  N +S RY  +HL  
Sbjct: 343 DEEHDLSFKQQDGFRYSARDCLVRRAQLENVPVVLGSATPSLETLHNALSGRYQHLHLKQ 402

Query: 381 RYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQ 440
           R   + +P +Q++D+RGQ  A+ + +S  +   +   L    Q LLFLNRRG+AP+ +C 
Sbjct: 403 RAGQAKMPEVQLLDVRGQ--AEEEGISQPLRQEVETHLKAGGQVLLFLNRRGFAPVLMCH 460

Query: 441 VCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAE 500
            CG +  C  C   +  H+   +L CH CG+ A     C  CGS+      G G ER+  
Sbjct: 461 DCGWQAACPSCDANMTFHQQVNELRCHHCGYQAKAPLDCPNCGSAS-FAKIGQGTERLET 519

Query: 501 EVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGV 560
            V ++FP  ++  +  D     G++       ++G  DI+IGTQ++AKGH+FP+++LVG+
Sbjct: 520 VVQQWFPDYKVLRVDRDTTRNKGQMMALTEQASQGRADILIGTQMLAKGHHFPKVTLVGL 579

Query: 561 VDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADS 620
           +D D GL + D R++ER  QL+ QV+GRAGR       +IQ + P HP+++ LV+   ++
Sbjct: 580 LDIDQGLFSCDFRAAERMAQLVVQVSGRAGRGERPGQVVIQTHHPEHPLLKVLVARGYEA 639

Query: 621 FYESEIRARESVNLPPFG-----RLAAVII-SGTKYQEVENYAYNLKEHA--------PR 666
           F +  ++ RE  +LPP+      R  AV   +G  +      A N  + +          
Sbjct: 640 FAKEALKEREQADLPPYQYQVLLRAEAVDANAGWTFLNDVKSALNFAKMSMLRSYLSVND 699

Query: 667 SSDIV--------VFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDN--TIKRS 716
           S DI         VFGP  +P+   +GRYR++LL+ G     L  + +Q+     T  ++
Sbjct: 700 SDDIKAEMLQGLEVFGPVSAPMLRRQGRYRYQLLLQGAHRGFLHQWLAQVETQLYTSNQA 759

Query: 717 NALRVQFDIDPQNF 730
             +R   D+DPQ  
Sbjct: 760 KKVRWSLDVDPQEM 773


>gi|157147267|ref|YP_001454586.1| primosome assembly protein PriA [Citrobacter koseri ATCC BAA-895]
 gi|157084472|gb|ABV14150.1| hypothetical protein CKO_03059 [Citrobacter koseri ATCC BAA-895]
          Length = 732

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 240/725 (33%), Positives = 384/725 (52%), Gaps = 36/725 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  VRVP  + +  +GIV  +  E+ ++   +L+ +  V D  P+ S
Sbjct: 16  FDYLLPEGMTVKAGCRVRVPFGKQQERVGIV-VSVSEQSELPLNELKAVVEVLDSEPVFS 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W ADY   PMG V    +  L    K          F         +N++ R
Sbjct: 75  PSVWRLLLWAADYYHHPMGDVLFHALPILLRQGKPASNAPMWYWFATEDGHAIDLNSLKR 134

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  RD +   + +   +  L+ +G+ +   E  +P       ++
Sbjct: 135 SPKQQQALAALRQGKIW--RDQVADLEFNDAALQALRKKGLCELASE--TPGFSDWRTHY 190

Query: 195 SL---PILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   +  F+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AVCGDRLRLNTEQATAVGAIHSASDSFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +Y  + L+ R  N A P LQ V+D++GQ I  G  L+P +I  +   L  + Q +LFLNR
Sbjct: 371 KYRMLRLTRRAGN-ARPALQHVLDLKGQKIQAG--LAPALIARMHQHLQADNQVILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+ 
Sbjct: 428 RGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPIPRQCPSCGST-HMVP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   +S +  D     G L+  L+ + +G   I+IGTQ++AKGH
Sbjct: 487 VGLGTEQLEQALAPFFPGVPVSRIDRDTTSRKGALEQHLAEVHRGGARILIGTQMLAKGH 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 547 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLL 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + VI+    +   +   +     NL + +P
Sbjct: 607 QTLLHKGYDAFAEQALAERQTLQLPPW--TSHVIVRAEDHNNQQAPVFLQQLRNLIQASP 664

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            + D + V GP  +      GRYR+++L+       LQ   S      NT+  S  ++  
Sbjct: 665 LADDKLWVLGPVPALAPKRGGRYRWQILLQHPSRIRLQHIVSGTLALINTLPDSRKVKWV 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|147678127|ref|YP_001212342.1| primosomal protein N' [Pelotomaculum thermopropionicum SI]
 gi|146274224|dbj|BAF59973.1| primosomal protein N' (replication factor Y) - superfamily II
           helicase [Pelotomaculum thermopropionicum SI]
          Length = 746

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 257/737 (34%), Positives = 394/737 (53%), Gaps = 46/737 (6%)

Query: 28  YIYSVPSAM--KVELGSIVRVPLRSRTVLG-IVWYNSEEKYKIDSLKLRPIEYVFD-CPP 83
           + Y++P     K+ +GS+V VP  +R + G +V +          ++++ I  V D  P 
Sbjct: 23  FHYAIPPDYRDKIAVGSMVTVPFGNRHLTGYVVGFG----IPPGEVRIKEIAGVIDEGPV 78

Query: 84  LSRQMCEFVKWVAD-YTFSPMGLVAR----------------MVVSALSETEKMEEKIQF 126
            + ++ E  +W+A+ Y  S     AR                +V  AL+  E ME+ +  
Sbjct: 79  FTPELLELARWMAENYLCSTAEAFARILSPRLQVKASRRADVLVYPALAGAE-MEKALSL 137

Query: 127 TGIFPRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPV 186
            G  P+     +L VL K        K +L  A+  SS  +D L  +G++K    + + +
Sbjct: 138 LGRSPK-----QLAVLQKAAGCPGLTKSELAAAAMTSSKTVDALLKKGLLKVSAVMPAYL 192

Query: 187 VDSPNLYFSLP--ILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVL 243
            D+P          L+++Q+  + ++     +G F V L+ G+TGSGKTEVYL  +AA L
Sbjct: 193 QDAPGDMIKTGSLTLNQDQEAALREISASLDRGRFDVFLLHGITGSGKTEVYLRAIAAAL 252

Query: 244 HLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVG 303
             G+Q + L+PEISLT  ++E F+ RFG + A  HS+LS   R + WR+V  G  SV++G
Sbjct: 253 ETGRQAVALVPEISLTPQMVELFRGRFGGQVAVLHSALSGGERYQEWRRVKEGQASVVLG 312

Query: 304 VRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIE 363
            RSA+F P  + GL +IDEEH+ SYKQ++ + Y+AR++++ R ++    VVL SATPS+E
Sbjct: 313 TRSAVFAPCPRPGLFIIDEEHEPSYKQDDHMRYHAREIALKRAQLAGAVVVLGSATPSLE 372

Query: 364 SRVNGIS-RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLAR 420
           S    +S   Y  + L  R     LP ++VID+R Q I +G     S  ++  +   L R
Sbjct: 373 SFSRAVSGGPYKLLKLPRRVDERPLPRVRVIDLR-QEIREGNRGIFSRPLLYALNGCLER 431

Query: 421 NEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCV 480
             Q +LFLNRRGY+ + +C+ CG  LKC  C   L  H  + +L CH C H A+    C 
Sbjct: 432 GGQAILFLNRRGYSTVVVCRECGLVLKCPRCDISLTYH-LEGRLRCHYCNHLAVLPGLCP 490

Query: 481 VCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDII 540
            CGS   +   G G +++ EE  + FP ARI  + SD     G  Q  L A   G  DI+
Sbjct: 491 GCGSR-YIRHFGAGTQKVEEEARKIFPKARIVRMDSDSTAQKGSHQKILDAFRDGLYDIL 549

Query: 541 IGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLI 600
           IGTQ++AKG + P ++LVGV++ D  L   D R++ERTFQLL+QV GRAGR GL    LI
Sbjct: 550 IGTQMIAKGLDLPGVTLVGVINADTALHMPDFRAAERTFQLLTQVAGRAGRGGLPGEVLI 609

Query: 601 QAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNL 660
           Q Y P H  + A  + D + FY SE+  R  +  PPF  LA ++ +    +EV   A   
Sbjct: 610 QTYSPEHYSISAAAAHDYEGFYRSEMAVRRVLGYPPFSHLARLLFTHEDEEEVRKGAEKS 669

Query: 661 KEH-----APRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ-MYDNTIK 714
           KE      + R+  + + GPA +PL  ++G +R++L++ G+R  N++    + + +    
Sbjct: 670 KELLDRLVSGRNCRVEILGPAPAPLSKIKGHFRWQLVLKGRRRENIKEIIREGLAELERD 729

Query: 715 RSNALRVQFDIDPQNFL 731
           R   + V  DI+PQ   
Sbjct: 730 RRFKVAVNVDINPQGMF 746


>gi|217971705|ref|YP_002356456.1| primosomal protein N' [Shewanella baltica OS223]
 gi|217496840|gb|ACK45033.1| primosomal protein N' [Shewanella baltica OS223]
          Length = 731

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 237/729 (32%), Positives = 384/729 (52%), Gaps = 39/729 (5%)

Query: 28  YIYSVPSAMKV--ELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP------IEYVF 79
           + Y VP       ++G  V+VP   + ++G+V   +      D+  L P      +E++ 
Sbjct: 17  FSYRVPETYPSTPQIGVRVKVPFGRQQLIGLVTGIT------DTCSLAPKQIKSVLEFID 70

Query: 80  DCPPLSRQMCEFVKWVADYTFSPMG--LVARMVVSALSETEKMEEKIQF-------TGIF 130
           D P L   + +   W A Y F   G  L   + V+     +   +KIQF         I 
Sbjct: 71  DKPLLPESLYKLTLWAARYYFCSQGQMLTQALPVALRKGLDAAPQKIQFWQLTEIGQNIA 130

Query: 131 PRI--NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVD 188
           P       A+ ++L+ +K   + ++   + +  +S   +  L+ +G + +  ++    +D
Sbjct: 131 PEAVKRAPAQKKLLELLKPASLTQEE--VISLDISKAALKALEEKGWVARHEKIAELNLD 188

Query: 189 SPNLYFSLPILDKNQQDVVEQVVPLCT----KGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
                 +L + +   +   EQ V + T    +G+  +L+ G+TGSGKTEVYL ++  +L 
Sbjct: 189 ---WRTTLEMDETPHKLNKEQAVAVATLNLQQGYHCTLLEGITGSGKTEVYLAVLEEILK 245

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            GKQ LIL+PEI LT   + RF++RF V  A  HS L+ + R + WRQ   G  ++I+G 
Sbjct: 246 QGKQALILVPEIGLTPQTINRFKRRFKVNVAVLHSGLTDNQRLEAWRQARCGQAAIIIGT 305

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALF P    G+I++DEEHD S+KQ+EG+ Y+ARD++++RG +ES PV+L +ATPS+ES
Sbjct: 306 RSALFTPMAYPGIIILDEEHDSSFKQQEGVGYHARDLAVMRGHLESIPVILGTATPSLES 365

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
             N +S RYH + L  R   +      +ID++   +  G S+   +++ IR  L    Q 
Sbjct: 366 LQNALSGRYHHLQLGERAGAAKKVRQGIIDIKNMPLKAGMSVP--LLNEIRLHLDAGNQV 423

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           LLFLNRRG+AP  LC  CG+  +C  C  +   H+S  ++ CH CG+     + C  CGS
Sbjct: 424 LLFLNRRGFAPALLCHECGHLHECDRCDAFFTVHQSLGEICCHHCGNQYAIPKQCHKCGS 483

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
           +  ++  G G E++AE + + FP   +  +  D     G L+  L+AI KGE  I++GTQ
Sbjct: 484 T-MLMGQGIGTEQLAEALQQEFPKHPVVRIDRDTTRLKGSLETHLNAIHKGEYKILVGTQ 542

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+FP ++LVG++D D  L +AD R+ ER  QL +QV GRAGR       L+Q +Q
Sbjct: 543 MLAKGHHFPDVTLVGLLDVDGALFSADFRAPERFGQLYTQVAGRAGRASKPGTVLLQTHQ 602

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
             +P+++ L+      F  S+++ R+   LPP   +  V        + +N+        
Sbjct: 603 SDNPILRDLLHRGYGEFARSQLKERQQALLPPAWHMVLVRAEAHLASDADNFLNAFAALL 662

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
           P+  +  V GP  +PL    G++R +LL   K  + LQ  F +++     +  +   R  
Sbjct: 663 PQDKEFEVIGPMPAPLDKKAGKFRRQLLFQAKNRNRLQQEFERIHPLVEQLIEAKRCRWS 722

Query: 723 FDIDPQNFL 731
            D DPQ+ L
Sbjct: 723 LDRDPQDLL 731


>gi|302392198|ref|YP_003828018.1| primosomal protein N' [Acetohalobium arabaticum DSM 5501]
 gi|302204275|gb|ADL12953.1| primosomal protein N' [Acetohalobium arabaticum DSM 5501]
          Length = 747

 Score =  389 bits (999), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 249/750 (33%), Positives = 385/750 (51%), Gaps = 45/750 (6%)

Query: 16  VIILLLQAVSGPYIYSVPSAMK--VELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR 73
           ++ L +  V  P+ Y +P  ++  +E+G  V+VP   R + G V    EE  + DS KL+
Sbjct: 9   IVDLPINEVDKPFTYLIPDQLREEIEIGYQVKVPFGHRQLSGYVIELKEE-VESDSTKLK 67

Query: 74  PIEYVFDCPPL-SRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR 132
            I  +     L  R++    KW+ADY  + +  V + V+ +   T+K E  ++     P 
Sbjct: 68  EIIKLKSSLQLFDRELLRLAKWIADYYQTYLITVLKSVIPSGDITQKTERIVRLNYSVPE 127

Query: 133 I-NTVARL--------RVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVI 183
           I   +A+L         VL+ + + +  +      A +V++         G +++++E  
Sbjct: 128 IKQELAKLSKRAYKQREVLEYLIENQDQDLTSTALAEKVNT-------TSGTVRRLYEKD 180

Query: 184 -----------SPVVD---SPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGS 229
                       PV D    P   FSL    +   + +E +      G    L+ GVTGS
Sbjct: 181 LIRYEEMEVRRDPVADIDFEPTTPFSLTTEQQKALNQIENLREAPESG--TLLLKGVTGS 238

Query: 230 GKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKI 289
           GKTEVYL+ +A V+  G+  ++L+PEISLT   ++RF+ RFG + A +HS LS   R   
Sbjct: 239 GKTEVYLQAIAQVIDDGQDAIVLVPEISLTPQTVKRFKSRFGDQIAIYHSHLSNGERYDE 298

Query: 290 WRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIE 349
           W ++ RG   V+VG RSA+F PF  LGLI+IDEEH+ SYKQ +   Y AR ++  R ++ 
Sbjct: 299 WLRMKRGEAKVVVGARSAIFAPFSNLGLIIIDEEHETSYKQGDHPKYQARKVANKRAELT 358

Query: 350 SFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSL-SP 408
               VL +ATP++ES        Y SV L  R  N  LP ++VIDMR +  A  +S+ S 
Sbjct: 359 GAVTVLGTATPALESYYQVQQGNYQSVSLENRIDNRPLPPVEVIDMREELEAGHRSIFSR 418

Query: 409 EMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQ 468
            +   I   LA+NEQ +LFLNRRG++   LC+ CG  L+C +C   L  H  K  L CH 
Sbjct: 419 RLTAAIEDRLAKNEQIILFLNRRGFSTFVLCRECGFVLECPNCDVSLTYHADKTLLRCHY 478

Query: 469 CGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQ 528
           C +       C  C  S  +   G G +++ + + E FP AR+  +  D     G  Q  
Sbjct: 479 CDYQRKVPDICPEC-ESRYIKYFGAGTQKVEQAIIEEFPTARVLRMDVDTTTRKGAHQRM 537

Query: 529 LSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGR 588
           L      E DI++GTQ++AKGH+FP ++LVGV+  D  L   D R++E TFQLL+QV GR
Sbjct: 538 LDRFRNNEADILLGTQMIAKGHDFPNITLVGVITADTALNFPDFRAAEHTFQLLTQVAGR 597

Query: 589 AGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGT 648
            GR  +    ++Q Y P H  +Q     D ++FY+ EI AR+ ++ PPF  L  +II   
Sbjct: 598 TGRGDIVGEVVVQTYDPDHYSIQLAKEHDYETFYQQEIEARKELDYPPFTHLINLIIKHE 657

Query: 649 KYQEVENYAYNL-----KEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQG 703
           K  +V   A  L     ++   R  ++ + GP  +PL  +RG+YR+++++ G+    ++ 
Sbjct: 658 KEVKVSKVANQLGGILNQQIRDRELNVELLGPIPAPLAKLRGKYRWQMILKGRDLDMMRK 717

Query: 704 FFSQMYDNTIKRSN--ALRVQFDIDPQNFL 731
             S   +   K  N  +  +  D+DP   L
Sbjct: 718 LNSYSLEALKKTVNLESTVISVDVDPIKML 747


>gi|160873618|ref|YP_001552934.1| primosomal protein N' [Shewanella baltica OS195]
 gi|160859140|gb|ABX47674.1| primosomal protein N' [Shewanella baltica OS195]
 gi|315265847|gb|ADT92700.1| primosomal protein N' [Shewanella baltica OS678]
          Length = 731

 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 237/729 (32%), Positives = 384/729 (52%), Gaps = 39/729 (5%)

Query: 28  YIYSVPSAMKV--ELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP------IEYVF 79
           + Y VP       ++G  V+VP   + ++G+V   +      D+  L P      +E++ 
Sbjct: 17  FSYRVPETYPSTPQIGVRVKVPFGRQQLIGLVTGIT------DTCSLAPKQIKSVLEFID 70

Query: 80  DCPPLSRQMCEFVKWVADYTFSPMG--LVARMVVSALSETEKMEEKIQF-------TGIF 130
           D P L   + +   W A Y F   G  L   + V+     +   +KIQF         I 
Sbjct: 71  DKPLLPESLYKLTLWAARYYFCSQGQMLTQALPVALRKGLDAAPQKIQFWQLTEIGQNIA 130

Query: 131 PRI--NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVD 188
           P       A+ ++L+ +K   + ++   + +  +S   +  L+ +G + +  ++    +D
Sbjct: 131 PEAVKRAPAQKKLLELLKPASLTQEE--VISLDISKAALKALEDKGWVARHEKIAELNLD 188

Query: 189 SPNLYFSLPILDKNQQDVVEQVVPLCT----KGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
                 +L + +   +   EQ V + T    +G+  +L+ G+TGSGKTEVYL ++  +L 
Sbjct: 189 ---WRTTLEMDETPHKLNKEQAVAVATLNLQQGYHCTLLEGITGSGKTEVYLAVLEEILK 245

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            GKQ LIL+PEI LT   + RF++RF V  A  HS L+ + R + WRQ   G  ++I+G 
Sbjct: 246 QGKQALILVPEIGLTPQTINRFKRRFKVNVAILHSGLTDNQRLEAWRQARCGQAAIIIGT 305

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALF P    G+I++DEEHD S+KQ+EG+ Y+ARD++++RG +ES PV+L +ATPS+ES
Sbjct: 306 RSALFTPMAYPGIIILDEEHDSSFKQQEGVGYHARDLAVMRGHLESIPVILGTATPSLES 365

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
             N +S RYH + L  R  ++      +ID++   +  G S+   +++ IR  L    Q 
Sbjct: 366 LQNALSGRYHHLQLGERAGSAKKVRQGIIDIKNMPLKAGMSVP--LLNEIRLHLDAGNQV 423

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           LLFLNRRG+AP  LC  CG+  +C  C  +   H+S  ++ CH CG+     + C  CGS
Sbjct: 424 LLFLNRRGFAPALLCHECGHLHECDRCDAFFTVHQSLGEICCHHCGNQYAIPKQCHKCGS 483

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
           +  ++  G G E++AE +   FP   +  +  D     G L+  L+AI KGE  I++GTQ
Sbjct: 484 T-MLMGQGIGTEQLAEALQLEFPKHPVVRIDRDTTRLKGSLETHLNAIHKGEYKILVGTQ 542

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+FP ++LVG++D D  L +AD R+ ER  QL +QV GRAGR       L+Q +Q
Sbjct: 543 MLAKGHHFPDVTLVGLLDVDGALFSADFRAPERFGQLYTQVAGRAGRASKPGTVLLQTHQ 602

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
             +P+++ L+      F  S+++ R+   LPP   +  V        + +N+        
Sbjct: 603 SDNPILRDLLHRGYGEFARSQLKERQQALLPPVWHMVLVRAEAHLASDADNFLNAFAALL 662

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
           P+  +  V GP  +PL    G++R +LL   K  + LQ  F +++     +  +   R  
Sbjct: 663 PQDKEFEVIGPMPAPLDKKAGKFRRQLLFQAKNRNRLQQEFERIHPLVEQLIEAKRCRWS 722

Query: 723 FDIDPQNFL 731
            D DPQ+ L
Sbjct: 723 LDRDPQDLL 731


>gi|290513058|ref|ZP_06552421.1| primosomal protein N [Klebsiella sp. 1_1_55]
 gi|289774440|gb|EFD82445.1| primosomal protein N [Klebsiella sp. 1_1_55]
          Length = 731

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 240/725 (33%), Positives = 381/725 (52%), Gaps = 37/725 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE-KYKIDSLKLRPI-EYVFDCPPLS 85
           + Y +P  M V+ G  VRVP   +  +GIV   SE  +  +D LK  P+ E + D P  S
Sbjct: 16  FDYLLPDGMTVKAGCRVRVPFGKQERIGIVAAVSERSELPLDELK--PVAEALDDEPVFS 73

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W A+Y   P+G V    +  L    K          F         +N + R
Sbjct: 74  GTVWRLLMWAAEYYHHPIGDVLFHALPILLRQGKPASATPLWYWFATEQGQAVDLNGLKR 133

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +   + +   +  L+ +G+ +   E  +PV+      +
Sbjct: 134 SPKQQQALAALRQGKIW--RHQVSELEFNEAALQALRGKGLAELACE--APVLTDWRSTY 189

Query: 195 SLP----ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           S+      L+  Q   V  +     + F+  L++G+TGSGKTEVYL ++  VL  G+Q L
Sbjct: 190 SVAGERLRLNTEQATAVGAIHSAADR-FSAWLLAGITGSGKTEVYLSVLENVLAQGRQAL 248

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           +++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF 
Sbjct: 249 VMVPEIGLTPQTIARFRQRFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFT 308

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   
Sbjct: 309 PFKDLGVIVIDEEHDSSYKQQEGWRYHARDLAVWRAHSEQIPIILGSATPALETLHNVRQ 368

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  + LS R  N+      V+D++GQ +  G  LSP +I+ +R  L  + Q +LFLNR
Sbjct: 369 GKYRQLTLSKRAGNARPAQQHVLDLKGQVLQAG--LSPALINRMRQHLQADNQVILFLNR 426

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  ++ 
Sbjct: 427 RGFAPALLCHDCGWIAECPRCDSYYTLHQAQHHLRCHHCDSQRPIPRQCPSCGST-HLVP 485

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +   FP   IS +  D     G L+  L+A+ +G   I+IGTQ++AKGH
Sbjct: 486 VGIGTEQLEQSLTPLFPGVPISRIDRDTTSRKGALEEHLAAVHRGGARILIGTQMLAKGH 545

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 546 HFPDVTLVSLLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVILQTHHPEHPLL 605

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + V+I    +   +   +     NL + +P
Sbjct: 606 QTLLYKGYDAFAEQALAERQTMQLPPW--TSHVLIRAEDHNNQQAPLFLQQLRNLLQASP 663

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            + D + V GP  +      GR+R+++L+       LQ   S      NT+  +  ++  
Sbjct: 664 LADDKLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIVSGTLALINTLPEARKVKWV 723

Query: 723 FDIDP 727
            D+DP
Sbjct: 724 LDVDP 728


>gi|262277903|ref|ZP_06055696.1| primosomal protein N' [alpha proteobacterium HIMB114]
 gi|262225006|gb|EEY75465.1| primosomal protein N' [alpha proteobacterium HIMB114]
          Length = 656

 Score =  387 bits (995), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 201/534 (37%), Positives = 308/534 (57%), Gaps = 4/534 (0%)

Query: 199 LDKNQQDVVEQV-VPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEIS 257
           L+  Q+D+++ +   +  K ++ +L+ G+ GSGKT +Y EI+   L    QVL+LLPE  
Sbjct: 126 LNSEQEDILKNIEKKIDFKKYSTNLLQGIPGSGKTHIYFEIIKKALEENYQVLVLLPEKG 185

Query: 258 LTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGL 317
           L+  I +RF+  F  +PA WHS +   +++KIW+ V +  I +I+G RSALFLPF+ L L
Sbjct: 186 LSEQIAKRFKDFFQYEPAIWHSGIKDKIKKKIWKGVFKNEIKLILGARSALFLPFQNLKL 245

Query: 318 IVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVH 377
           IVIDEEHD SYKQEEGI +NARDM+I++  I+ FP  LVSATPS+E+  N  +++Y+   
Sbjct: 246 IVIDEEHDASYKQEEGISFNARDMAILQASIDQFPTFLVSATPSVETFYNSKNKKYNYFS 305

Query: 378 LSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLT 437
           L  R+  S LP +Q I +    I++   +S  ++  +++ L   +Q L FLNRRG++   
Sbjct: 306 LKNRFNQSELPEIQTIKLTKDNISENNFISELVVKEVKNYLKTGDQVLFFLNRRGHSTFV 365

Query: 438 LCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIER 497
            C  C  RL+C  CS  LV H+      CH C +S    + C    S       G G+E+
Sbjct: 366 FCYKCMKRLECPKCSVGLVYHKRDNTALCHYCNYSTKLERQC-KDNSKCNFKFYGLGLEK 424

Query: 498 IAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSL 557
           + EE+   F      ILSSDL         +L  I + +  II+ TQ+V+KG NF  ++ 
Sbjct: 425 VFEEIKNKFKGYNADILSSDLTEYNA-FSDKLKNIEENKTKIIVATQIVSKGFNFKHLNC 483

Query: 558 VGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGD 617
           +  V+ D      D+RSSE+ +QLL Q++GRAGRF  KS   +Q +   + + ++L   +
Sbjct: 484 IVAVNCDSAFLGNDIRSSEKNYQLLYQLSGRAGRFNKKSKIFLQTFDDKNNIFESLKKFN 543

Query: 618 ADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIVVFGPAE 677
           +D+FY+ EI  RE  NLPPF +  ++++SG     VE YA  LK+  P++  I ++GP  
Sbjct: 544 SDNFYKKEIDFREYSNLPPFYKFISIVVSGKNSFHVEKYAVQLKQTLPKNEFIEIYGPVS 603

Query: 678 SPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQNFL 731
           + +  ++  YRFRLLI        Q    +  +   +    L++Q D+DP NF+
Sbjct: 604 AVISKIKSDYRFRLLIKYNPKVTPQAQIKKKLE-LAQLPKNLKLQVDVDPLNFV 656


>gi|288937832|ref|YP_003441891.1| primosomal protein N' [Klebsiella variicola At-22]
 gi|288892541|gb|ADC60859.1| primosomal protein N' [Klebsiella variicola At-22]
          Length = 731

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 240/725 (33%), Positives = 381/725 (52%), Gaps = 37/725 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE-KYKIDSLKLRPI-EYVFDCPPLS 85
           + Y +P  M V+ G  VRVP   +  +GIV   SE  +  +D LK  P+ E + D P  S
Sbjct: 16  FGYLLPDGMTVKAGCRVRVPFGKQERIGIVAAVSERSELPLDELK--PVAEALDDEPVFS 73

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W A+Y   P+G V    +  L    K          F         +N + R
Sbjct: 74  GTVWRLLMWAAEYYHHPIGDVLFHALPILLRQGKPASATPLWYWFATEQGQAVDLNGLKR 133

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +   + +   +  L+ +G+ +   E  +PV+      +
Sbjct: 134 SPKQQQALAALRQGKIW--RHQVSELEFNEAALQALRGKGLAELACE--APVLTDWRSTY 189

Query: 195 SLP----ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           S+      L+  Q   V  +     + F+  L++G+TGSGKTEVYL ++  VL  G+Q L
Sbjct: 190 SVAGERLRLNTEQATAVGAIHSAADR-FSAWLLAGITGSGKTEVYLSVLENVLAQGRQAL 248

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           +++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF 
Sbjct: 249 VMVPEIGLTPQTIARFRQRFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFT 308

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   
Sbjct: 309 PFKDLGVIVIDEEHDSSYKQQEGWRYHARDLAVWRAHSEQIPIILGSATPALETLHNVRQ 368

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  + LS R  N+      V+D++GQ +  G  LSP +I+ +R  L  + Q +LFLNR
Sbjct: 369 GKYRQLTLSKRAGNARPAQQHVLDLKGQVLQAG--LSPALINRMRQHLQADNQVILFLNR 426

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  ++ 
Sbjct: 427 RGFAPALLCHDCGWIAECPRCDSYYTLHQAQHHLRCHHCDSQRPIPRQCPSCGST-HLVP 485

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +   FP   IS +  D     G L+  L+A+ +G   I+IGTQ++AKGH
Sbjct: 486 VGIGTEQLEQSLTPLFPGVPISRIDRDTTSRKGALEEHLAAVHRGGARILIGTQMLAKGH 545

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 546 HFPDVTLVSLLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVILQTHHPEHPLL 605

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + V+I    +   +   +     NL + +P
Sbjct: 606 QTLLYKGYDAFAEQALAERQTMQLPPW--TSHVLIRAEDHNNQQAPLFLQQLRNLLQASP 663

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            + D + V GP  +      GR+R+++L+       LQ   S      NT+  +  ++  
Sbjct: 664 LADDKLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIVSGTLALINTLPEARKVKWV 723

Query: 723 FDIDP 727
            D+DP
Sbjct: 724 LDVDP 728


>gi|296105367|ref|YP_003615513.1| primosome assembly protein PriA [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059826|gb|ADF64564.1| primosome assembly protein PriA [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 731

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 241/727 (33%), Positives = 383/727 (52%), Gaps = 41/727 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P +M V+ G  V VP   +  +GIV  +  +K ++   +L+ +  V D  P+ S 
Sbjct: 16  FDYLLPDSMSVKAGCRVTVPFGKQQRVGIV-VSVSDKSELPLNELKSVVEVLDSEPVYST 74

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR- 138
                + W ADY   P+G V    +  +    K          F         IN++ R 
Sbjct: 75  STWRLLLWAADYYHHPIGDVLFHALPIMLRQGKSASHAPMWYWFATEQGQAVDINSLKRS 134

Query: 139 ---LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLY-- 193
               + L  ++ GKIW  R  +   +VS   +  L+ +G    + E+ S   ++P LY  
Sbjct: 135 QKQQQALAALRQGKIW--RHQVDELEVSETALQALRKKG----LSELAS---EAPALYDW 185

Query: 194 ---FSLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
              FS+    +    +Q      +   +  F+  L++GVTGSGKTEVYL ++  VL  GK
Sbjct: 186 RERFSVSGDRLRLNTEQATAVGAIHSASGHFSAWLLAGVTGSGKTEVYLSVLENVLAQGK 245

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           Q L+++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+
Sbjct: 246 QALVMVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSS 305

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LF PFK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N
Sbjct: 306 LFTPFKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLHN 365

Query: 368 GISRRYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
              R+YH + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L    Q +L
Sbjct: 366 VRQRKYHMLRLTRRAGN-ARPAIQHVLDLKGQQVQAG--LAPALITRMRQHLQAGNQVIL 422

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRG+AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+ 
Sbjct: 423 FLNRRGFAPALLCHDCGWIAECPRCDHYYTFHQAQRHLRCHHCDSQRPVPRQCPSCGST- 481

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
            ++  G G E++ + +  +FP   IS +  D     G L+ QL+ + +G   I+IGTQ++
Sbjct: 482 HIVPVGLGTEQLEQALEPFFPDVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQML 541

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGH+FP ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P 
Sbjct: 542 AKGHHFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPE 601

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY---NLKEH 663
           HP++Q L+    D+F E  +  R+++ LPP+     +       Q+   +     NL + 
Sbjct: 602 HPLLQTLLHKGYDAFAEQALAERQTMQLPPWTSHVLIRAEDHNIQQAPLFLQQLRNLLQA 661

Query: 664 APR-SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALR 720
           +P   + + + GP  +      GR+R+++L+       LQ   S      NT+  +  ++
Sbjct: 662 SPLVDNQLWILGPVPALAPKRGGRFRWQILLQHPSRIRLQHIVSGTLALINTLPEARKVK 721

Query: 721 VQFDIDP 727
              D+DP
Sbjct: 722 WVLDVDP 728


>gi|152999025|ref|YP_001364706.1| primosomal protein N' [Shewanella baltica OS185]
 gi|304411530|ref|ZP_07393143.1| primosomal protein N' [Shewanella baltica OS183]
 gi|307306694|ref|ZP_07586436.1| primosomal protein N' [Shewanella baltica BA175]
 gi|151363643|gb|ABS06643.1| primosomal protein N' [Shewanella baltica OS185]
 gi|304350057|gb|EFM14462.1| primosomal protein N' [Shewanella baltica OS183]
 gi|306910662|gb|EFN41091.1| primosomal protein N' [Shewanella baltica BA175]
          Length = 731

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 237/729 (32%), Positives = 383/729 (52%), Gaps = 39/729 (5%)

Query: 28  YIYSVPSAMKV--ELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP------IEYVF 79
           + Y VP       ++G  V+VP   + ++G+V   +      D+  L P      +E++ 
Sbjct: 17  FSYRVPETYPSTPQIGVRVKVPFGRQQLIGLVTGIT------DTCSLAPKQIKSVLEFID 70

Query: 80  DCPPLSRQMCEFVKWVADYTFSPMG--LVARMVVSALSETEKMEEKIQF-------TGIF 130
           D P L   + +   W A Y F   G  L   + V+     +   +KIQF         I 
Sbjct: 71  DKPLLPESLYKLTLWAARYYFCSQGQMLTQALPVALRKGLDAAPQKIQFWQLTEIGQNIA 130

Query: 131 PRI--NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVD 188
           P       A+ ++L+ +K   + ++   + +  +S   +  L+ +G + +  ++    +D
Sbjct: 131 PEAVKRAPAQKKLLELLKPASLTQEE--VISLDISKAALKALEDKGWVARHEKIAELNLD 188

Query: 189 SPNLYFSLPILDKNQQDVVEQVVPLCT----KGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
                 +L + +   +   EQ V + T    +G+  +L+ G+TGSGKTEVYL ++  +L 
Sbjct: 189 ---WRTTLEMDETPHKLNKEQAVAVATLNLQQGYHCTLLEGITGSGKTEVYLAVLEEILK 245

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            GKQ LIL+PEI LT   + RF++RF V  A  HS L+ + R + WRQ   G  ++I+G 
Sbjct: 246 QGKQALILVPEIGLTPQTINRFKRRFKVNVAILHSGLTDNQRLEAWRQARCGQAAIIIGT 305

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALF P    G+I++DEEHD S+KQ+EG+ Y+ARD++++RG +ES PV+L +ATPS+ES
Sbjct: 306 RSALFTPMAYPGIIILDEEHDSSFKQQEGVGYHARDLAVMRGHLESIPVILGTATPSLES 365

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
             N +S RYH + L  R   +      +ID++   +  G S+   +++ IR  L    Q 
Sbjct: 366 LQNALSGRYHHLQLGERAGAAKKVRQGIIDIKNMPLKAGMSVP--LLNEIRLHLDAGNQV 423

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           LLFLNRRG+AP  LC  CG+  +C  C  +   H+S  ++ CH CG+     + C  CGS
Sbjct: 424 LLFLNRRGFAPALLCHECGHLHECDRCDAFFTVHQSLGEICCHHCGNQYAIPKQCHKCGS 483

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
           +  ++  G G E++AE +   FP   +  +  D     G L+  L+AI KGE  I++GTQ
Sbjct: 484 T-MLMGQGIGTEQLAEALQLEFPKHPVVRIDRDTTRLKGSLETHLNAIHKGEYKILVGTQ 542

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+FP ++LVG++D D  L +AD R+ ER  QL +QV GRAGR       L+Q +Q
Sbjct: 543 MLAKGHHFPDVTLVGLLDVDGALFSADFRAPERFGQLYTQVAGRAGRASKPGTVLLQTHQ 602

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
             +P+++ L+      F  S+++ R+   LPP   +  V        + +N+        
Sbjct: 603 SDNPILRDLLHRGYGEFARSQLKERQQALLPPAWHMVLVRAEAHLASDADNFLNAFAALL 662

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
           P+  +  V GP  +PL    G++R +LL   K  + LQ  F +++     +  +   R  
Sbjct: 663 PQDKEFEVIGPMPAPLDKKAGKFRRQLLFQAKNRNRLQQEFERIHPLVEQLIEAKRCRWS 722

Query: 723 FDIDPQNFL 731
            D DPQ+ L
Sbjct: 723 LDRDPQDLL 731


>gi|295095091|emb|CBK84181.1| replication restart DNA helicase PriA [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 731

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 241/725 (33%), Positives = 382/725 (52%), Gaps = 37/725 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P +M  + G  V VP   +  +GIV  +  E  ++   +L+ +  V D  P+ S 
Sbjct: 16  FDYLLPDSMSAKAGCRVTVPFGKQQRVGIV-VSVSEHSELPLNELKSVVEVLDSEPVYST 74

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR- 138
                + W ADY   P+G V    +  +    K          F         IN++ R 
Sbjct: 75  STWRLLLWAADYYHHPIGDVLFHALPIMLRQGKSASHAPMWYWFATEQGQAVDINSLKRS 134

Query: 139 ---LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
               + L  ++ GKIW  R  +   +VS   +  L+ +G+ +   E  +P +      FS
Sbjct: 135 QKQQQALAALRQGKIW--RHQVDELEVSETALQALRKKGLSELASE--APALHDWRDGFS 190

Query: 196 LP----ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           +      L+  Q   V  +     + F+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 VSGDRLRLNTEQATAVGAIHSAADR-FSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 249

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 250 MVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 309

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   R
Sbjct: 310 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLHNVRQR 369

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +YH + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L    Q +LFLNR
Sbjct: 370 KYHMLRLTRRAGN-ARPAIQHVLDLKGQQVQAG--LAPALISRMRQHLQAGNQVILFLNR 426

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++ 
Sbjct: 427 RGFAPALLCHDCGWIAECPRCDHYYTFHQAQRHLRCHHCDSQRPVPRQCPSCGST-HIVP 485

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH
Sbjct: 486 VGLGTEQLEQALAPFFPDVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGH 545

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P HP++
Sbjct: 546 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLL 605

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F +  +  R+++ LPP+   + VII    +   +   +     NL + +P
Sbjct: 606 QTLLHKGYDAFADQALAERQTMQLPPW--TSHVIIRAEDHNNQQAPLFLQQLRNLLQASP 663

Query: 666 R-SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
              + + + GP  +      GR+R++LL+       LQ   S      NT+  +  ++  
Sbjct: 664 LVDNQLWILGPVPALAPKRGGRFRWQLLLQHPSRIRLQQIVSGTLALINTLPEARKVKWV 723

Query: 723 FDIDP 727
            D+DP
Sbjct: 724 LDVDP 728


>gi|261343013|ref|ZP_05970871.1| hypothetical protein ENTCAN_09616 [Enterobacter cancerogenus ATCC
           35316]
 gi|288314765|gb|EFC53703.1| primosomal protein N' [Enterobacter cancerogenus ATCC 35316]
          Length = 731

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 240/724 (33%), Positives = 379/724 (52%), Gaps = 35/724 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P +M    G  V VP   +   GIV  +  EK ++   +L+ +  V D  P+ S 
Sbjct: 16  FDYLLPDSMSARAGCRVTVPFGKQQRTGIV-VSVSEKSELPLNELKSVIAVLDNEPVYST 74

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEK-----------MEEKIQFTGIFPRINT 135
                + W ADY   P+G V    +  L    K             E+ Q   I     +
Sbjct: 75  STWRLLLWAADYYHHPIGDVLFHALPILLRQGKNACHAPMWYWFATEQGQAVDINSLKRS 134

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
             + + L  ++ GKIW  R  +   +VS   +  L+ +G+ +   E  +P        FS
Sbjct: 135 QKQQQALAALRQGKIW--RHQVNELEVSETALQALRKKGLSELGSE--APAQQDWRESFS 190

Query: 196 LP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           +    +    +Q      +   +  F+  L++GVTGSGKTEVYL ++  VL  GKQ L++
Sbjct: 191 VSGDRLRLNTEQATAVGAIHSASDHFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALVM 250

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF PF
Sbjct: 251 VPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTPF 310

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
           K LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   R+
Sbjct: 311 KNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLHNVRQRK 370

Query: 373 YHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           YH + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L    Q +LFLNRR
Sbjct: 371 YHMLRLTRRAGN-ARPAIQHVLDLKGQQVQAG--LAPALITRMRQHLQAGNQVILFLNRR 427

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIAC 491
           G+AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++  
Sbjct: 428 GFAPALLCHDCGWIAECPRCDHYYTFHQAQRHLRCHHCDSQRPVPRQCPSCGST-HIVPV 486

Query: 492 GFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHN 551
           G G E++ + +  +FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH+
Sbjct: 487 GLGTEQLEQTLAPFFPDVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHH 546

Query: 552 FPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQ 611
           FP ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P HP++Q
Sbjct: 547 FPDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQ 606

Query: 612 ALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAPR 666
            L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P 
Sbjct: 607 ILLHKGYDAFAEQALAERQTMQLPPW--TSHVIIRAEDHNNQQAPLFLQQLRNLLQASPL 664

Query: 667 -SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQF 723
             + + + GP  +      GR+R+++L+       LQ   S      NT+  +  ++   
Sbjct: 665 VDNQLWILGPVPALAAKRGGRFRWQILLQHPSRIRLQHIVSATLALINTLPDARKVKWVL 724

Query: 724 DIDP 727
           D+DP
Sbjct: 725 DVDP 728


>gi|126176035|ref|YP_001052184.1| primosomal protein N' [Shewanella baltica OS155]
 gi|125999240|gb|ABN63315.1| primosomal protein N' [Shewanella baltica OS155]
          Length = 731

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 237/729 (32%), Positives = 383/729 (52%), Gaps = 39/729 (5%)

Query: 28  YIYSVPSAMKV--ELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP------IEYVF 79
           + Y VP       ++G  V+VP   + ++G+V   +      D+  L P      +E++ 
Sbjct: 17  FSYRVPKTYPSTPQIGVRVKVPFGRQQLIGLVTGIT------DTCSLAPKQIKSVLEFID 70

Query: 80  DCPPLSRQMCEFVKWVADYTFSPMG--LVARMVVSALSETEKMEEKIQF-------TGIF 130
           D P L   + +   W A Y F   G  L   + V+     +   +KIQF         I 
Sbjct: 71  DKPLLPESLYKLTLWAARYYFCSQGQMLTQALPVALRKGLDAAPQKIQFWQLTEIGQNIA 130

Query: 131 PRI--NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVD 188
           P       A+ ++L+ +K   + ++   + +  +S   +  L+ +G + +  ++    +D
Sbjct: 131 PEAVKRAPAQKKLLELLKPASLTQEE--VISLDISKAALKALEDKGWVARHEKIAELNLD 188

Query: 189 SPNLYFSLPILDKNQQDVVEQVVPLCT----KGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
                 +L + +   +   EQ V + T    +G+  +L+ G+TGSGKTEVYL ++  +L 
Sbjct: 189 ---WRTTLEMDETPHKLNKEQAVAVATLNLQQGYHCTLLEGITGSGKTEVYLAVLEEILK 245

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            GKQ LIL+PEI LT   + RF++RF V  A  HS L+ + R + WRQ   G  ++I+G 
Sbjct: 246 QGKQALILVPEIGLTPQTINRFKRRFKVNVAILHSGLTDNQRLEAWRQARCGQAAIIIGT 305

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALF P    G+I++DEEHD S+KQ+EG+ Y+ARD++++RG +ES PV+L +ATPS+ES
Sbjct: 306 RSALFTPMAYPGIIILDEEHDSSFKQQEGVGYHARDLAVMRGHLESIPVILGTATPSLES 365

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
             N +S RYH + L  R   +      +ID++   +  G S+   +++ IR  L    Q 
Sbjct: 366 LQNALSGRYHHLQLDERAGAAKKVRQGIIDIKNMPLKAGMSVP--LLNEIRLHLDAGNQV 423

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           LLFLNRRG+AP  LC  CG+  +C  C  +   H+S  ++ CH CG+     + C  CGS
Sbjct: 424 LLFLNRRGFAPALLCHECGHLHECDRCDAFFTVHQSLGEICCHHCGNQYAIPKQCHKCGS 483

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
           +  ++  G G E++AE +   FP   +  +  D     G L+  L+AI KGE  I++GTQ
Sbjct: 484 T-MLMGQGIGTEQLAEALQLEFPKHPVVRIDRDTTRLKGSLETHLNAIHKGEYKILVGTQ 542

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+FP ++LVG++D D  L +AD R+ ER  QL +QV GRAGR       L+Q +Q
Sbjct: 543 MLAKGHHFPDVTLVGLLDVDGALFSADFRAPERFGQLYTQVAGRAGRASKPGTVLLQTHQ 602

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
             +P+++ L+      F  S+++ R+   LPP   +  V        + +N+        
Sbjct: 603 SDNPILRDLLHRGYGEFARSQLKERQQALLPPAWHMVLVRAEAHLASDADNFLNAFAALL 662

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
           P+  +  V GP  +PL    G++R +LL   K  + LQ  F +++     +  +   R  
Sbjct: 663 PQDKEFEVIGPMPAPLDKKAGKFRRQLLFQAKNRNRLQQEFERIHPLVEQLIEAKRCRWS 722

Query: 723 FDIDPQNFL 731
            D DPQ+ L
Sbjct: 723 LDRDPQDLL 731


>gi|307245942|ref|ZP_07528025.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|307254916|ref|ZP_07536738.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|307259357|ref|ZP_07541084.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 11
           str. 56153]
 gi|306853161|gb|EFM85383.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|306862157|gb|EFM94129.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|306866593|gb|EFM98454.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 11
           str. 56153]
          Length = 732

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 242/729 (33%), Positives = 390/729 (53%), Gaps = 38/729 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +PS +    G  V VP  ++T +GIV  +  E   +   KL+PI+ V D  P+  +
Sbjct: 11  FDYLLPSFLSAVKGVRVEVPFGNQTKIGIV-VDFPETSDVPEDKLKPIKAVLDLEPIFDK 69

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIK 146
           ++   ++W A Y  +P+G VA   +          E+ Q    +  +    R  +L   +
Sbjct: 70  EIWTLLRWAARYYHAPIGEVAINALPVKLRNGDSTERSQPD--YFAVTEAGRAALLSG-E 126

Query: 147 DGKIWEKRDLI-----------RASQVSSHVIDGLKAQGVIKQI---FEVI---SPVVDS 189
           + +  +++DL+           + +  S     GL  +  I+ +   FE+      + + 
Sbjct: 127 NKRAKKQQDLLAKLAEIANFFEKPTACSQSAWKGLLEKNYIEPVNVPFELQHWQKKLQNR 186

Query: 190 P--NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
           P  NL+  L +L+K Q  VV ++      GF   L++GVTGSGKTEVYL+++  VL  G+
Sbjct: 187 PLVNLHNRL-VLNKQQTLVVSRLA--VQNGFEAFLLNGVTGSGKTEVYLQVIEEVLKRGE 243

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           QVL+L+PEI LT   ++RF+ RF V+    HS+++ + R   W +   G  ++++G RSA
Sbjct: 244 QVLVLVPEIGLTPQTVQRFKARFNVEIDVLHSNMNETERLNAWLRAKNGESAIVIGTRSA 303

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LF  F+KLGLI+IDEEHD S+KQ++G  Y+ARD++I+R K    P++L SATPS+ES  N
Sbjct: 304 LFSQFEKLGLIIIDEEHDSSFKQQDGWRYHARDLAILRAKNLHIPIILGSATPSLESVQN 363

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + ++  + L+ R  N+     Q+ID++ Q I  G  LS  ++  ++  L +  Q +LF
Sbjct: 364 VQNGKFIELSLTARAGNAQQAKQQLIDLKTQRITAG--LSDRLLAMMKQHLEQGNQVMLF 421

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRG+AP+ LC  CG   +C  C      H+ +K L CH C    +  + C  CGS+  
Sbjct: 422 LNRRGFAPVLLCHECGWMCECDACEKPYTYHQKQKILRCHHCASQRVIPRQCGHCGSTN- 480

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           +I  G G E++ + + E FP  +IS +  D     G L+  L+ I +G+  I+IGTQ++A
Sbjct: 481 LITTGVGTEQLEQVLSEQFPTYQISRIDRDSTARKGALENHLNDIREGKSQILIGTQMLA 540

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGH+FP ++LV +V+ D  L + D R+ ER  QL  QV GRAGR   +   ++Q + P H
Sbjct: 541 KGHHFPNVTLVAIVNVDSALFSTDFRAEERLAQLYVQVAGRAGRAEKQGEVVLQTHYPEH 600

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS 667
           P+++ L+     +F +  ++ R+ + LPPF     +  +G   Q+V N   NL  +  + 
Sbjct: 601 PLLKTLLEQGYLAFAQEALKMRKVMGLPPFAAQVLLRATGKDNQQVVNLLQNLTAYFQQK 660

Query: 668 ------SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ--MYDNTIKRSNAL 719
                  DI +  P  +P+    G YR+ LLI  +    LQ    Q  +    +   N +
Sbjct: 661 CTELGLQDIQLLPPFSAPMAKKAGHYRWLLLIQHRSRGVLQQLIDQFDLDKANLGLQNNI 720

Query: 720 RVQFDIDPQ 728
           R+  DIDPQ
Sbjct: 721 RLTLDIDPQ 729


>gi|206576976|ref|YP_002241196.1| primosomal protein N' [Klebsiella pneumoniae 342]
 gi|206566034|gb|ACI07810.1| primosomal protein N' [Klebsiella pneumoniae 342]
          Length = 731

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 240/725 (33%), Positives = 380/725 (52%), Gaps = 37/725 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE-KYKIDSLKLRPI-EYVFDCPPLS 85
           + Y +P  M V+ G  VRVP   +  +GIV   SE  +  +D LK  P+ E + D P  S
Sbjct: 16  FDYLLPDGMTVKAGCRVRVPFGKQERIGIVAAVSERSELPLDELK--PVAEALDDEPVFS 73

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W A+Y   P+G V    +  L    K          F         +N + R
Sbjct: 74  GTVWRLLMWAAEYYHHPIGDVLFHALPILLRQGKPASATPLWYWFATEQGQAVDLNGLKR 133

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  +  GKIW  R  +   + +   +  L+ +G+ +   E  +PV+      +
Sbjct: 134 SPKQQQALAALCQGKIW--RHQVSELEFNEAALQALRGKGLAELACE--APVLTDWRSTY 189

Query: 195 SLP----ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           S+      L+  Q   V  +     + F+  L++G+TGSGKTEVYL ++  VL  G+Q L
Sbjct: 190 SVAGERLRLNTEQATAVGAIHSAADR-FSAWLLAGITGSGKTEVYLSVLENVLAQGRQAL 248

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           +++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF 
Sbjct: 249 VMVPEIGLTPQTIARFRQRFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFT 308

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   
Sbjct: 309 PFKDLGVIVIDEEHDSSYKQQEGWRYHARDLAVWRAHSEQIPIILGSATPALETLHNVRQ 368

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  + LS R  N+      V+D++GQ +  G  LSP +I+ +R  L  + Q +LFLNR
Sbjct: 369 GKYRQLTLSKRAGNARPAQQHVLDLKGQVLQAG--LSPALINRMRQHLQADNQVILFLNR 426

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  ++ 
Sbjct: 427 RGFAPALLCHDCGWIAECPRCDSYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGST-HLVP 485

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +   FP   IS +  D     G L+  L+A+ +G   I+IGTQ++AKGH
Sbjct: 486 VGIGTEQLEQSLTPLFPGVPISRIDRDTTSRKGALEEHLAAVHRGGARILIGTQMLAKGH 545

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 546 HFPDVTLVSLLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVILQTHHPEHPLL 605

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + V+I    +   +   +     NL + +P
Sbjct: 606 QTLLYKGYDAFAEQALAERQTMQLPPW--TSHVLIRAEDHNNQQAPLFLQQLRNLLQASP 663

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            + D + V GP  +      GR+R+++L+       LQ   S      NT+  +  ++  
Sbjct: 664 LADDKLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIVSGTLALINTLPEARKVKWV 723

Query: 723 FDIDP 727
            D+DP
Sbjct: 724 LDVDP 728


>gi|330004453|ref|ZP_08304947.1| primosomal protein [Klebsiella sp. MS 92-3]
 gi|328536611|gb|EGF62938.1| primosomal protein [Klebsiella sp. MS 92-3]
          Length = 755

 Score =  385 bits (990), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 238/725 (32%), Positives = 379/725 (52%), Gaps = 37/725 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE-KYKIDSLKLRPI-EYVFDCPPLS 85
           + Y +P  M V+ G  VRVP   +  +GIV   SE  +  +D LK  P+ E + D P  S
Sbjct: 40  FDYLLPEGMAVKAGCRVRVPFGKQERIGIVAAVSERSELPLDELK--PVAEALDDEPVFS 97

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W A+Y   P+G V    +  +    K          F         +N++ R
Sbjct: 98  TTVWRLLMWAAEYYHHPIGDVLFHALPVMLRQGKPASATPLWYWFATEQGQVVDLNSLKR 157

Query: 139 LR----VLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
            R     L  ++ GKIW  R  +   + +   +  L+ +G+ +   E  +P +      +
Sbjct: 158 SRKQQQALAALRQGKIW--RHQVGELEFNEAALQALRGKGLAELACE--APALTDWRSAY 213

Query: 195 SLP----ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           S+      L+  Q   V  +     + F+  L++G+TGSGKTEVYL ++  VL  G+Q L
Sbjct: 214 SVAGERLRLNTEQATAVGAIHSAADR-FSAWLLAGITGSGKTEVYLSVLENVLAQGRQAL 272

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           +++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF 
Sbjct: 273 VMVPEIGLTPQTIARFRQRFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFT 332

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   
Sbjct: 333 PFKDLGVIVIDEEHDSSYKQQEGWRYHARDLAVWRAHSEQIPIILGSATPALETLHNVRQ 392

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  + LS R  N+      V+D++GQ +  G  LSP +I  +R  L  + Q +LFLNR
Sbjct: 393 GKYRQLTLSKRAGNARPAQQHVLDLKGQPLQAG--LSPALISRMRQHLQADNQVILFLNR 450

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  ++ 
Sbjct: 451 RGFAPALLCHDCGWIAECPRCDSYYTLHQAQHHLRCHHCDSQRPIPRQCPSCGST-HLVP 509

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +   FP   IS +  D     G L+  L+A+ +G   I+IGTQ++AKGH
Sbjct: 510 VGIGTEQLEQALAPLFPEVPISRIDRDTTSRKGALEEHLAAVHRGGARILIGTQMLAKGH 569

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 570 HFPDVTLVSLLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVILQTHHPEHPLL 629

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R ++ LPP+   + V+I    +   +   +     NL + +P
Sbjct: 630 QTLLYKGYDAFAEQALAERRTMQLPPW--TSHVLIRAEDHNNQQAPLFLQQLRNLLQASP 687

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            + + + V GP  +      GR+R+++L+       LQ   S      NT+  +  ++  
Sbjct: 688 LADEKLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIVSGTLALINTLPEARKVKWV 747

Query: 723 FDIDP 727
            D+DP
Sbjct: 748 LDVDP 752


>gi|303253665|ref|ZP_07339803.1| primosome assembly protein PriA [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307248076|ref|ZP_07530105.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|302647585|gb|EFL77803.1| primosome assembly protein PriA [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|306855474|gb|EFM87648.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
          Length = 732

 Score =  385 bits (990), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 242/729 (33%), Positives = 388/729 (53%), Gaps = 38/729 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +PS +    G  V VP  ++T +GIV  +  E   +   KL+PI+ V D  P+  +
Sbjct: 11  FDYLLPSFLSAVKGVRVEVPFGNQTKIGIV-VDFPETSDVPEDKLKPIKAVLDLEPIFDK 69

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIK 146
           ++   ++W A Y  +P+G VA   +          E+ Q    +  +    R  +L   +
Sbjct: 70  EIWTLLRWAARYYHAPIGEVAINALPVKLRNGDSTERSQPD--YFAVTEAGRAALLSG-E 126

Query: 147 DGKIWEKRDLI-----------RASQVSSHVIDGLKAQGVIKQIFEVISP------VVDS 189
           + +  +++DL+           + +  S     GL  +  I+ +     P      + + 
Sbjct: 127 NKRAKKQQDLLAKLAEIANFFEKPAACSQSAWKGLLEKNYIELVNVPFEPQHWQKKLQNR 186

Query: 190 P--NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
           P  NL   L +L+K Q  VV ++      GF   L++GVTGSGKTEVYL+++  VL  G+
Sbjct: 187 PLVNLQNRL-VLNKQQSLVVSRLT--VQNGFEAFLLNGVTGSGKTEVYLQVIEEVLKRGE 243

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           QVL+L+PEI LT   ++RF+ RF V+    HS+++ + R   W +V  G  ++++G RSA
Sbjct: 244 QVLVLVPEIGLTPQTVQRFKARFNVEIDVLHSNMNETERLNAWLRVKNGESAIVIGTRSA 303

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LF  F+KLGLI+IDEEHD S+KQ++G  Y+ARD++I+R K    P++L SATPS+ES  N
Sbjct: 304 LFSQFEKLGLIIIDEEHDSSFKQQDGWRYHARDLAILRAKNLHIPIILGSATPSLESVQN 363

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + ++  + L+ R  N+     Q+ID++ Q I  G  LS  ++  ++  L +  Q +LF
Sbjct: 364 VQNGKFIELSLTARAGNAQQAKQQLIDLKTQRITAG--LSDRLLAMMKRHLEQGNQVVLF 421

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRG+AP+ LC  CG   +C  C      H+ +K L CH C    +  + C  CGS+  
Sbjct: 422 LNRRGFAPVLLCHECGWMCECDACEKPYTYHQKQKILRCHHCASQRVIPRQCGHCGSTN- 480

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           +I  G G E++ + + E FP  +IS +  D     G L+  L+ I +G+  I+IGTQ++A
Sbjct: 481 LITTGVGTEQLEQVLSEQFPTYQISRIDRDSTARKGALENHLNDIREGKSQILIGTQMLA 540

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGH+FP ++LV +V+ D  L + D R+ ER  QL  QV GRAGR   +   ++Q + P H
Sbjct: 541 KGHHFPNVTLVAIVNVDSALFSTDFRAEERLAQLYVQVAGRAGRAEKQGEVVLQTHYPEH 600

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS 667
           P+++ L+     +F +  ++ R+ + LPPF     +  +G   Q+V N   NL  +  + 
Sbjct: 601 PLLKTLLEQGYLAFAQEALKMRKVMGLPPFAAQVLLRATGKDNQQVVNLLQNLTAYFQQK 660

Query: 668 ------SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ--MYDNTIKRSNAL 719
                  DI +  P  +P+    G YR+ LLI  +    LQ    Q  +    +   N +
Sbjct: 661 CTELGLQDIQLLPPFSAPMAKKAGHYRWLLLIQHRSRGVLQQLIDQFDLDKANLGLQNNI 720

Query: 720 RVQFDIDPQ 728
           R+  DIDPQ
Sbjct: 721 RLTLDIDPQ 729


>gi|20807951|ref|NP_623122.1| primosomal protein N [Thermoanaerobacter tengcongensis MB4]
 gi|20516521|gb|AAM24726.1| Primosomal protein N (replication factor Y) - superfamily II
           helicase [Thermoanaerobacter tengcongensis MB4]
          Length = 732

 Score =  385 bits (990), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 249/729 (34%), Positives = 388/729 (53%), Gaps = 39/729 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLG-IVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           Y Y VP  M +E+G  V VP ++R V G +V    +  Y ++  K++ +  + D  P+ +
Sbjct: 18  YTYKVPEGMDLEVGMRVLVPFKNRLVEGYVVSLTDKPSYSLE--KIKSVYKILDKYPIFN 75

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSA-LSETEKMEE--KIQFTGIF-------PRINT 135
            +M +  KW+ DY       V + ++ A +   EK  +  +++   +F       PR   
Sbjct: 76  EKMIKLAKWMRDYYKCYFSEVFQTIMPAGIDRGEKKVKLVRLKIEDVFEEDFKKAPRQYE 135

Query: 136 VARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVIS--PVVDSPNLY 193
           V  LR L K    K+ E   L++        I  L+ +G I+   E IS   V D    +
Sbjct: 136 V--LRYLKKRSPIKLSE---LVKILNTDYGTIRALEKKGYIEVYEEEISRFQVRDVEKTF 190

Query: 194 FSLPILDKNQQDVVEQVVPLCTKGFAVS-LISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
              PIL + Q+  VE+V      G   + L+ GVTGSGKTEVYL+++   + +GK  ++L
Sbjct: 191 --PPILTEEQKRAVEEVKKSIFSGQPDAYLLFGVTGSGKTEVYLKLIEETVKIGKSAIVL 248

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI+LT   +ERF  RFG + A  HS LS   R   WR+V    + V+VGVRSA+F PF
Sbjct: 249 VPEIALTPQTIERFVSRFGNRVAVIHSGLSPGERFDEWRKVKNKEVDVVVGVRSAVFAPF 308

Query: 313 KKLGLIVIDEEHDISYKQEEG-ILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
             LGLI+IDEEH+ +YKQ +    YNA++++  R +IE   +V+ SATPS+E+    I  
Sbjct: 309 DNLGLIIIDEEHEATYKQSDTRPRYNAKEVAEKRCEIEKAVLVMASATPSLETYYKAIKG 368

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLARNEQTLLFLN 429
            Y  + L+ R + +++P ++V++M  + +A+G +   S ++   I+  L + EQT+LFLN
Sbjct: 369 DYKLLKLTRRIK-ASMPEIEVVNMSDE-LAKGNNSIFSRKLFSYIKENLKKGEQTILFLN 426

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGY+    C+ CG   KC +C   L  H   KKL CH CG+     ++C  CGS  ++ 
Sbjct: 427 RRGYSSFVACRDCGYVPKCPNCDISLTYHFEDKKLVCHYCGYEEPMRETCPKCGSK-RIR 485

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
             G G ER+  ++ ++FP AR+  +  D     G  +        G+ DI+IGTQ+++KG
Sbjct: 486 YMGIGTERVEMDIKKFFPEARVLRMDVDTTRRKGSHEKIFYEFKNGKADILIGTQMISKG 545

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
            + P ++LVGV+  D+ L   D RSSERTFQLL+QV GRAGR       +IQ Y+  H  
Sbjct: 546 FDIPNVTLVGVILADITLNLPDFRSSERTFQLLTQVAGRAGRGEKPGRVVIQTYEDNHYS 605

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR--- 666
           +      D   F+  EI+ RE    PPF  L  +++SG   ++V+N + N      +   
Sbjct: 606 ILTAKEQDYVKFFREEIKYREIFKYPPFAHLMNIVVSGEDEEKVKNASANTYLACQKVIN 665

Query: 667 ----SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQ 722
                S   + GPA +P+  +  RYR+++++  +    L+      Y   +K    +RV 
Sbjct: 666 KLQVKSYNKILGPAPAPISKINNRYRWQVIVKSEEREVLEEIAE--YVQNMKYPKDIRVA 723

Query: 723 FDIDPQNFL 731
            DIDP N +
Sbjct: 724 VDIDPLNIM 732


>gi|165976457|ref|YP_001652050.1| primosome assembly protein PriA [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|165876558|gb|ABY69606.1| primosomal protein N' [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
          Length = 746

 Score =  385 bits (990), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 242/729 (33%), Positives = 388/729 (53%), Gaps = 38/729 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +PS +    G  V VP  ++T +GIV  +  E   +   KL+PI+ V D  P+  +
Sbjct: 25  FDYLLPSFLSAVKGVRVEVPFGNQTKIGIV-VDFPETSDVPEDKLKPIKAVLDLEPIFDK 83

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIK 146
           ++   ++W A Y  +P+G VA   +          E+ Q    +  +    R  +L   +
Sbjct: 84  EIWTLLRWAARYYHAPIGEVAINALPVKLRNGDSTERSQPD--YFAVTEAGRAALLSG-E 140

Query: 147 DGKIWEKRDLI-----------RASQVSSHVIDGLKAQGVIKQIFEVISP------VVDS 189
           + +  +++DL+           + +  S     GL  +  I+ +     P      + + 
Sbjct: 141 NKRAKKQQDLLAKLAEIANFFEKPAACSQSAWKGLLEKNYIELVNVPFEPQHWQKKLQNR 200

Query: 190 P--NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
           P  NL   L +L+K Q  VV ++      GF   L++GVTGSGKTEVYL+++  VL  G+
Sbjct: 201 PLVNLQNRL-VLNKQQSLVVSRLT--VQNGFEAFLLNGVTGSGKTEVYLQVIEEVLKRGE 257

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           QVL+L+PEI LT   ++RF+ RF V+    HS+++ + R   W +V  G  ++++G RSA
Sbjct: 258 QVLVLVPEIGLTPQTVQRFKARFNVEIDVLHSNMNETERLNAWLRVKNGESAIVIGTRSA 317

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LF  F+KLGLI+IDEEHD S+KQ++G  Y+ARD++I+R K    P++L SATPS+ES  N
Sbjct: 318 LFSQFEKLGLIIIDEEHDSSFKQQDGWRYHARDLAILRAKNLHIPIILGSATPSLESVQN 377

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + ++  + L+ R  N+     Q+ID++ Q I  G  LS  ++  ++  L +  Q +LF
Sbjct: 378 VQNGKFIELSLTARAGNAQQAKQQLIDLKTQRITAG--LSDRLLAMMKRHLEQGNQVVLF 435

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRG+AP+ LC  CG   +C  C      H+ +K L CH C    +  + C  CGS+  
Sbjct: 436 LNRRGFAPVLLCHECGWMCECDACEKPYTYHQKQKILRCHHCASQRVIPRQCGHCGSTN- 494

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           +I  G G E++ + + E FP  +IS +  D     G L+  L+ I +G+  I+IGTQ++A
Sbjct: 495 LITTGVGTEQLEQVLSEQFPTYQISRIDRDSTARKGALENHLNDIREGKSQILIGTQMLA 554

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGH+FP ++LV +V+ D  L + D R+ ER  QL  QV GRAGR   +   ++Q + P H
Sbjct: 555 KGHHFPNVTLVAIVNVDSALFSTDFRAEERLAQLYVQVAGRAGRAEKQGEVVLQTHYPEH 614

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS 667
           P+++ L+     +F +  ++ R+ + LPPF     +  +G   Q+V N   NL  +  + 
Sbjct: 615 PLLKTLLEQGYLAFAQEALKMRKVMGLPPFAAQVLLRATGKDNQQVVNLLQNLTAYFQQK 674

Query: 668 ------SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ--MYDNTIKRSNAL 719
                  DI +  P  +P+    G YR+ LLI  +    LQ    Q  +    +   N +
Sbjct: 675 CTELGLQDIQLLPPFSAPMAKKAGHYRWLLLIQHRSRGVLQQLIDQFDLDKANLGLQNNI 734

Query: 720 RVQFDIDPQ 728
           R+  DIDPQ
Sbjct: 735 RLTLDIDPQ 743


>gi|212211845|ref|YP_002302781.1| primosomal protein N' [Coxiella burnetii CbuG_Q212]
 gi|212010255|gb|ACJ17636.1| primosomal protein N' [Coxiella burnetii CbuG_Q212]
          Length = 662

 Score =  385 bits (989), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 203/532 (38%), Positives = 303/532 (56%), Gaps = 7/532 (1%)

Query: 199 LDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISL 258
           L++ QQ+ V Q+  + +KGF   L++GVTGSGKTEVYL  +  ++   KQ LIL+PEI L
Sbjct: 133 LNEYQQNAVNQI--MASKGFQTFLLAGVTGSGKTEVYLRCIEKLIQQEKQALILVPEIGL 190

Query: 259 TSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLI 318
           T   L RF++RF V  A  HSSL+   R + W    RG   +++G RSA+F P    G+I
Sbjct: 191 TPQTLNRFRERFNVPTAVLHSSLTDKKRAQAWMMAKRGTAKIVIGTRSAIFTPLLNPGII 250

Query: 319 VIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHL 378
           ++DEEHD S+KQ+ G  Y+ARD++++RG+ E+ PVVL SATPS+ES  N   RRY  + L
Sbjct: 251 ILDEEHDTSFKQQSGFRYSARDLAVMRGQFENIPVVLGSATPSLESLYNVERRRYQLLSL 310

Query: 379 STRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTL 438
             R   + LP L ++D+R + +  G  +S +++  I   +    Q LLFLNRRGYAP  L
Sbjct: 311 PGRAGKAKLPSLTIVDLRQKKLIAG--MSEDLLISIEKHIKNKGQVLLFLNRRGYAPTLL 368

Query: 439 CQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERI 498
           C  CG  + C  C   L  H   K+LYCH CG +     +C  C    ++I  G G ER+
Sbjct: 369 CHGCGWVMHCDRCDARLTLHYFPKRLYCHHCGAAKKIPPTCPQCHQQ-ELIDVGLGTERL 427

Query: 499 AEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLV 558
              + + FP   I  +  D       ++ +L+ I   E  I+IGTQ++AKGH+FP ++LV
Sbjct: 428 EAALQQRFPNDDIVRIDRDSTRTKNSMENKLNLIHNREAPILIGTQMIAKGHHFPHLTLV 487

Query: 559 GVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDA 618
            ++D D GL +AD R++ER  QLL+QV GRAGR   +   LIQ +QP +P +  L+    
Sbjct: 488 AIIDADSGLYSADFRATERMGQLLTQVAGRAGRVDRQGEVLIQTHQPNNPFLTLLLQEGY 547

Query: 619 DSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS--SDIVVFGPA 676
           ++F ++ ++ R+ V LPPF  LA +     K     ++   +KE        ++ + GP 
Sbjct: 548 EAFAQALLKERQLVQLPPFTYLALLRTEAVKQNLPLDFLTKIKELMVNELKEEVDLLGPV 607

Query: 677 ESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
            + +    GRYR++LL   K   +L    +++      +   +R   DIDPQ
Sbjct: 608 SAGMERKAGRYRYQLLFQSKHRKHLHSVLNKLISLLATQRTKVRWSLDIDPQ 659


>gi|283834709|ref|ZP_06354450.1| primosomal protein [Citrobacter youngae ATCC 29220]
 gi|291069635|gb|EFE07744.1| primosomal protein [Citrobacter youngae ATCC 29220]
          Length = 732

 Score =  385 bits (989), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 234/724 (32%), Positives = 377/724 (52%), Gaps = 34/724 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M  + G  VRVP  + +  +GIV   SE   ++   +L+ +  V D  P+ S
Sbjct: 16  FDYLLPQGMSAKAGCRVRVPFGKQQERVGIVLSVSEHS-ELPLNELKAVLEVLDSEPVYS 74

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 75  TSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEEGQVIDLNSLKR 134

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E  +P       ++
Sbjct: 135 SPKQQQALAALRQGKIW--RDRVAELEFNDAALQALRKKGLCDLASE--TPGFSDWRTHY 190

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AVSGERLRLNTEQATAVGAIHSAADSFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPIEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           +Y  + L+ R  N+      V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNRR
Sbjct: 371 KYRMLRLTRRAGNARPATQHVLDLKGQQVQAG--LAPALITRMRQHLQADNQVILFLNRR 428

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIAC 491
           G+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+  
Sbjct: 429 GFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPIPRQCPSCGST-HMVPV 487

Query: 492 GFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHN 551
           G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH+
Sbjct: 488 GLGTEQLEQALAPFFPGVPISRIDRDTTSRKGSLEQHLAEVHRGGARILIGTQMLAKGHH 547

Query: 552 FPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQ 611
           FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++Q
Sbjct: 548 FPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLLQ 607

Query: 612 ALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAPR 666
            L+    D+F E  +  R+++ LPP+   + VI+    +       +     NL + +P 
Sbjct: 608 TLLYKGYDAFAEQALAERQTLQLPPW--TSHVIVRAEDHNNQHAPMFLQQLRNLIQASPL 665

Query: 667 SSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQF 723
           + D + V GP  +      GRYR+++L+       LQ   S      NT+  +  ++   
Sbjct: 666 ADDKLWVLGPVPALAPKRGGRYRWQILLQHPSRIRLQHIVSGTLALINTLPDARKVKWVL 725

Query: 724 DIDP 727
           D+DP
Sbjct: 726 DVDP 729


>gi|146313670|ref|YP_001178744.1| primosome assembly protein PriA [Enterobacter sp. 638]
 gi|145320546|gb|ABP62693.1| replication restart DNA helicase PriA [Enterobacter sp. 638]
          Length = 731

 Score =  385 bits (989), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 235/724 (32%), Positives = 381/724 (52%), Gaps = 35/724 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P +M  + G  V VP   +  +G+V  +  +K ++   +L+ +  V D  P+ S 
Sbjct: 16  FDYLLPDSMSAKAGCRVTVPFGKQQRVGVV-VSVSDKSELPINELKAVVEVLDVEPVYSA 74

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR- 138
            +   + W ADY   P+G V    +  L    K          F         IN++ R 
Sbjct: 75  SVWRLLLWAADYYHHPIGDVLFHALPILLRQGKSASHAPTWYWFATEDGQAVDINSLKRS 134

Query: 139 ---LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFS 195
               + L  ++ G+IW  R  +   + +   +  L+ +G+ +   E  +P +      FS
Sbjct: 135 PKQQQALAALRQGRIW--RHQVEELEFNDAALQALRKKGLCELASE--APALVDWRDGFS 190

Query: 196 LP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           +    +    +Q      +   +  F+  L++GVTGSGKTEVYL ++   L  GKQ L++
Sbjct: 191 VAGERLRLNTEQATAVGAIHSASDSFSAWLLAGVTGSGKTEVYLSVLENALAQGKQALVM 250

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI LT   + RF++RF       HS L+ + R   W +   G  ++++G RS+LF PF
Sbjct: 251 VPEIGLTPQTIARFRERFNAPVEVLHSGLNDTERLSAWLKAKNGEAAIVIGTRSSLFTPF 310

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
           K LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   R+
Sbjct: 311 KNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLHNVRQRK 370

Query: 373 YHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           YH + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNRR
Sbjct: 371 YHMLRLTRRAGN-ARPAIQHVLDLKGQQVQAG--LAPALITRMRQHLQADNQVILFLNRR 427

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIAC 491
           G+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+  
Sbjct: 428 GFAPTLLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGST-HMVPV 486

Query: 492 GFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHN 551
           G G E++ + +  +FP   +S +  D     G L+ QL+ + +G   I+IGTQ++AKGH+
Sbjct: 487 GLGTEQLEQALAPFFPGVPLSRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHH 546

Query: 552 FPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQ 611
           FP ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P HP++Q
Sbjct: 547 FPDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQ 606

Query: 612 ALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAPR 666
            L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P 
Sbjct: 607 TLLHKGYDAFAEQALAERQTMQLPPW--TSHVIIRAEDHNNQQAPLFLQQLRNLLQASPL 664

Query: 667 -SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQF 723
             + + + GP  +      GRYR+++L+       LQ   S      NT+  +  ++   
Sbjct: 665 VDNQLWILGPVPALAPKRGGRYRWQILLQHPSRVRLQHVISGTLALINTLPEARKVKWVL 724

Query: 724 DIDP 727
           D+DP
Sbjct: 725 DVDP 728


>gi|28199908|ref|NP_780222.1| primosome assembly protein PriA [Xylella fastidiosa Temecula1]
 gi|182682659|ref|YP_001830819.1| primosome assembly protein PriA [Xylella fastidiosa M23]
 gi|28058039|gb|AAO29871.1| primosomal protein N' [Xylella fastidiosa Temecula1]
 gi|182632769|gb|ACB93545.1| primosomal protein N' [Xylella fastidiosa M23]
 gi|307578940|gb|ADN62909.1| primosome assembly protein PriA [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 733

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 234/725 (32%), Positives = 378/725 (52%), Gaps = 38/725 (5%)

Query: 28  YIYSVPSAMKVE---LGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR-PIEYVFDCPP 83
           + Y  PS + +    LG  VRVP   R ++G+V    E      S+ LR    ++   P 
Sbjct: 18  FDYLPPSGIPLPDSTLGCRVRVPFGKRELIGVV---VELPSAEMSVPLREAFAWIDRIPI 74

Query: 84  LSRQMCEFVKWVADYTFSPMG-LVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVL 142
           L  ++ + ++W++ YT +P+G ++A  +   L   + + E   +T    R+    R    
Sbjct: 75  LDGELAQSLQWLSHYTHTPLGEILATALPGLLRHGKPLPET--WTCWAWRLTETGRTAAP 132

Query: 143 DKIKDGKIWEKRDLIRASQVSSHVID-----------GLKAQGVIKQIFEVISPVVDSPN 191
              ++ +  +  +L+ AS  +   ++            L  +G +++I +  +  V    
Sbjct: 133 KLRRNSRSAQMAELLTASDQTEDALNTRMNRWRAVAHNLTKRGYVERIKKPTTVPVIIQT 192

Query: 192 LYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
              ++P+L+  QQ  VE +      GF   L+ GVTGSGKTEVYL+ +A  L   KQ L+
Sbjct: 193 TSNTVPVLNTEQQKAVETLN--ANVGFKTYLLDGVTGSGKTEVYLQAIATCLAASKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           L+PEI LT  +L  F  R G+     HS L+ S R ++W     G   +++G RSA+F P
Sbjct: 251 LVPEIGLTPQLLTNFHARLGIPVHALHSKLADSERARVWATARCGEARLVLGTRSAVFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
               GLI++DEEHD SYKQ++GI YNARD ++VRGK  + PV+L SATPS+ES  N  + 
Sbjct: 311 LPNAGLIIVDEEHDTSYKQQDGIRYNARDFALVRGKALNVPVILGSATPSLESLYNAHNG 370

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           RY  + LS R   +  P ++V+D+R + +  G  LSPE++ GI  TLAR+EQ L+F NR 
Sbjct: 371 RYKHLRLSYRAGQAYAPQVRVLDVRKRPLKDG--LSPEVLTGINATLARDEQVLVFKNRC 428

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLY-------CHQCGHSAIYSQSCVVCGS 484
           GY+P+ LC  CG    C  CS  +  H +   +Y       CH CG       SC  CGS
Sbjct: 429 GYSPVLLCHDCGWTATCHQCSTSV--HHTPMTVYSGGTYLQCHHCGARQPMPLSCPDCGS 486

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
           +  +   G G ER+   + E FP   +  +  +       L+ Q + +      I++GTQ
Sbjct: 487 TA-LQPQGIGTERLEARLIEAFPKHPVVRIDRNTTKHRDGLKTQFTKLGNAA-GILVGTQ 544

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+ PR+++V VV  D GL +AD R++E+  Q L QV GRAGR        +Q + 
Sbjct: 545 ILAKGHHLPRLTMVVVVGIDEGLFSADFRATEKLSQQLIQVAGRAGRAKHAGEVWLQTHH 604

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P HP++Q L++G   +F  +E++ R++  LPPF  LA +          + +   +++H 
Sbjct: 605 PDHPLLQTLINGGYHTFANTELQQRQAAWLPPFAHLALLRAEAKDTTSTQQFLTTIRKHM 664

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
           P ++ +  +GP  +P+    G  R++LL+   + + L    + +    + +  +  +R  
Sbjct: 665 PTNNAVECYGPMSAPMPRRAGYERYQLLLSSSQRNALHRTLNVLIPAIHALPEARRVRWS 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|152972730|ref|YP_001337876.1| primosome assembly protein PriA [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150957579|gb|ABR79609.1| primosome assembly protein PriA [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 731

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 238/725 (32%), Positives = 379/725 (52%), Gaps = 37/725 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE-KYKIDSLKLRPI-EYVFDCPPLS 85
           + Y +P  M V+ G  VRVP   +  +GIV   SE  +  +D LK  P+ E + D P  S
Sbjct: 16  FDYLLPEGMAVKAGCRVRVPFGKQERIGIVAAVSERSELPLDELK--PVAEALDDEPVFS 73

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W A+Y   P+G V    +  +    K          F         +N + R
Sbjct: 74  TTVWRLLMWAAEYYHHPIGDVLFHALPVMLRQGKPASATPLWYWFATEQGQVVDLNGLKR 133

Query: 139 LR----VLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
            R     L  ++ GKIW  R  +   + +   +  L+ +G+ +   E  +P +      +
Sbjct: 134 SRKQQQALAALRQGKIW--RHQVGELEFNEAALQALRGKGLAELACE--APALTDWRSAY 189

Query: 195 SLP----ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           S+      L+  Q   V  +     + F+  L++G+TGSGKTEVYL ++  VL  G+Q L
Sbjct: 190 SVAGERLRLNTEQATAVGAIHSAADR-FSAWLLAGITGSGKTEVYLSVLENVLAQGRQAL 248

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           +++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF 
Sbjct: 249 VMVPEIGLTPQTIARFRQRFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFT 308

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   
Sbjct: 309 PFKDLGVIVIDEEHDSSYKQQEGWRYHARDLAVWRAHSEQIPIILGSATPALETLHNVRQ 368

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  + LS R  N+      V+D++GQ +  G  LSP +I  +R  L  + Q +LFLNR
Sbjct: 369 GKYRQLTLSKRAGNARPAQQHVLDLKGQPLQAG--LSPALISRMRQHLQADNQVILFLNR 426

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  ++ 
Sbjct: 427 RGFAPALLCHDCGWIAECPRCDSYYTLHQAQHHLRCHHCDSQRPIPRQCPSCGST-HLVP 485

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +   FP   IS +  D     G L+  L+A+ +G   I+IGTQ++AKGH
Sbjct: 486 VGIGTEQLEQALAPLFPEVPISRIDRDTTSRKGALEEHLAAVHRGGARILIGTQMLAKGH 545

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 546 HFPDVTLVSLLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVILQTHHPEHPLL 605

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + V+I    +   +   +     NL + +P
Sbjct: 606 QTLLYKGYDAFAEQALAERQTMQLPPW--TSHVLIRAEDHNNQQAPLFLQQLRNLLQASP 663

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            + + + V GP  +      GR+R+++L+       LQ   S      NT+  +  ++  
Sbjct: 664 LADEKLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIVSGTLALINTLPEARKVKWV 723

Query: 723 FDIDP 727
            D+DP
Sbjct: 724 LDVDP 728


>gi|261867133|ref|YP_003255055.1| primosome assembly protein PriA [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412465|gb|ACX81836.1| primosomal protein N' [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 746

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 237/730 (32%), Positives = 380/730 (52%), Gaps = 47/730 (6%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIE-YVFDCPPLSR 86
           + Y +P+++ V +G+ V VP  ++  +G+V     E+  +   +L+P++ Y+ +    S 
Sbjct: 30  FDYILPTSLNVVVGARVWVPFGTQKRVGVV-VEVAEQSDVSMEQLKPVQAYLDEVSLFSP 88

Query: 87  QMCEFVKWVADYTFSPMGLVARMVV--------------SALSETEKMEEKIQFTGIFPR 132
           Q  +F++W A Y  +P+G V    +              S   +   + E+    G+  R
Sbjct: 89  QSWQFLQWAAGYYHAPLGEVLSQALPVKLRQGESAVEKPSVFWKPTALGEQALTQGLLKR 148

Query: 133 INTVARLRVLDKIKD----------GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEV 182
                +L  L    D            IW     ++A    + VI   + Q   +Q+ + 
Sbjct: 149 AKK--QLEALQAANDLPEKGNNPFSAAIWSA---LKAKDYVTEVILETEIQTWQQQLGD- 202

Query: 183 ISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAV 242
             P+V+  +       L+K Q  V  Q+    T+GF   L+ GVTGSGKTE+YL+ +  +
Sbjct: 203 -KPLVNKADRL----TLNKPQALVFSQLK--FTQGFVPWLLDGVTGSGKTEIYLQFIEDI 255

Query: 243 LHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIV 302
           L  GKQVL+L+PEI LT   + RFQ RF V     HS+L+ + R ++W++   G  +V++
Sbjct: 256 LQQGKQVLVLVPEIGLTPQTVRRFQARFNVVIDVLHSNLNDTQRLQVWQRARNGQSAVVI 315

Query: 303 GVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSI 362
           G RSALF  F +LG I+IDEEHD S+KQ++G  Y+ARD++IV  K  + P+++ SATPS+
Sbjct: 316 GTRSALFTQFAELGAIIIDEEHDASFKQQDGWRYHARDLAIVYAKQLNIPILMGSATPSL 375

Query: 363 ESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNE 422
           ES  N  S +Y  + LS +  NS     Q+ID++ Q I  G  LS  ++  ++  L +  
Sbjct: 376 ESLNNVQSGKYRHLSLSEKANNSTALKQQIIDLKRQPIHNG--LSDVLLKRMQAHLEKGN 433

Query: 423 QTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVC 482
           Q LLFLNRRG+AP+ LC  CG   +C HC      H+    L CH C       + C  C
Sbjct: 434 QVLLFLNRRGFAPVLLCHECGWMAECRHCDKPYTYHQQHHVLRCHHCASQKPIPRQCGNC 493

Query: 483 GSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIG 542
           GS+ ++I  G G E++   + E FP   I+ +  D     G+L+  L  I +G+  I+IG
Sbjct: 494 GST-QLITTGLGTEQLEATLKEAFPNYGIARIDRDTTARKGKLEDYLEDINQGKSQILIG 552

Query: 543 TQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQA 602
           TQ++AKGH+FP ++LV +V+ D  L + D R+ ER  QL  QV GRAGR   +   L+Q 
Sbjct: 553 TQMLAKGHHFPNVTLVALVNVDSALFSLDFRAEERLAQLYMQVAGRAGRGSQQGEVLLQT 612

Query: 603 YQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE 662
           + P HP++Q+L+      F ++ +  R+S+ LPPFG  A         +E E       E
Sbjct: 613 HYPEHPLLQSLLQKGYSQFAQNALALRKSIGLPPFGSQALFKAQSRYSEEAEQLLAQFVE 672

Query: 663 HAPR-----SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSN 717
           +  +     + ++ + GP  +P     G+YR++LL+     + LQ   ++ +     +  
Sbjct: 673 YLQQIKRNTAPELQILGPMPAPFSKKAGQYRWQLLLQHPSRAALQQVLTEFWRYQGDQPT 732

Query: 718 ALRVQFDIDP 727
            +R   D+DP
Sbjct: 733 KVRWILDVDP 742


>gi|262041706|ref|ZP_06014898.1| primosomal protein N [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259040968|gb|EEW42047.1| primosomal protein N [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 755

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 238/725 (32%), Positives = 379/725 (52%), Gaps = 37/725 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE-KYKIDSLKLRPI-EYVFDCPPLS 85
           + Y +P  M V+ G  VRVP   +  +GIV   SE  +  +D LK  P+ E + D P  S
Sbjct: 40  FDYLLPEGMAVKAGCRVRVPFGKQERIGIVAAVSERSELPLDELK--PVAEALDDEPVFS 97

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W A+Y   P+G V    +  +    K          F         +N + R
Sbjct: 98  TTVWRLLMWAAEYYHHPIGDVLFHALPVMLRQGKPASATPLWYWFATEQGQVVDLNGLKR 157

Query: 139 LR----VLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
            R     L  ++ GKIW  R  +   + +   +  L+ +G+ +   E  +P +      +
Sbjct: 158 SRKQQQALAALRQGKIW--RHQVGELKFNEAALQALRGKGLAELACE--APALTDWRSAY 213

Query: 195 SLP----ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           S+      L+  Q   V  +     + F+  L++G+TGSGKTEVYL ++  VL  G+Q L
Sbjct: 214 SVAGERLRLNTEQATAVGAIHSAADR-FSAWLLAGITGSGKTEVYLSVLENVLAQGRQAL 272

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           +++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF 
Sbjct: 273 VMVPEIGLTPQTIARFRQRFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFT 332

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   
Sbjct: 333 PFKDLGVIVIDEEHDSSYKQQEGWRYHARDLAVWRAHSEQIPIILGSATPALETLHNVRQ 392

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  + LS R  N+      V+D++GQ +  G  LSP +I  +R  L  + Q +LFLNR
Sbjct: 393 GKYRQLTLSKRAGNARPAQQHVLDLKGQPLQAG--LSPALISRMRQHLQADNQVILFLNR 450

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  ++ 
Sbjct: 451 RGFAPALLCHDCGWIAECPRCDSYYTLHQAQHHLRCHHCDSQRPIPRQCPSCGST-HLVP 509

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +   FP   IS +  D     G L+  L+A+ +G   I+IGTQ++AKGH
Sbjct: 510 VGIGTEQLEQALAPLFPEVPISRIDRDTTSRKGALEEHLAAVHRGGARILIGTQMLAKGH 569

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 570 HFPDVTLVSLLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVILQTHHPEHPLL 629

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + V+I    +   +   +     NL + +P
Sbjct: 630 QTLLYKGYDAFAEQALAERQTMQLPPW--TSHVLIRAEDHNNQQAPLFLQQLRNLLQASP 687

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            + + + V GP  +      GR+R+++L+       LQ   S      NT+  +  ++  
Sbjct: 688 LADEKLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIVSGTLALINTLPEARKVKWV 747

Query: 723 FDIDP 727
            D+DP
Sbjct: 748 LDVDP 752


>gi|332290001|ref|YP_004420853.1| primosome assembly protein PriA [Gallibacterium anatis UMN179]
 gi|330432897|gb|AEC17956.1| primosome assembly protein PriA [Gallibacterium anatis UMN179]
          Length = 735

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 245/744 (32%), Positives = 389/744 (52%), Gaps = 56/744 (7%)

Query: 23  AVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCP 82
           A+   + Y +P +++V +G+ V VP  ++  +G++   SE     +   L+ +  V D  
Sbjct: 11  ALRNQFDYLLPDSLEVTIGARVLVPFGTQKRIGLI---SEFLPASEVENLKTVLKVLDQQ 67

Query: 83  PL-SRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRI--NTVARL 139
           PL   +M + V W  DY   P+G     + +AL    + EE       +P +      +L
Sbjct: 68  PLFDEKMWQLVLWAKDYYHYPIG---EALFTALPLKFRKEE-------YPSLMQQQFYQL 117

Query: 140 RVLDKIKDGKIWEKRDLI------------RASQVSSHVIDGLKAQGVIKQIFEVISPVV 187
             L K    +   KR L             R  + S      +K Q + K   E+I+   
Sbjct: 118 TALGKAALAENSLKRALKQQEMLQFLQQHQRLEKESDIFSATIKRQLLQKNYVELITD-- 175

Query: 188 DSPNLYF------SLPI--------LDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTE 233
           + P L+F      ++P+        L+K Q   V Q+     +GF   L+ GVTGSGKTE
Sbjct: 176 EQPKLWFERATIDAIPLVNEKNKLMLNKEQALAVSQIS--LRQGFHSWLLQGVTGSGKTE 233

Query: 234 VYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQV 293
           VYL+++  VL   +QVL+L+PEI LT  I+ RF  RF V     HS+++ + R ++W++ 
Sbjct: 234 VYLQVIEEVLKQKRQVLVLVPEIGLTPQIIRRFNLRFNVPIGVLHSNMTDNARLQVWQEA 293

Query: 294 ARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPV 353
            RG +++++G RSA+F  F  LGLIV+DEEHD S+KQ+EG  Y+ARD+++ R K    P+
Sbjct: 294 RRGELAIVIGTRSAIFTQFPDLGLIVLDEEHDQSFKQQEGWRYHARDLAVYRAKQHDIPI 353

Query: 354 VLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDG 413
           +L SATPS+ES  N  +++YH + L  R  N    H  V+D++ Q +  G  LS  ++  
Sbjct: 354 ILGSATPSLESLHNVENQKYHFIPLRYRATNQVANHQMVVDLKTQPMENG--LSYALLQQ 411

Query: 414 IRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSA 473
           ++  L R EQ LLFLNRRG+AP+ LC  CG    C  C+     H+S++ L CH C    
Sbjct: 412 MKQVLERGEQVLLFLNRRGFAPVYLCHECGTVESCPRCNRPYTYHQSRRILQCHHCDAQK 471

Query: 474 IYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIA 533
                C  CGS+  ++  G G E++ + + + FP  +I+ L  D     G L   L  IA
Sbjct: 472 PIPFQCANCGST-HLLTTGIGTEQLEQVLQQKFPQYQIARLDRDNVTKKGELDRYLDEIA 530

Query: 534 KGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFG 593
           +G+  I+IGTQ++AKGH+FP + LVG+++ D  L ++D R+ ER  QL  QV GR GR  
Sbjct: 531 QGKRQILIGTQMLAKGHHFPNVGLVGLINIDSALFSSDFRAEERLAQLYVQVAGRTGRGN 590

Query: 594 LKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISG---TKY 650
              L L+Q + P HP+   L+S    +F +  +  R+   LPP+   A +  SG   T+ 
Sbjct: 591 KAGLVLLQTHYPEHPLFNTLISKGYSAFSQQALLQRQQFQLPPYSYQALLKASGNNETQL 650

Query: 651 QEVENYAYNLKEHAPRS--SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQG--FFS 706
            +   +     ++ P++    + + GP  + +    G+YR+ +L   ++ S L    F  
Sbjct: 651 AQSLTFFVEQVKNLPQAWLEQLQIVGPLPALMEKRAGKYRWYVLFQHQQRSKLHQVLFHI 710

Query: 707 QMYDNTIKRSNALRVQFDIDPQNF 730
           +   NT K ++ +R+  DIDP +F
Sbjct: 711 ETLLNTNKPASGVRLSLDIDPYDF 734


>gi|94268711|ref|ZP_01291262.1| Primosomal protein n [delta proteobacterium MLMS-1]
 gi|93451494|gb|EAT02323.1| Primosomal protein n [delta proteobacterium MLMS-1]
          Length = 820

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 221/609 (36%), Positives = 336/609 (55%), Gaps = 14/609 (2%)

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVI----KQIFEVISPVVDS 189
            T+A L  L   ++     +R+L R    +   + GL A G++    +++F    P+ + 
Sbjct: 215 KTLALLGELAGAEEQPAVPRRELTRQYPGAGRALKGLAAHGLVALEQRRLFR--DPLGEP 272

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P  +     L   QQ V+  + P  T G +A  L+ GVTGSGKTEVYL+  A  L  G+Q
Sbjct: 273 PPFFARPAQLTTEQQAVLAAIQPAVTGGRYAPFLLHGVTGSGKTEVYLQAAATALAQGRQ 332

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VL+L+PEI+L + +   F  RFG   A  HS L+   R   W  +  G   + +G RSA+
Sbjct: 333 VLVLVPEIALATQLEGHFCSRFGDIVALLHSGLAAGARFDQWSLLLSGQAKIAIGARSAI 392

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           F P    GLI++DEEHD +YKQE+   YNARD++++RG  +   V+L SATP++ S    
Sbjct: 393 FAPLPDPGLIIVDEEHDPAYKQEDQPRYNARDLALLRGLQQQATVILGSATPAVASFYQA 452

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLARNEQTLL 426
            + ++  + +S R  +  LP +++ID++      G+    SP+++  ++  LA   Q+L+
Sbjct: 453 QAGKFKLLTMSKRVEDRPLPAVEIIDLQEVKTVSGRPPLFSPQLVKALKENLAAGRQSLV 512

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRG+A L LC+ CG  ++C HC   L  H+ + +L CH CG     +  C  C  SG
Sbjct: 513 FLNRRGFANLMLCKDCGRPIQCQHCQVSLTLHKKRGQLLCHHCGFHLPRNVVCPHC-RSG 571

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
            ++A GFG ER+ EE+    P ARI+ L  D      R    L A+   EIDI+IGTQ++
Sbjct: 572 TLVAAGFGTERLEEELSRLLPSARIARLDQDTSRDRRRYLAVLKAVRDHEIDILIGTQMI 631

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
            KGH+FP+++LVG+V  D GL   D +++ERTFQLL+QV+GRAGR       ++Q  Q  
Sbjct: 632 TKGHHFPQVTLVGIVWADAGLGIPDYKAAERTFQLLTQVSGRAGRGEHPGRVIVQTLQAD 691

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR 666
           H  +    + D    Y+ EI  R  +  PPFGRL  + + G   Q  +  A  L E A R
Sbjct: 692 HYSVALAQAHDYQGLYQREIALRRRLGFPPFGRLINLRLDGENEQRCQELAAGLGEIARR 751

Query: 667 S--SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNA--LRVQ 722
              + + V GPA +PL  +RGRYR++LL+ G   + +      +     K + A  +++ 
Sbjct: 752 QQPATVQVLGPAPAPLARLRGRYRWQLLLKGAEVATIHTLCRGICAEFAKLAGASTVKLS 811

Query: 723 FDIDPQNFL 731
            D+DP+N +
Sbjct: 812 LDVDPENMV 820



 Score = 40.8 bits (94), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 3/92 (3%)

Query: 24  VSGPYIYSVP-SAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCP 82
           +  P  Y+ P  A  ++ G  + VPL  R + G +    +++  +   K+RP   V D  
Sbjct: 20  IEHPLTYTPPPEAGILQPGQRLLVPLGKRQITGYL-LACQQQSPVAGAKIRPALAVLDPE 78

Query: 83  PL-SRQMCEFVKWVADYTFSPMGLVARMVVSA 113
           PL    M  F +W+ADY   P+G + +  + A
Sbjct: 79  PLFPAAMIPFFRWLADYYHHPIGEIIQSALPA 110


>gi|332998433|gb|EGK18031.1| primosomal protein N' [Shigella flexneri K-272]
 gi|333014126|gb|EGK33483.1| primosomal protein N' [Shigella flexneri K-227]
          Length = 732

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 240/721 (33%), Positives = 372/721 (51%), Gaps = 28/721 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  VRVP  + +  +GIV  +  +  ++   +L+ +  V D  P+ +
Sbjct: 16  FDYLLPEGMTVKAGCRVRVPFGKQQERIGIV-VSVSDASELPLTELKAVVEVLDSEPVFT 74

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 75  HSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEQGQAVDLNSLKR 134

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E         N   
Sbjct: 135 SPKQQQALAALRQGKIW--RDQVATLEFNDAALQALRKKGLCDLASETPEFSDWRTNYAV 192

Query: 195 SLPILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           S   L  N +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L+++
Sbjct: 193 SGERLRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALVMV 252

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RSALF PFK
Sbjct: 253 PEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFK 312

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   ++Y
Sbjct: 313 NLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQKKY 372

Query: 374 HSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
             + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  N Q +LFLNRRG
Sbjct: 373 RLLRLTRRAGN-ARPAIQHVLDLKGQKVQAG--LAPALITRMRQHLQANNQVILFLNRRG 429

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++  G
Sbjct: 430 FAPALLCHDCGWIAECPRCDHYYTLHQAQQHLRCHHCDSQRPVPRQCPSCGST-HLVPVG 488

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ + +   FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH+F
Sbjct: 489 LGTEQLEQTLAPLFPDVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHHF 548

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P HP++Q 
Sbjct: 549 PDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQT 608

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE---HAPRSSD 669
           L+    D+F E  +  R  + LPP+     V       Q    +   L+     +P + D
Sbjct: 609 LLYKGYDAFAEQALAERRMMQLPPWTSHVIVRAEDHNNQHAPLFLQQLRNLILSSPLADD 668

Query: 670 -IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDID 726
            + V GP  +      GR+R+++L+       LQ   S      NTI  S  ++   D+D
Sbjct: 669 KLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIISGTLALINTIPDSRKVKWVLDVD 728

Query: 727 P 727
           P
Sbjct: 729 P 729


>gi|94264677|ref|ZP_01288459.1| Primosomal protein n [delta proteobacterium MLMS-1]
 gi|93454908|gb|EAT05152.1| Primosomal protein n [delta proteobacterium MLMS-1]
          Length = 820

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 221/609 (36%), Positives = 336/609 (55%), Gaps = 14/609 (2%)

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVI----KQIFEVISPVVDS 189
            T+A L  L   ++     +R+L R    +   + GL A G++    +++F    P+ + 
Sbjct: 215 KTLALLGELAGAEEQPAVPRRELTRQYPGAGRALKGLAAHGLVALEQRRLFR--DPLGEP 272

Query: 190 PNLYFSLPILDKNQQDVVEQVVPLCTKG-FAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
           P  +     L   QQ V+  + P  T G +A  L+ GVTGSGKTEVYL+  A  L  G+Q
Sbjct: 273 PPFFARPAQLTTEQQAVLAAIQPAVTGGRYAPFLLHGVTGSGKTEVYLQAAATALAQGRQ 332

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
           VL+L+PEI+L + +   F  RFG   A  HS L+   R   W  +  G   + +G RSA+
Sbjct: 333 VLVLVPEIALATQLEGHFCSRFGDIVALLHSGLAAGARFDQWSLLLSGQAKIAIGARSAI 392

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
           F P    GLI++DEEHD +YKQE+   YNARD++++RG  +   V+L SATP++ S    
Sbjct: 393 FAPLPDPGLIIVDEEHDPAYKQEDQPRYNARDLALLRGLQQQATVILGSATPAVASFYQA 452

Query: 369 ISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS--LSPEMIDGIRHTLARNEQTLL 426
            + ++  + +S R  +  LP +++ID++      G+    SP+++  ++  LA   Q+L+
Sbjct: 453 QAGKFKLLTMSKRVEDRPLPAVEIIDLQEVKTVSGRPPLFSPQLVKALKENLAAGRQSLV 512

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRG+A L LC+ CG  ++C HC   L  H+ + +L CH CG     +  C  C  SG
Sbjct: 513 FLNRRGFANLMLCKDCGRPIQCQHCQVSLTLHKKRDQLLCHHCGFHLPRNVVCPHC-RSG 571

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
            ++A GFG ER+ EE+    P ARI+ L  D      R    L A+   EIDI+IGTQ++
Sbjct: 572 TLVAAGFGTERLEEELSRLLPSARIARLDQDTSRDRRRYLAVLKAVRDHEIDILIGTQMI 631

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
            KGH+FP+++LVG+V  D GL   D +++ERTFQLL+QV+GRAGR       ++Q  Q  
Sbjct: 632 TKGHHFPQVTLVGIVWADAGLGIPDYKAAERTFQLLTQVSGRAGRGEHPGRVIVQTLQAD 691

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR 666
           H  +    + D    Y+ EI  R  +  PPFGRL  + + G   Q  +  A  L E A R
Sbjct: 692 HYSVALAQAHDYQGLYQREIALRRRLGFPPFGRLINLRLDGENEQRCQELAAGLGEIARR 751

Query: 667 S--SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNA--LRVQ 722
              + + V GPA +PL  +RGRYR++LL+ G   + +      +     K + A  +++ 
Sbjct: 752 QQPATVQVLGPAPAPLARLRGRYRWQLLLKGAEVATIHTLCRGICAEFAKLAGASTVKLS 811

Query: 723 FDIDPQNFL 731
            D+DP+N +
Sbjct: 812 LDVDPENMV 820



 Score = 40.8 bits (94), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 44/92 (47%), Gaps = 3/92 (3%)

Query: 24  VSGPYIYSVP-SAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCP 82
           +  P  Y+ P  A  ++ G  + VPL  R + G +    +++  +   K+RP   V D  
Sbjct: 20  IEHPLTYTPPPEAGILQPGQRLLVPLGKRQITGYL-LACQQQSPVAGAKIRPALAVLDPE 78

Query: 83  PL-SRQMCEFVKWVADYTFSPMGLVARMVVSA 113
           PL    M  F +W+ADY   P+G + +  + A
Sbjct: 79  PLFPAAMIPFFRWLADYYHHPIGEIIQSALPA 110


>gi|269964737|ref|ZP_06178975.1| Primosomal protein N' [Vibrio alginolyticus 40B]
 gi|269830636|gb|EEZ84857.1| Primosomal protein N' [Vibrio alginolyticus 40B]
          Length = 734

 Score =  384 bits (987), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 241/729 (33%), Positives = 384/729 (52%), Gaps = 39/729 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYN-SEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y++P  +   +G  V VP   +T++GIV    +   +  D LK  PI+ V D  P+ S
Sbjct: 18  FDYAIPGHLFPIIGGRVSVPFGRQTLVGIVTAMVNHSDFPKDQLK--PIKAVLDSQPIWS 75

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSA------------LSE---TEKMEEKIQFTGIF 130
            ++   + W + +   P+G      + A            L E   TE  ++K+   G+ 
Sbjct: 76  EKLYSLLTWCSQFYQYPLGDTLHNAMPAALRKGKPADFATLQEWQITESGKDKL-MQGLD 134

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFE--VISPVVD 188
            R   V + +VL  + +G +  +       +++S V+  L+ +G I++I +   I+    
Sbjct: 135 RR--AVKQQKVLQMLVNGALPHQE--FVDQEIASTVLKSLEEKGWIERIEKKPAITQWGQ 190

Query: 189 SPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQ 248
               Y   P L+  Q   +  V      GFA  L+ GVTGSGKTEVYL ++  VL  GKQ
Sbjct: 191 HVECYVEKPKLNHEQALAIASVN--SQTGFACYLLEGVTGSGKTEVYLNLIKPVLEQGKQ 248

Query: 249 VLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSAL 308
            L+L+PEI LT   + RF++RF V     HS L+ + R   W      A  +I+G RSAL
Sbjct: 249 ALVLVPEIGLTPQTINRFKRRFNVPVDVIHSGLNETERLNAWLSARDKAAGIIIGTRSAL 308

Query: 309 FLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNG 368
             PF  LG+I++DEEHD SYKQ++ + Y+ARD++++R   E  P+VL SATP++E+  N 
Sbjct: 309 LAPFADLGIIIVDEEHDTSYKQQDSLRYHARDVAVMRAHKEQVPIVLGSATPALETLHNA 368

Query: 369 ISRRYHSVHLSTRYRNSALPHL-QVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
           +S +YH + L+ R   SA+P   +V+D++GQ +  G  LS ++I  +R  L    Q +LF
Sbjct: 369 LSGKYHHLTLTQR-AGSAVPTTNKVLDVKGQYLESG--LSAQLIAEMRKHLKAGNQVMLF 425

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRG++P  +C  CG   +C  C  +   H    ++ CH CG        C  CGS+ +
Sbjct: 426 LNRRGFSPALMCHECGWIAECKRCDAYYTFHHYSNEIRCHHCGSQQPVIHQCQGCGST-Q 484

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           ++  G G E++ +++ + FP  +   +  D     G L+  L +I KGE  I+IGTQ++A
Sbjct: 485 LVTVGVGTEQLEQQLAQLFPEYKAIRIDRDSTRRKGSLEDALESIRKGEHQILIGTQMLA 544

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGH+FP ++LV ++D D  L ++D R+SER  QL  QV GRAGR       ++Q + P H
Sbjct: 545 KGHHFPNVTLVALLDVDGSLYSSDFRASERLAQLFIQVAGRAGRASKPGEVILQTHHPEH 604

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENY----AYNLKEH 663
            ++QAL+  D   F  + +  R+   LPP+  L        + + VE++     + L+ H
Sbjct: 605 SLLQALLQKDYRHFAMTALEERKLAQLPPYSFLTLFKAEANQSEIVEDFLRQVRFTLESH 664

Query: 664 APRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQF 723
                  +V GP  SPL    G+YR++LL+  +  S +Q   +          NA +V++
Sbjct: 665 PLFDDSCMVLGPTPSPLAKRAGKYRWQLLLQTQHRSLMQKLLTSAKPAIELLPNAKKVRW 724

Query: 724 --DIDPQNF 730
             DI+PQ+ 
Sbjct: 725 NLDIEPQDL 733


>gi|293390957|ref|ZP_06635291.1| primosomal protein N' [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290951491|gb|EFE01610.1| primosomal protein N' [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 732

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 237/730 (32%), Positives = 380/730 (52%), Gaps = 47/730 (6%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIE-YVFDCPPLSR 86
           + Y +P+++ V +G+ V VP  ++  +G+V     E+  +   +L+P++ Y+ +    S 
Sbjct: 16  FDYILPTSLNVVVGARVWVPFGTQKRVGVV-VEVAEQSDVPVEQLKPVQAYLDEVSLFSP 74

Query: 87  QMCEFVKWVADYTFSPMGLVARMVV--------------SALSETEKMEEKIQFTGIFPR 132
           Q  +F++W A Y  +P+G V    +              S   +   + E+    G+  R
Sbjct: 75  QSWQFLQWAAGYYHAPLGEVLSQALPVKLRQGESAVEKPSVFWKPTALGEQALTQGLLKR 134

Query: 133 INTVARLRVLDKIKD----------GKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEV 182
                +L  L    D            IW     ++A    + VI   + Q   +Q+ + 
Sbjct: 135 AKK--QLEALQAANDLPEKGNNPFSAAIWSA---LKAKDYVTEVILETEIQTWQQQLGD- 188

Query: 183 ISPVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAV 242
             P+V+  +       L+K Q  V  Q+    T+GF   L+ GVTGSGKTE+YL+ +  +
Sbjct: 189 -KPLVNKADRL----TLNKPQALVFSQLK--FTQGFVPWLLDGVTGSGKTEIYLQFIEDI 241

Query: 243 LHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIV 302
           L  GKQVL+L+PEI LT   + RFQ RF V     HS+L+ + R ++W++   G  +V++
Sbjct: 242 LQQGKQVLVLVPEIGLTPQTVRRFQARFNVVIDVLHSNLNDTQRLQVWQRARNGQSAVVI 301

Query: 303 GVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSI 362
           G RSALF  F +LG I+IDEEHD S+KQ++G  Y+ARD++IV  K  + P+++ SATPS+
Sbjct: 302 GTRSALFTQFAELGAIIIDEEHDASFKQQDGWRYHARDLAIVYAKQLNIPILMGSATPSL 361

Query: 363 ESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNE 422
           ES  N  S +Y  + LS +  NS     Q+ID++ Q I  G  LS  ++  ++  L +  
Sbjct: 362 ESLNNVQSGKYRHLSLSEKANNSTALKQQIIDLKRQPIHNG--LSDVLLKRMQAHLEKGN 419

Query: 423 QTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVC 482
           Q LLFLNRRG+AP+ LC  CG   +C HC      H+    L CH C       + C  C
Sbjct: 420 QVLLFLNRRGFAPVLLCHECGWMAECRHCDKPYTYHQQHHVLRCHHCASQKPIPRQCGNC 479

Query: 483 GSSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIG 542
           GS+ ++I  G G E++   + E FP   I+ +  D     G+L+  L  I +G+  I+IG
Sbjct: 480 GST-QLITTGLGTEQLEATLKEAFPNYGIARIDRDTTARKGKLEDYLEDINQGKSQILIG 538

Query: 543 TQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQA 602
           TQ++AKGH+FP ++LV +V+ D  L + D R+ ER  QL  QV GRAGR   +   L+Q 
Sbjct: 539 TQMLAKGHHFPNVTLVALVNVDSALFSLDFRAEERLAQLYMQVAGRAGRGSQQGEVLLQT 598

Query: 603 YQPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE 662
           + P HP++Q+L+      F ++ +  R+S+ LPPFG  A         +E E       E
Sbjct: 599 HYPEHPLLQSLLQKGYSQFAQNALALRKSIGLPPFGSQALFKAQSRYREEAEQLLAQFVE 658

Query: 663 HAPR-----SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSN 717
           +  +     + ++ + GP  +P     G+YR++LL+     + LQ   ++ +     +  
Sbjct: 659 YLQQIKRNTAPELQILGPMPAPFSKKAGQYRWQLLLQHPSRAALQQVLTEFWRYQGDQPT 718

Query: 718 ALRVQFDIDP 727
            +R   D+DP
Sbjct: 719 KVRWILDVDP 728


>gi|71901710|ref|ZP_00683784.1| Primosomal protein n [Xylella fastidiosa Ann-1]
 gi|71728527|gb|EAO30684.1| Primosomal protein n [Xylella fastidiosa Ann-1]
          Length = 733

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 233/725 (32%), Positives = 377/725 (52%), Gaps = 38/725 (5%)

Query: 28  YIYSVPSAMKVE---LGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR-PIEYVFDCPP 83
           + Y  PS + +    LG  VRVP   R ++G+V    E      S+ LR    ++   P 
Sbjct: 18  FDYLPPSGIPLPNSTLGCRVRVPFGKRELIGVV---VELPSAEISVPLREAFAWIDRIPI 74

Query: 84  LSRQMCEFVKWVADYTFSPMG-LVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVL 142
           L  ++ + ++W++ YT +P+G ++A  +   L   + + E   +T    R+         
Sbjct: 75  LDGELAQSLQWLSHYTHTPLGEILATALPGLLRHGKPLPET--WTCWAWRLTETGHTAAP 132

Query: 143 DKIKDGKIWEKRDLIRASQVSSHVID-----------GLKAQGVIKQIFEVISPVVDSPN 191
              ++ +  +  +L+ AS  +   ++            L  +G +++I +  +  V    
Sbjct: 133 KLRRNSRSAQMAELLTASDQTEDALNTRMNRWRAVARNLTKRGYVERIKKPTTVPVIIQT 192

Query: 192 LYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
              ++P+L+  QQ  VE +      GF   L+ GVTGSGKTEVYL+ +A  L   KQ L+
Sbjct: 193 TSNTVPVLNTEQQKAVETLN--ANVGFKTYLLDGVTGSGKTEVYLQAIATCLAASKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           L+PEI LT  +L  F  R G+     HS L+ S R ++W     G   +++G RSA+F P
Sbjct: 251 LVPEIGLTPQLLTNFHARLGIPVHALHSKLADSERARVWATARCGEARLVLGTRSAVFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
               GLI++DEEHD SYKQ++GI YNARD ++VRGK  + PV+L SATPS+ES  N  + 
Sbjct: 311 LPHAGLIIVDEEHDTSYKQQDGIRYNARDFALVRGKALNVPVILGSATPSLESLYNAHNG 370

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           RY  + LS R   +  P ++V+D+R + +  G  LSPE++ GI  TLAR+EQ L+F NR 
Sbjct: 371 RYKHLRLSYRAGQAYAPQVRVLDVRKRPLKDG--LSPEVLTGINATLARDEQVLVFKNRC 428

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLY-------CHQCGHSAIYSQSCVVCGS 484
           GY+P+ LC  CG    C  CS  +  H +   +Y       CH CG       SC  CGS
Sbjct: 429 GYSPVLLCHDCGWTATCHQCSTSV--HHTPMTVYSAGTYLQCHHCGARQTMPLSCPDCGS 486

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
           +  +   G G ER+   + E FP   +  +  +       L+ Q + +      I++GTQ
Sbjct: 487 TA-LQPQGIGTERLEARLIEAFPKHPVVRIDRNTTKHRDGLKTQFTKLGNAA-GILVGTQ 544

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+ PR+++V VV  D GL +AD R++E+  Q L QV GRAGR        +Q + 
Sbjct: 545 ILAKGHHLPRLTMVVVVGIDEGLFSADFRATEKLSQQLIQVAGRAGRAKHAGEVWLQTHH 604

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P HP++Q L++G   +F  +E++ R++  LPPF  LA +          + +   +++H 
Sbjct: 605 PDHPLLQTLINGGYHTFANTELQQRQAAGLPPFAHLALLRAEAKDTTSTQQFLTTIRKHM 664

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
           P ++ +  +GP  +P+    G  R++LL+   + + L    + +    + +  +  +R  
Sbjct: 665 PTNNAVECYGPMSAPMPRRAGYERYQLLLSSSQRNALHRTLNVLIPAIHALPEARRVRWS 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|324115663|gb|EGC09599.1| primosomal protein N [Escherichia coli E1167]
          Length = 732

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 240/721 (33%), Positives = 372/721 (51%), Gaps = 28/721 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  VRVP  + +  +GIV  +  +  ++   +L+ +  V D  P+ +
Sbjct: 16  FDYLLPEGMTVKAGCRVRVPFGKQQERIGIV-VSVSDASELPLNELKAVVEVLDSEPVFT 74

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 75  HSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEQGQAVDLNSLKR 134

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E         N   
Sbjct: 135 SPKQQQALAALRQGKIW--RDQVATLEFNDAALQALRKKGLCDLASETPEFSDWRTNYAV 192

Query: 195 SLPILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           S   L  N +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L+++
Sbjct: 193 SGERLRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALVMV 252

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RSALF PFK
Sbjct: 253 PEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFK 312

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   ++Y
Sbjct: 313 NLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQKKY 372

Query: 374 HSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
             + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  N Q +LFLNRRG
Sbjct: 373 RLLRLTRRAGN-ARPAIQHVLDLKGQKVQAG--LAPALITRMRQHLQANNQVILFLNRRG 429

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++  G
Sbjct: 430 FAPALLCHDCGWIAECPRCDHYYTLHQAQQHLRCHHCDSQRPVPRQCPSCGST-HLVPVG 488

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ + +   FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH+F
Sbjct: 489 LGTEQLEQTLAPLFPDVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHHF 548

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P HP++Q 
Sbjct: 549 PDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQT 608

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE---HAPRSSD 669
           L+    D+F E  +  R  + LPP+     V       Q    +   L+     +P + D
Sbjct: 609 LLYKGYDAFAEQALAERRMMQLPPWTSHVIVRAEDHNNQHAPLFLQQLRNLLLSSPLADD 668

Query: 670 -IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDID 726
            + V GP  +      GR+R+++L+       LQ   S      NTI  S  ++   D+D
Sbjct: 669 KLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIISGTLALINTIPDSRKVKWVLDVD 728

Query: 727 P 727
           P
Sbjct: 729 P 729


>gi|237728049|ref|ZP_04558530.1| primosome assembly protein PriA [Citrobacter sp. 30_2]
 gi|226910306|gb|EEH96224.1| primosome assembly protein PriA [Citrobacter sp. 30_2]
          Length = 746

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 233/724 (32%), Positives = 377/724 (52%), Gaps = 34/724 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  +  + G  VRVP  + +  +GIV   SE   ++   +L+ +  V D  P+ S
Sbjct: 30  FDYLLPEGLSAKAGCRVRVPFGKQQERVGIVLSVSEHS-ELPRSELKAVLEVLDSEPVYS 88

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 89  TSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPATNAPMWYWFATEEGQVIDLNSLKR 148

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E  +P       ++
Sbjct: 149 SPKQQQALAALRQGKIW--RDQVAELEFNDAALQALRKKGLCDLASE--TPGFSDWRTHY 204

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   +  F+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 205 AVSGERLRLNTEQATAVGAIHSASDSFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 264

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 265 MVPEIGLTPQTITRFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 324

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N    
Sbjct: 325 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQN 384

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           +Y  + L+ R  N+      V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNRR
Sbjct: 385 KYRMLRLTRRAGNARPATQHVLDLKGQQVQAG--LAPALIARMRQHLQADNQVILFLNRR 442

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIAC 491
           G+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+  
Sbjct: 443 GFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPIPRQCPSCGST-HMVPV 501

Query: 492 GFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHN 551
           G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH+
Sbjct: 502 GLGTEQLEQALAPFFPGVPISRIDRDTTSRKGSLEQHLAEVHRGGARILIGTQMLAKGHH 561

Query: 552 FPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQ 611
           FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++Q
Sbjct: 562 FPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLLQ 621

Query: 612 ALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAPR 666
            L+    D+F E  +  R+++ LPP+   + VI+    +       +     NL + +P 
Sbjct: 622 TLLYKGYDAFAEQALAERQTLQLPPW--TSHVIVRAEDHNNQHAPMFLQQLRNLIQASPL 679

Query: 667 SSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQF 723
           + D + V GP  +      GRYR+++L+       LQ   S      NT+  +  ++   
Sbjct: 680 ADDKLWVLGPVPALAPKRGGRYRWQILLQHPSRIRLQHIVSGTLALINTLPDARKVKWVL 739

Query: 724 DIDP 727
           D+DP
Sbjct: 740 DVDP 743


>gi|307261515|ref|ZP_07543184.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 12
           str. 1096]
 gi|306868798|gb|EFN00606.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 12
           str. 1096]
          Length = 732

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 241/732 (32%), Positives = 387/732 (52%), Gaps = 44/732 (6%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P  +    G  V VP  ++T +G+V  +  E   +   KL+PI+ V D  P+   
Sbjct: 11  FDYLLPPFLSAVKGVRVEVPFGNQTKIGVV-VDFPETSDVPEDKLKPIKAVLDLEPIFDE 69

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQ---FTGIFPRINTVARLRVLD 143
           ++   ++W A Y  +P+G VA   +          E+ Q   FT     +    R  +L 
Sbjct: 70  EIWTLLRWAARYYHAPIGEVAINALPVKLRNGDSTERSQPDYFT-----VTEAGRAALLS 124

Query: 144 KIKDGKIWEKRDLI-----------RASQVSSHVIDGLKAQGVIKQIFEVISP------V 186
             ++ +  +++DL+           + +  S     GL  +  I+ +     P      +
Sbjct: 125 G-ENKRAKKQQDLLEKLAEIASFFEKPTACSQSAWKGLLEKNYIEPVNVPFEPQHWQKKL 183

Query: 187 VDSP--NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
            + P  NL+  L +L+K Q  VV ++      GF   L++GVTGSGKTEVYL+++  VL 
Sbjct: 184 QNRPLVNLHNRL-VLNKQQSLVVSRLT--VQNGFEAFLLNGVTGSGKTEVYLQVIEEVLK 240

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            G+QVL+L+PEI LT   ++RF+ RF V+    HS+++ + R   W +   G  ++++G 
Sbjct: 241 RGEQVLVLVPEIGLTPQTVQRFKARFNVEIDVLHSNMNETERLNAWWRAKNGESAIVIGT 300

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALF  F+KLGLI+IDEEHD S+KQ++G  Y+ARD++I+R K    P++L SATPS+ES
Sbjct: 301 RSALFSQFEKLGLIIIDEEHDSSFKQQDGWRYHARDLAILRAKNLHIPIILGSATPSLES 360

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
             N  + ++  + L+ R  N+     Q+ID++ Q I  G  LS  ++  ++  L +  Q 
Sbjct: 361 VQNVQNGKFIELSLTARAGNAQQAKQQLIDLKTQRITAG--LSDRLLAMMKRHLEQGNQV 418

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           +LFLNRRG+AP+ LC  CG   +C  C      H+ +K L CH C    +  + C  CGS
Sbjct: 419 MLFLNRRGFAPVLLCHECGWMCECDACEKPYTYHQKQKILRCHHCASQRVIPRQCGHCGS 478

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
           +  +I  G G E++ + + E FP  +IS +  D     G L+  L+ I +G+  I+IGTQ
Sbjct: 479 TN-LITTGVGTEQLEQVLSEQFPTYQISRIDRDSTARKGALENHLNDIREGKSQILIGTQ 537

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+FP ++LV +V+ D  L + D R+ ER  QL  QV GRAGR   +   ++Q + 
Sbjct: 538 MLAKGHHFPNVTLVAIVNVDSALFSTDFRAEERLAQLYVQVAGRAGRAEKQGEVVLQTHY 597

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P HP+++ L+     +F +  ++ R+ + LPPF     +  +G   Q+V N   NL  + 
Sbjct: 598 PEHPLLKTLLEQGYLAFAQEALKMRKVMGLPPFAAQVLLRATGKDNQQVVNLLQNLTAYF 657

Query: 665 PRS------SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ--MYDNTIKRS 716
            +        DI +  P  +P+    G YR+ LLI  +    LQ    Q  +    +   
Sbjct: 658 QQKCTELGLQDIQLLPPFSAPMAKKAGHYRWLLLIQHRSRGVLQQLIDQFDLDKANLGLQ 717

Query: 717 NALRVQFDIDPQ 728
           N +R+  DIDPQ
Sbjct: 718 NNIRLTLDIDPQ 729


>gi|281603329|gb|ADA76313.1| Primosome assembly protein PriA [Shigella flexneri 2002017]
          Length = 756

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 240/721 (33%), Positives = 372/721 (51%), Gaps = 28/721 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  VRVP  + +  +GIV  +  +  ++   +L+ +  V D  P+ +
Sbjct: 40  FDYLLPEGMTVKAGCRVRVPFGKQQERIGIV-VSVSDASELPLTELKAVVEVLDGEPVFT 98

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 99  HSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEQGQAVDLNSLKR 158

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E         N   
Sbjct: 159 SPKQQQALAALRQGKIW--RDQVATLEFNDAALQALRKKGLCDLASETPEFSDWRTNYAV 216

Query: 195 SLPILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           S   L  N +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L+++
Sbjct: 217 SGERLRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALVMV 276

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RSALF PFK
Sbjct: 277 PEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFK 336

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   ++Y
Sbjct: 337 NLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQKKY 396

Query: 374 HSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
             + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  N Q +LFLNRRG
Sbjct: 397 RLLRLTRRAGN-ARPAIQHVLDLKGQKVQAG--LAPALITRMRQHLQANNQVILFLNRRG 453

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++  G
Sbjct: 454 FAPALLCHDCGWIAECPRCDHYYTLHQAQQHLRCHHCDSQRPVPRQCPSCGST-HLVPVG 512

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ + +   FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH+F
Sbjct: 513 LGTEQLEQTLAPLFPDVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHHF 572

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P HP++Q 
Sbjct: 573 PDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQT 632

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE---HAPRSSD 669
           L+    D+F E  +  R  + LPP+     V       Q    +   L+     +P + D
Sbjct: 633 LLYKGYDAFAEQALAERRMMQLPPWTSHVIVRAEDHNNQHAPLFLQQLRNLILSSPLADD 692

Query: 670 -IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDID 726
            + V GP  +      GR+R+++L+       LQ   S      NTI  S  ++   D+D
Sbjct: 693 KLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIISGTLALINTIPDSRKVKWVLDVD 752

Query: 727 P 727
           P
Sbjct: 753 P 753


>gi|30064772|ref|NP_838943.1| primosome assembly protein PriA [Shigella flexneri 2a str. 2457T]
 gi|56480486|ref|NP_709739.2| primosome assembly protein PriA [Shigella flexneri 2a str. 301]
 gi|110807796|ref|YP_691316.1| primosome assembly protein PriA [Shigella flexneri 5 str. 8401]
 gi|30043032|gb|AAP18754.1| primosomal protein N (factor Y), putative helicase [Shigella
           flexneri 2a str. 2457T]
 gi|56384037|gb|AAN45446.2| primosomal protein N (factor Y), putative helicase [Shigella
           flexneri 2a str. 301]
 gi|110617344|gb|ABF06011.1| primosome assembly protein PriA [Shigella flexneri 5 str. 8401]
 gi|313648822|gb|EFS13261.1| primosomal protein N' [Shigella flexneri 2a str. 2457T]
 gi|332751574|gb|EGJ81973.1| primosomal protein N' [Shigella flexneri 4343-70]
 gi|332751846|gb|EGJ82243.1| primosomal protein N' [Shigella flexneri K-671]
 gi|332752555|gb|EGJ82941.1| primosomal protein N' [Shigella flexneri 2747-71]
 gi|332764525|gb|EGJ94757.1| primosomal protein N' [Shigella flexneri 2930-71]
 gi|333013890|gb|EGK33252.1| primosomal protein N' [Shigella flexneri K-304]
          Length = 732

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 240/721 (33%), Positives = 372/721 (51%), Gaps = 28/721 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  VRVP  + +  +GIV  +  +  ++   +L+ +  V D  P+ +
Sbjct: 16  FDYLLPEGMTVKAGCRVRVPFGKQQERIGIV-VSVSDASELPLTELKAVVEVLDGEPVFT 74

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 75  HSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEQGQAVDLNSLKR 134

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E         N   
Sbjct: 135 SPKQQQALAALRQGKIW--RDQVATLEFNDAALQALRKKGLCDLASETPEFSDWRTNYAV 192

Query: 195 SLPILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           S   L  N +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L+++
Sbjct: 193 SGERLRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALVMV 252

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RSALF PFK
Sbjct: 253 PEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFK 312

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   ++Y
Sbjct: 313 NLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQKKY 372

Query: 374 HSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
             + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  N Q +LFLNRRG
Sbjct: 373 RLLRLTRRAGN-ARPAIQHVLDLKGQKVQAG--LAPALITRMRQHLQANNQVILFLNRRG 429

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++  G
Sbjct: 430 FAPALLCHDCGWIAECPRCDHYYTLHQAQQHLRCHHCDSQRPVPRQCPSCGST-HLVPVG 488

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ + +   FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH+F
Sbjct: 489 LGTEQLEQTLAPLFPDVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHHF 548

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P HP++Q 
Sbjct: 549 PDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQT 608

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE---HAPRSSD 669
           L+    D+F E  +  R  + LPP+     V       Q    +   L+     +P + D
Sbjct: 609 LLYKGYDAFAEQALAERRMMQLPPWTSHVIVRAEDHNNQHAPLFLQQLRNLILSSPLADD 668

Query: 670 -IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDID 726
            + V GP  +      GR+R+++L+       LQ   S      NTI  S  ++   D+D
Sbjct: 669 KLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIISGTLALINTIPDSRKVKWVLDVD 728

Query: 727 P 727
           P
Sbjct: 729 P 729


>gi|283787384|ref|YP_003367249.1| primosomal protein replication factor [Citrobacter rodentium
           ICC168]
 gi|282950838|emb|CBG90515.1| primosomal protein replication factor [Citrobacter rodentium
           ICC168]
          Length = 778

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 237/726 (32%), Positives = 376/726 (51%), Gaps = 38/726 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  VRVP  + +  +GIV  +  +K ++   +L+ +  V D  PL S
Sbjct: 62  FDYLLPEGMDVKAGCRVRVPFGKQQERIGIV-VSVSDKSELPLNELKAVVNVLDDEPLFS 120

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W  DY   P+G V    +  L    K          F         +N++ R
Sbjct: 121 SSVWRLLLWATDYYHHPVGDVLFHALPILLRQGKPASNAPMWYWFATEEGQAVDLNSLKR 180

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  RD +     S   +  L+ +G+     E+ S      +   
Sbjct: 181 SPKQQQALAALRQGKIW--RDRLAELDFSDAALQALRKKGLC----ELASETPGFSDWRT 234

Query: 195 SLPILDKNQQDVVEQVVPL-----CTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
              +  +  +   EQ   +         F+  L++GVTGSGKTEVYL ++  VL  GKQ 
Sbjct: 235 GYAVCGERLRLNTEQATAVGAIHSAADQFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQA 294

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           L+++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF
Sbjct: 295 LVMVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLF 354

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
            PFK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N  
Sbjct: 355 TPFKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVR 414

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
            ++Y  + L+ R  N+      V+D++GQ +  G  L+P +I  +R  L  + Q +LFLN
Sbjct: 415 QKKYRMLRLTRRAGNARPAVQHVLDLKGQQVQAG--LAPALIGRMRQHLQADNQVILFLN 472

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+
Sbjct: 473 RRGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPTCGST-HMV 531

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
             G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKG
Sbjct: 532 PVGLGTEQLEQALAPFFPGVPISRIDRDTTSRKGSLEQHLAEVHRGGARILIGTQMLAKG 591

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           H+FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP+
Sbjct: 592 HHFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPL 651

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHA 664
           +Q L+    D+F E  +  R+++ LPP+   + VI+    +       +     NL + +
Sbjct: 652 LQTLLHKGYDAFAEQALAERQTMQLPPW--TSHVIVRAEDHNNQLAPLFLQQLRNLIQAS 709

Query: 665 PRSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRV 721
           P + D + V GP  +      GRYR+++L+       LQ   S      NT+  +  ++ 
Sbjct: 710 PLADDKLWVLGPVPALAPKRGGRYRWQILLQHPSRIRLQHIVSGTLTLINTLPDARKVKW 769

Query: 722 QFDIDP 727
             D+DP
Sbjct: 770 VLDVDP 775


>gi|168237723|ref|ZP_02662781.1| putative primosomal protein N' [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194737086|ref|YP_002117016.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194712588|gb|ACF91809.1| primosomal protein N' [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197289431|gb|EDY28796.1| putative primosomal protein N' [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 732

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 241/725 (33%), Positives = 381/725 (52%), Gaps = 36/725 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEE-KYKIDSLKLRPIEYVFDCPPLS 85
           + Y +P     + G  VRVP  + +  +GIV   S+  +  +D LK   IE + + P  S
Sbjct: 16  FDYLLPEGEVAKAGCRVRVPFGKQQERVGIVVSVSDHSELPLDELK-SVIEILDNEPIFS 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W ADY   P+G V    +  L    K          F         IN++ R
Sbjct: 75  PSIWRLLLWAADYYHHPLGDVLFHALPVLLRQGKPASNAPLWYWFATEEGQAADINSLKR 134

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +     +   +  L+ +G+ +   E  +P       ++
Sbjct: 135 SAKQQQALAALRQGKIW--RYQVAELDFTDATLQTLRRKGLCELASE--TPAFTDWREHY 190

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   + GF+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AVAGERLRLNTEQATAVGAIHSASDGFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +Y  + L+ R  N A P LQ V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNR
Sbjct: 371 KYRMLRLTRRAGN-ARPALQHVLDLKGQRLQAG--LAPALIARMRQHLQADNQVILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+ 
Sbjct: 428 RGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGST-HMLP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH
Sbjct: 487 VGLGTEQLEQVLAPFFPGVPISRIDRDTTSRKGALEQHLAEVHRGGARILIGTQMLAKGH 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 547 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLL 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P
Sbjct: 607 QTLLYKGYDAFAEQALAERQTLQLPPW--TSHVIIRAEDHNNQQAPVFLQQLRNLIQASP 664

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            S D + + GP  +      GRYR+++L+       LQ   S      NT+  +  ++  
Sbjct: 665 LSDDKLWILGPVPALAPKRGGRYRWQILLQHPSRIRLQHIISGTLALINTLPEARKVKWV 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|323174326|gb|EFZ59952.1| primosomal protein N' [Escherichia coli LT-68]
          Length = 732

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 239/721 (33%), Positives = 373/721 (51%), Gaps = 28/721 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  VRVP  + +  +GIV  +  +  ++   +L+ +  V D  P+ +
Sbjct: 16  FDYLLPEGMTVKAGCRVRVPFGKQQERIGIV-VSVSDASELPLNELKAVVEVLDSEPVFT 74

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 75  HSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEQGQAVDLNSLKR 134

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E         N   
Sbjct: 135 SPKQQQALAALRQGKIW--RDQVAELEFNDAALQALRKKGLCDLASETPEFSDWRTNYAV 192

Query: 195 SLPILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           S   L  N +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L+++
Sbjct: 193 SGERLRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALVMV 252

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RSALF PFK
Sbjct: 253 PEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFK 312

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   ++Y
Sbjct: 313 NLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQKKY 372

Query: 374 HSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
             + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  N Q +LFLNRRG
Sbjct: 373 RLLRLTRRAGN-ARPAIQHVLDLKGQKVQSG--LAPALITRMRQHLQANNQVILFLNRRG 429

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++  G
Sbjct: 430 FAPALLCHDCGWIAECPRCDHYYTLHQAQQHLRCHHCDSQRPVPRQCPSCGST-HLVPVG 488

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ + +   FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH+F
Sbjct: 489 LGTEQLEQTLAPLFPGVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHHF 548

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P HP++Q 
Sbjct: 549 PDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQT 608

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE---HAPRSSD 669
           L+    D+F E  +  R  + LPP+     V       Q    +   L+     +P + D
Sbjct: 609 LLYKGYDAFAEQALAERRMMQLPPWTSHVIVRAEDHNNQHAPLFLQQLRNLILSSPLADD 668

Query: 670 -IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDID 726
            + V GP  +      GR+R+++L+      +LQ   +      NTI  S  ++   D+D
Sbjct: 669 KLWVLGPVPALAPKRGGRWRWQILLQHPSRVHLQHIINGTLALINTIPDSRKVKWVLDVD 728

Query: 727 P 727
           P
Sbjct: 729 P 729


>gi|149911775|ref|ZP_01900380.1| primosome assembly protein PriA [Moritella sp. PE36]
 gi|149805163|gb|EDM65184.1| primosome assembly protein PriA [Moritella sp. PE36]
          Length = 714

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 229/705 (32%), Positives = 365/705 (51%), Gaps = 38/705 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPP-LSR 86
           YIY  P    ++ G  + VP  ++ ++GI      +  +    KL+PI  V D    LS 
Sbjct: 18  YIY--PDDAHIQPGMRICVPFMNKQLIGIALATKNDS-EFPLAKLKPIINVLDENAILSA 74

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRIN------------ 134
            M  F  W ADY   P+G V    +  L    K+E     +  F ++             
Sbjct: 75  DMLAFFNWCADYYHYPIGEVIAQALPVL--LRKLESAKLNSYTFWQLTDSAHDLTAQELN 132

Query: 135 --TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNL 192
             T A+L+ +  + +  + +    ++ + + S  I  L+ +G+I Q +  I    D+ + 
Sbjct: 133 RLTPAQLQTIKLLAETGLTQSH--LKLANIKSTTIKALQDKGLISQEYIKIQDN-DAQHW 189

Query: 193 YFSLPILDKNQQDVVEQVVPLCT---KGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQV 249
             +L I D       EQ + +       FA  L+ GVTGSGKTEVYL ++  VL  G+Q 
Sbjct: 190 RQNLVISDNRPTLNTEQAITIAAIDINHFATYLLDGVTGSGKTEVYLNVIEKVLKTGRQA 249

Query: 250 LILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALF 309
           L+L+PEI LT   + RF++RF V     HS L+ + R + W +   G   +++G RSA+F
Sbjct: 250 LVLVPEIGLTPQTISRFKRRFNVPIVALHSGLNDAERREAWLEAQAGVAGIVIGTRSAIF 309

Query: 310 LPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGI 369
            P   LG+I+IDEEHD S KQ+E   Y+ARD++IVR +  +  VVL SATP++E+  N +
Sbjct: 310 TPMHDLGVIIIDEEHDGSLKQQETFRYHARDLAIVRAQRNNIAVVLGSATPALETLHNAM 369

Query: 370 SRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
           + +Y  + L+ R  N+ +P   +ID++ Q++  G  LS E +  +   LA   Q LLFLN
Sbjct: 370 TGKYRHLRLTQRAGNAQMPTHHLIDIKNQSLDSG--LSAEFMALMATHLAAGNQVLLFLN 427

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRGYAP  +C  CG+  +C  C+ +   H+S+  L+CH C       + C  C S+  M 
Sbjct: 428 RRGYAPAVMCHTCGSMAECQRCNTYYTYHQSRNVLHCHHCDEQFPKPRRCPSCNSNEIMT 487

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
           A GFG E++   +  +FP   I  +  D     G L+  L A+ K E  I+IGTQ++AKG
Sbjct: 488 A-GFGTEQLEAMLNNHFPQYPIIRIDRDSTSRKGSLEKSLEAVRKREFRILIGTQMLAKG 546

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           H+FP ++LVG++D D  L ++D R+ E+  QL  QV+GRAGR   +    IQ + P H +
Sbjct: 547 HHFPDVTLVGLIDVDSALFSSDFRAPEKLAQLFVQVSGRAGRATKQGEVAIQTHHPEHEL 606

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE------H 663
           +Q L++     F ++ + AR   NLPP+   A       ++ +   +   +K+      H
Sbjct: 607 IQDLINNGYSHFAQTALHARSMANLPPYSFQALFRAEAHQFSDANAFLVEIKQLVQAHNH 666

Query: 664 APRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQM 708
            P+   ++  GP  +P+    G+YR +LL+   +  ++     Q+
Sbjct: 667 NPQ---LLCLGPMPAPMEKRAGKYRLQLLLQSPQRQHITHLLRQI 708


>gi|168821550|ref|ZP_02833550.1| primosomal protein N' [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205341873|gb|EDZ28637.1| primosomal protein N' [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|320088506|emb|CBY98265.1| Primosomal protein N' ATP-dependent helicase priA; Replication
           factor Y [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 732

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 241/725 (33%), Positives = 381/725 (52%), Gaps = 36/725 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEE-KYKIDSLKLRPIEYVFDCPPLS 85
           + Y +P     + G  VRVP  + +  +GIV   S+  +  +D LK   IE + + P  S
Sbjct: 16  FDYLLPEGGVAKAGCRVRVPFGKQQERVGIVVSVSDHSELPLDELK-SVIEILDNEPIFS 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W ADY   P+G V    +  L    K          F         IN++ R
Sbjct: 75  PSIWRLLLWAADYYHHPLGDVLFHALPVLLRQGKPASNAPLWYWFATEEGQAVDINSLKR 134

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +     +   +  L+ +G+ +   E  +P       ++
Sbjct: 135 SAKQQQALAALRQGKIW--RYQVTELDFTDATLQTLRRKGLCELASE--TPAFTDWREHY 190

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   + GF+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AVAGERLRLNTEQATAVGAIHSASDGFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +Y  + L+ R  N A P LQ V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNR
Sbjct: 371 KYRMLRLTRRAGN-ARPALQHVLDLKGQRLQAG--LAPALIARMRQHLQADNQVILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+ 
Sbjct: 428 RGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGST-HMLP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH
Sbjct: 487 VGLGTEQLEQVLAPFFPGVPISRIDRDTTSRKGALEQHLAEVHRGGARILIGTQMLAKGH 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 547 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLL 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P
Sbjct: 607 QTLLYKGYDAFAEQALAERQTLQLPPW--TSHVIIRAEDHNNQQAPVFLQQLRNLIQASP 664

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            S D + + GP  +      GRYR+++L+       LQ   S      NT+  +  ++  
Sbjct: 665 LSDDKLWILGPVPALAPKRGGRYRWQILLQHPSRIRLQHIISGTLALINTLPEARKVKWV 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|329894769|ref|ZP_08270570.1| Helicase PriA essential for oriC/DnaA-independent DNA replication
           [gamma proteobacterium IMCC3088]
 gi|328922758|gb|EGG30091.1| Helicase PriA essential for oriC/DnaA-independent DNA replication
           [gamma proteobacterium IMCC3088]
          Length = 730

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 245/718 (34%), Positives = 367/718 (51%), Gaps = 35/718 (4%)

Query: 34  SAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPLS---RQMCE 90
           S  K++ G+ + VP     ++GI+  N   + +++  KL+    + D  P+S   + + E
Sbjct: 28  SIAKLQPGTRIEVPFGRAQLVGIL-VNRAPESEVNQTKLKRATRIID--PISLLPKPLFE 84

Query: 91  FVKWVADYTFSPMGLVARMVVSAL----SETEKMEEKIQFTGIFPRINTVARLRVLDKIK 146
              W + Y   P+G V  +    L     ET      I+ T   P    +A   +L   K
Sbjct: 85  LCLWASQYYAHPIGEVLTLAFPPLLRKGVETNAPHNAIKLT---PE-GRLAPQGILRSPK 140

Query: 147 DGKIWEK-------RDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLPIL 199
              + E+       R  ++A   SS +I  L  +G+   I   I     SP+     P L
Sbjct: 141 QAALIERLQRHEATRSALKAEGFSSSIIKALIDKGLA--IPCRIEDSEFSPSESDPQPRL 198

Query: 200 DKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLT 259
           +  QQ  V Q+      GF  SL+ G+TGSGKTEVYL+ +A  +  G Q ++L+PEI+LT
Sbjct: 199 NSQQQFAVAQLSQ--HAGFKASLLYGITGSGKTEVYLQTIANTIASGAQAMVLVPEIALT 256

Query: 260 SAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIV 319
                RFQ RFG      HS L+ + R + W +   G + V++G RSALF PF+ LGLIV
Sbjct: 257 PQTAARFQGRFGACVGVLHSGLTETQRAREWERARTGKLQVLLGTRSALFTPFQNLGLIV 316

Query: 320 IDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLS 379
           +DEEHD +YKQ++G  Y+ARD+++ R +IE  P++L SATPS+E+  N    R+    L+
Sbjct: 317 VDEEHDSAYKQQDGFRYHARDLAVKRAQIEQCPIILGSATPSLETISNVNIGRFEQYTLN 376

Query: 380 TRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLC 439
           TR + ++LP  Q+ID+R Q++  G  LS  +ID   HTL + EQ LLFLNRRG+A   LC
Sbjct: 377 TRAKAASLPSWQIIDVRQQSLEAG--LSQTLIDACHHTLGKGEQALLFLNRRGFAHTLLC 434

Query: 440 QVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIA 499
             CG   +C +C   +V H+   +L CH C       ++C  C  S      G+G ER  
Sbjct: 435 HDCGWVAECDNCDSRMVIHKRHNRLRCHHCQAQKPLPKTCPSC-HSNHWQGVGYGTERAE 493

Query: 500 EEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEID-IIIGTQLVAKGHNFPRMSLV 558
             +   FP   I  + SD  G   +L   L AI   +   +I+GTQ++AKGH+  +++LV
Sbjct: 494 LALQSLFPHTPIHRIDSDTVGSASQLDHVLDAINANQTGCLILGTQMLAKGHDLAKVTLV 553

Query: 559 GVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDA 618
           G+VD D  L ++D R+ ER  QLL+QV+GR+GR       ++Q + P   +   ++  D 
Sbjct: 554 GIVDTDALLFSSDFRAEERLGQLLTQVSGRSGRGDRPGTVMLQTHHPDAEIFHQVIHQDY 613

Query: 619 DSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRSS---DIVVFGP 675
                S + AR    LPPFG++  V        E E +  N   H   SS   + V+ GP
Sbjct: 614 RETASSLLHARHQTGLPPFGQIVMVHADSKDPSEAERF-LNSARHTLTSSLPQNHVLIGP 672

Query: 676 AESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIK--RSNALRVQFDIDPQNFL 731
             +PL    G++R++L        NL  F   + D   +    + L    DIDP +FL
Sbjct: 673 LPAPLSKRAGKFRYQLTWLAPHEKNLHRFVHSIADTLTRLPHKSELSWAIDIDPHDFL 730


>gi|224585906|ref|YP_002639705.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224470434|gb|ACN48264.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
          Length = 732

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 241/725 (33%), Positives = 382/725 (52%), Gaps = 36/725 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEE-KYKIDSLKLRPIEYVFDCPPLS 85
           + Y +P     + G  VRVP  + +  +GIV   S+  +  +D LK   IE + + P +S
Sbjct: 16  FDYLLPEGGVAKAGCRVRVPFGKQQERVGIVVSVSDHSELPLDELK-SVIEILDNEPIVS 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W ADY   P+G V    +  L    K          F         IN++ R
Sbjct: 75  PSIWRLLLWAADYYHHPLGDVLFHALPVLLRQGKPASNAPLWYWFATEEGQAVDINSLKR 134

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +     +   +  L+ +G+ +   E  +P        +
Sbjct: 135 SAKQQQALAALRQGKIW--RYQVAELDFTDATLQTLRRKGLCELASE--TPAFTDWRERY 190

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   + GF+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AVAGERLRLNTEQATAVGAIHSASDGFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +Y  + L+ R  N A P LQ V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNR
Sbjct: 371 KYRMLRLTRRAGN-ARPALQHVLDLKGQRLQAG--LAPALIARMRQHLQADNQVILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C+ CGS+  M+ 
Sbjct: 428 RGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCLSCGST-HMLP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH
Sbjct: 487 VGLGTEQLEQVLAPFFPGVPISRIDRDTTSRKGALEQHLAEVHRGGARILIGTQMLAKGH 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 547 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLL 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P
Sbjct: 607 QTLLYKGYDAFAEQALAERQTLQLPPW--TSHVIIRAEDHNNQQAPVFLQQLRNLIQASP 664

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            S D + + GP  +      GRYR+++L+       LQ   S      NT+  +  ++  
Sbjct: 665 LSDDKLWILGPVPALAPKRGGRYRWQILLQHPSRIRLQHIISGTLALINTLPEARKVKWV 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|161617232|ref|YP_001591197.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167551407|ref|ZP_02345162.1| primosomal protein N' [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|238912241|ref|ZP_04656078.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|161366596|gb|ABX70364.1| hypothetical protein SPAB_05073 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205323747|gb|EDZ11586.1| primosomal protein N' [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
          Length = 732

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 241/725 (33%), Positives = 381/725 (52%), Gaps = 36/725 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEE-KYKIDSLKLRPIEYVFDCPPLS 85
           + Y +P     + G  VRVP  + +  +GIV   S+  +  +D LK   IE + + P  S
Sbjct: 16  FDYLLPEGGVAKAGCRVRVPFGKQQERVGIVVSVSDHSELPLDELK-SVIEILDNEPIFS 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W ADY   P+G V    +  L    K          F         IN++ R
Sbjct: 75  PSIWRLLLWAADYYHHPLGDVLFHALPVLLRQGKPASNAPLWYWFATEEGQAVDINSLKR 134

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +     +   +  L+ +G+ +   E  +P       ++
Sbjct: 135 SAKQQQALAALRQGKIW--RYQVAELDFTDATLQTLRRKGLCELASE--TPAFTDWREHY 190

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   + GF+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AVAGERLRLNTEQATAVGAIHSASDGFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +Y  + L+ R  N A P LQ V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNR
Sbjct: 371 KYRMLRLTRRAGN-ARPALQHVLDLKGQRLQAG--LAPALIARMRQHLQADNQVILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+ 
Sbjct: 428 RGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGST-HMLP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH
Sbjct: 487 VGLGTEQLEQVLAPFFPGVPISRIDRDTTSRKGALEQHLAEVHRGGARILIGTQMLAKGH 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 547 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLL 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P
Sbjct: 607 QTLLYKGYDAFAEQALAERQTLQLPPW--TSHVIIRAEDHNNQQAPVFLQQLRNLIQASP 664

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            S D + + GP  +      GRYR+++L+       LQ   S      NT+  +  ++  
Sbjct: 665 LSDDKLWILGPVPALAPKRGGRYRWQILLQHPSRIRLQHIISGTLALINTLPEARKVKWV 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|260857664|ref|YP_003231555.1| primosome factor n' [Escherichia coli O26:H11 str. 11368]
 gi|260870654|ref|YP_003237056.1| primosome factor n' [Escherichia coli O111:H- str. 11128]
 gi|257756313|dbj|BAI27815.1| primosome factor n' [Escherichia coli O26:H11 str. 11368]
 gi|257767010|dbj|BAI38505.1| primosome factor n' [Escherichia coli O111:H- str. 11128]
 gi|323153988|gb|EFZ40197.1| primosomal protein N' [Escherichia coli EPECa14]
 gi|323177957|gb|EFZ63541.1| primosomal protein N' [Escherichia coli 1180]
          Length = 732

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 240/721 (33%), Positives = 372/721 (51%), Gaps = 28/721 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  VRVP  + +  +GIV  +  +  ++   +L+ +  V D  P+ +
Sbjct: 16  FDYLLPEGMTVKAGCRVRVPFGKQQERIGIV-VSVSDASELPLNELKAVVEVLDVEPVFT 74

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 75  HSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEQGQAVDLNSLKR 134

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E         N   
Sbjct: 135 SPKQQQALAALRQGKIW--RDQVAELEFNDAALQALRKKGLCDLASETPEFSDWRTNYAV 192

Query: 195 SLPILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           S   L  N +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L+++
Sbjct: 193 SGERLRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALVMV 252

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RSALF PFK
Sbjct: 253 PEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFK 312

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   ++Y
Sbjct: 313 NLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQKKY 372

Query: 374 HSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
             + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  N Q +LFLNRRG
Sbjct: 373 RLLRLTRRAGN-ARPAIQHVLDLKGQKVQAG--LAPALITRMRQHLQANNQVILFLNRRG 429

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++  G
Sbjct: 430 FAPALLCHDCGWIAECPRCDHYYTLHQAQQHLRCHHCDSQRPVPRQCPSCGST-HLVPVG 488

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ + +   FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH+F
Sbjct: 489 LGTEQLEQTLAPMFPGVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHHF 548

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P HP++Q 
Sbjct: 549 PDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQT 608

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE---HAPRSSD 669
           L+    D+F E  +  R  + LPP+     V       Q    +   L+     +P + D
Sbjct: 609 LLYKGYDAFAEQALAERRMMQLPPWTSHVIVRAEDHNNQHAPLFLQQLRNLILSSPLADD 668

Query: 670 -IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDID 726
            + V GP  +      GR+R+++L+       LQ   S      NTI  S  ++   D+D
Sbjct: 669 KLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIISGTLALINTIPDSRKVKWVLDVD 728

Query: 727 P 727
           P
Sbjct: 729 P 729


>gi|187732612|ref|YP_001882631.1| primosome assembly protein PriA [Shigella boydii CDC 3083-94]
 gi|187429604|gb|ACD08878.1| primosomal protein N' [Shigella boydii CDC 3083-94]
          Length = 732

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 239/721 (33%), Positives = 374/721 (51%), Gaps = 28/721 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  VRVP  + +  +G+V  +  +  ++   +L+ +  V D  P+ +
Sbjct: 16  FDYLLPEGMTVKAGCRVRVPFGKQQERIGVV-VSVSDVSELPLNELKAVVEVLDVEPVFT 74

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 75  HSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEQGQAVDLNSLKR 134

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E         N   
Sbjct: 135 SPKQQQALAALRQGKIW--RDQVATLEFNDAALQALRKKGLCDLASETPEFSDWRTNYAV 192

Query: 195 SLPILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           S   L  N +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L+++
Sbjct: 193 SGERLRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALVMV 252

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RSALF PFK
Sbjct: 253 PEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFK 312

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   ++Y
Sbjct: 313 NLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQKKY 372

Query: 374 HSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
             + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  N Q +LFLNRRG
Sbjct: 373 RLLRLTRRAGN-ARPAIQHVLDLKGQKVQAG--LAPALITRMRQHLQANNQVILFLNRRG 429

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +AP  LC  CG   +C  C  +   H++++ L+CH C       + C  CGS+  ++  G
Sbjct: 430 FAPALLCHDCGWIAECPRCDHYYTLHQAQQHLHCHHCDSQRPVPRQCPSCGST-HLVPVG 488

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ + +   FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH+F
Sbjct: 489 LGTEQLEQTLAPMFPGVPISRIDRDTTSRKGALEQQLAKVHRGGARILIGTQMLAKGHHF 548

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q Y P HP++Q 
Sbjct: 549 PDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTYHPEHPLLQT 608

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE---HAPRSSD 669
           L+    D+F E  +  R  + LPP+     V +     Q    +   L+     +P + D
Sbjct: 609 LLYKGYDAFAEQALAERRMMQLPPWTSHVIVRVEDHNNQHAPLFLQQLRNLILSSPLADD 668

Query: 670 -IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDID 726
            + + GP  +      GR+R+++L+       LQ   S      NTI  S  ++   D+D
Sbjct: 669 KLWILGPVPALAPKRGGRWRWQILLQHPSRVRLQHIISGTLALINTIPDSRKVKWVLDVD 728

Query: 727 P 727
           P
Sbjct: 729 P 729


>gi|56415939|ref|YP_153014.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364866|ref|YP_002144503.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56130196|gb|AAV79702.1| primosomal protein replication factor [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197096343|emb|CAR61947.1| primosomal protein replication factor [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 732

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 241/725 (33%), Positives = 381/725 (52%), Gaps = 36/725 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEE-KYKIDSLKLRPIEYVFDCPPLS 85
           + Y +P     + G  VRVP  + +  +GIV   S+  +  +D LK   IE + + P  S
Sbjct: 16  FDYLLPEGGVAKAGCRVRVPFGKQQERVGIVVSVSDHSELPLDELK-SVIEILDNEPIFS 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W ADY   P+G V    +  L    K          F         IN++ R
Sbjct: 75  PSIWRLLLWAADYYHHPLGDVLFHALPVLLRQGKPASNAPLWYWFATEEGQAVDINSLKR 134

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +     +   +  L+ +G+ +   E  +P       ++
Sbjct: 135 SAKQQQALAALRQGKIW--RYQVAELDFTDATLQTLRRKGLCELASE--TPAFTDWREHY 190

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   + GF+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AVAGERLRLNTEQATAVGAIHSASDGFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDRSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +Y  + L+ R  N A P LQ V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNR
Sbjct: 371 KYRMLRLTRRAGN-ARPALQHVLDLKGQRLQAG--LAPALIARMRQHLQADNQVILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+ 
Sbjct: 428 RGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGST-HMLP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH
Sbjct: 487 VGLGTEQLEQVLAPFFPGVPISRIDRDTTSRKGALEQHLAEVHRGGARILIGTQMLAKGH 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 547 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLL 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P
Sbjct: 607 QTLLYKGYDAFAEQALAERQTLQLPPW--TSHVIIRAEDHNNQQAPVFLQQLRNLIQASP 664

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            S D + + GP  +      GRYR+++L+       LQ   S      NT+  +  ++  
Sbjct: 665 LSDDKLWILGPVPALAPKRGGRYRWQILLQHPSRIRLQHIISGTLALINTLPEARKVKWV 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|332998547|gb|EGK18144.1| primosomal protein N' [Shigella flexneri K-218]
          Length = 732

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 239/721 (33%), Positives = 372/721 (51%), Gaps = 28/721 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  +RVP  + +  +GIV  +  +  ++   +L+ +  V D  P+ +
Sbjct: 16  FDYLLPEGMTVKAGCRMRVPFGKQQERIGIV-VSVSDASELPLTELKAVVEVLDGEPVFT 74

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 75  HSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEQGQAVDLNSLKR 134

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E         N   
Sbjct: 135 SPKQQQALAALRQGKIW--RDQVATLEFNDAALQALRKKGLCDLASETPEFSDWRTNYAV 192

Query: 195 SLPILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           S   L  N +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L+++
Sbjct: 193 SGERLRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALVMV 252

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RSALF PFK
Sbjct: 253 PEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFK 312

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   ++Y
Sbjct: 313 NLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQKKY 372

Query: 374 HSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
             + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  N Q +LFLNRRG
Sbjct: 373 RLLRLTRRAGN-ARPAIQHVLDLKGQKVQAG--LAPALITRMRQHLQANNQVILFLNRRG 429

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++  G
Sbjct: 430 FAPALLCHDCGWIAECPRCDHYYTLHQAQQHLRCHHCDSQRPVPRQCPSCGST-HLVPVG 488

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ + +   FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH+F
Sbjct: 489 LGTEQLEQTLAPLFPDVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHHF 548

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P HP++Q 
Sbjct: 549 PDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQT 608

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE---HAPRSSD 669
           L+    D+F E  +  R  + LPP+     V       Q    +   L+     +P + D
Sbjct: 609 LLYKGYDAFAEQALAERRMMQLPPWTSHVIVRAEDHNNQHAPLFLQQLRNLILSSPLADD 668

Query: 670 -IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDID 726
            + V GP  +      GR+R+++L+       LQ   S      NTI  S  ++   D+D
Sbjct: 669 KLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIISGTLALINTIPDSRKVKWVLDVD 728

Query: 727 P 727
           P
Sbjct: 729 P 729


>gi|205354329|ref|YP_002228130.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205274110|emb|CAR39119.1| primosomal protein replication factor [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|326629454|gb|EGE35797.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 732

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 240/725 (33%), Positives = 381/725 (52%), Gaps = 36/725 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEE-KYKIDSLKLRPIEYVFDCPPLS 85
           + Y +P     + G  VRVP  + +  +GIV   S+  +  +D LK   I+ + + P  S
Sbjct: 16  FDYLLPEGGVAKAGCRVRVPFGKQQERVGIVVSVSDHSELPLDELK-SVIDILDNEPIFS 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W ADY   P+G V    +  L    K          F         IN++ R
Sbjct: 75  PSIWRLLLWAADYYHPPLGDVLFHALPVLLRQGKPASNAPLWYWFATEEGQAVDINSLKR 134

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +     +   +  L+ +G+ +   E  +P       ++
Sbjct: 135 SAKQQQALAALRQGKIW--RYQVAELDFTDATLQTLRRKGLCELASE--APAFTDWREHY 190

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   + GF+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AIAGERLRLNTEQATAVGAIHSASDGFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPVEVMHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +Y  + L+ R  N A P LQ V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNR
Sbjct: 371 KYRMLRLTRRAGN-ARPALQHVLDLKGQRLQAG--LAPALIARMRQHLQADNQVILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+ 
Sbjct: 428 RGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGST-HMLP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH
Sbjct: 487 VGLGTEQLEQVLAPFFPGVPISRIDRDTTSRKGALEQHLAEVHRGGARILIGTQMLAKGH 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 547 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLL 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P
Sbjct: 607 QTLLYKGYDAFAEQALAERQTLQLPPW--TSHVIIRAEDHNNQQAPVFLQQLRNLIQASP 664

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            S D + + GP  +      GRYR+++L+       LQ   S      NT+  +  ++  
Sbjct: 665 LSDDKLWILGPVPALAPKRGGRYRWQILLQHPSRIRLQHIISGTLALINTLPEARKVKWV 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|32033953|ref|ZP_00134209.1| COG1198: Primosomal protein N' (replication factor Y) - superfamily
           II helicase [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|126208506|ref|YP_001053731.1| primosome assembly protein PriA [Actinobacillus pleuropneumoniae
           L20]
 gi|126097298|gb|ABN74126.1| primosomal protein N' [Actinobacillus pleuropneumoniae serovar 5b
           str. L20]
          Length = 738

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 241/732 (32%), Positives = 387/732 (52%), Gaps = 44/732 (6%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P  +    G  V VP  ++T +G+V  +  E   +   KL+PI+ V D  P+   
Sbjct: 17  FDYLLPPFLSAVKGVRVEVPFGNQTKIGVV-VDFPETSDVPEDKLKPIKAVLDLEPIFDE 75

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQ---FTGIFPRINTVARLRVLD 143
           ++   ++W A Y  +P+G VA   +          E+ Q   FT     +    R  +L 
Sbjct: 76  EIWTLLRWAARYYHAPIGEVAINALPVKLRNGDSTERSQPDYFT-----VTEAGRAALLS 130

Query: 144 KIKDGKIWEKRDLI-----------RASQVSSHVIDGLKAQGVIKQIFEVISP------V 186
             ++ +  +++DL+           + +  S     GL  +  I+ +     P      +
Sbjct: 131 G-ENKRAKKQQDLLEKLAEIASFFEKPTACSQSAWKGLLEKNYIEPVNVPFEPQHWQKKL 189

Query: 187 VDSP--NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
            + P  NL+  L +L+K Q  VV ++      GF   L++GVTGSGKTEVYL+++  VL 
Sbjct: 190 QNRPLVNLHNRL-VLNKQQSLVVSRLT--VQNGFEAFLLNGVTGSGKTEVYLQVIEEVLK 246

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            G+QVL+L+PEI LT   ++RF+ RF V+    HS+++ + R   W +   G  ++++G 
Sbjct: 247 RGEQVLVLVPEIGLTPQTVQRFKARFNVEIDVLHSNMNETERLNAWLRAKNGESAIVIGT 306

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALF  F+KLGLI+IDEEHD S+KQ++G  Y+ARD++I+R K    P++L SATPS+ES
Sbjct: 307 RSALFSQFEKLGLIIIDEEHDSSFKQQDGWRYHARDLAILRAKNLHIPIILGSATPSLES 366

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
             N  + ++  + L+ R  N+     Q+ID++ Q I  G  LS  ++  ++  L +  Q 
Sbjct: 367 VQNVQNGKFIELSLTARAGNAQQAKQQLIDLKTQRITAG--LSDRLLAMMKRHLEQGNQV 424

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           +LFLNRRG+AP+ LC  CG   +C  C      H+ +K L CH C    +  + C  CGS
Sbjct: 425 VLFLNRRGFAPVLLCHECGWMCECDACEKPYTYHQKQKILRCHHCASQRVIPRQCGHCGS 484

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
           +  +I  G G E++ + + E FP  +IS +  D     G L+  L+ I +G+  I+IGTQ
Sbjct: 485 TN-LITTGVGTEQLEQVLSEQFPTYQISRIDRDSTARKGALENHLNDIREGKSQILIGTQ 543

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+FP ++LV +V+ D  L + D R+ ER  QL  QV GRAGR   +   ++Q + 
Sbjct: 544 MLAKGHHFPNVTLVAIVNVDSALFSTDFRAEERLAQLYVQVAGRAGRAEKQGEVVLQTHY 603

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P HP+++ L+     +F +  ++ R+ + LPPF     +  +G   Q+V N   NL  + 
Sbjct: 604 PEHPLLKTLLEQGYLAFAQEALKMRKVMGLPPFAAQVLLRATGKDNQQVVNLLQNLTAYF 663

Query: 665 PRS------SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ--MYDNTIKRS 716
            +        DI +  P  +P+    G YR+ LLI  +    LQ    Q  +    +   
Sbjct: 664 QQKCTELGLQDIQLLPPFSAPMAKKAGHYRWLLLIQHRSRGVLQQLIDQFDLDKANLGLQ 723

Query: 717 NALRVQFDIDPQ 728
           N +R+  DIDPQ
Sbjct: 724 NNIRLTLDIDPQ 735


>gi|315178880|gb|ADT85794.1| primosome assembly protein PriA [Vibrio furnissii NCTC 11218]
          Length = 733

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 236/733 (32%), Positives = 383/733 (52%), Gaps = 48/733 (6%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P+ +   +G  V VP   +T++G+V   ++E       +L+ I+ V D  P+   
Sbjct: 18  FDYLIPNHLFPIIGGRVSVPFGRQTLVGVVTALAQES-AFPREQLKAIKAVLDSQPVWPE 76

Query: 87  QMCEFVKWVADYTFSPMG-LVARMVVSAL----------SETEKMEEK--IQFTGIFPRI 133
            +   ++W + +   P+G  +A  + SAL          S+   M E+   Q    F R 
Sbjct: 77  TLYRLLQWCSQFYQYPLGDTLANAMPSALRKGKPADFASSKEWHMTERGRDQLMQGFGR- 135

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVI---------KQIFEVIS 184
             V + +V+  ++ G +     ++   +VSS  ++ L+ +G I         +   +V+ 
Sbjct: 136 -AVKQAQVMHLLEPGPV--AHQIMLDEEVSSATLNTLQDKGWIEVTEKQPQFRPWPKVVE 192

Query: 185 PVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
             VD P L         NQ+  +        +GF   L+ GVTGSGKTEVYL ++  VL 
Sbjct: 193 ADVDKPKL---------NQEQAIAIASVNSQRGFGCYLLHGVTGSGKTEVYLNLIKPVLE 243

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            GKQ L+L+PEI LT   + RF+KRF V     HS L+ + R   W         +++G 
Sbjct: 244 AGKQALVLVPEIGLTPQTINRFRKRFTVPVEVIHSGLNDTERLNAWLAARDKVAGIVIGT 303

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSAL  PF  LG+I++DEEHD SYKQ++ + Y+ARD++++R  +E  P+VL SATP++E+
Sbjct: 304 RSALLTPFADLGIIIVDEEHDASYKQQDSLRYHARDVAVMRANLEQVPIVLGSATPALET 363

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHL-QVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQ 423
             N ++ +YH + L+ R   +ALP   +V+D++G  +  G  LS  +I  +R  L++  Q
Sbjct: 364 LHNALTGKYHHLQLTQRA-GTALPTTNRVLDVKGLYLESG--LSAPLIAEMRRHLSQGNQ 420

Query: 424 TLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCG 483
            LLFLNRRG++P  +C  CG    C  C  +   H+   ++ CH CG        C  CG
Sbjct: 421 VLLFLNRRGFSPALMCHECGWIANCQRCDAYYTYHQHSSEIRCHHCGSQRPVIHQCQGCG 480

Query: 484 SSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGT 543
           S+  ++  G G E++  ++ E FP  +   +  D     G L+  L AI +GE  I+IGT
Sbjct: 481 ST-HLVTVGVGTEQLEAQLSELFPEYKAIRIDRDSTRRKGSLESALGAIRRGEYQILIGT 539

Query: 544 QLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAY 603
           Q++AKGH+FP ++LV ++D D  L ++D R+SER  QL  QV GRAGR       ++Q +
Sbjct: 540 QMLAKGHHFPDVTLVALLDVDGSLYSSDFRASERLAQLFIQVAGRAGRASKPGEVVLQTH 599

Query: 604 QPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENY----AYN 659
            P H ++QAL+  D + F E+ +  R+   LPP+  L      G + Q VE++     + 
Sbjct: 600 HPEHTLLQALLHNDYNQFAETALAERKLAQLPPYTYLTLFRAEGNQSQPVEDFLRQVRHT 659

Query: 660 LKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSN 717
           L+ H       +V GP  +PL    G++R++LL+     S +Q   +        +  ++
Sbjct: 660 LEAHPLCEQGCLVLGPTPAPLAKRAGKFRWQLLLQAPSRSVMQKLLASAKPAIQLLPLAS 719

Query: 718 ALRVQFDIDPQNF 730
            +R   DI+PQ+ 
Sbjct: 720 KVRWSLDIEPQDL 732


>gi|170769654|ref|ZP_02904107.1| primosomal protein N' [Escherichia albertii TW07627]
 gi|170121462|gb|EDS90393.1| primosomal protein N' [Escherichia albertii TW07627]
          Length = 732

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 241/724 (33%), Positives = 371/724 (51%), Gaps = 34/724 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDC----P 82
           + Y +P  M V+ G  VRVP  + +  +GIV   S+    +  L L  ++ V D     P
Sbjct: 16  FDYLLPEGMTVKAGCRVRVPFGKQQARIGIVVSVSD----VSELPLNELKAVVDVLDVEP 71

Query: 83  PLSRQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFP 131
             +  +   + W ADY   P+G V            R   +A        E+ Q   I  
Sbjct: 72  VFTHSVWRLLMWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEQGQAVDINS 131

Query: 132 RINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPN 191
              +  + + L  ++ GKIW  RD +   +++   +  L+ +G+     E         N
Sbjct: 132 LKRSPKQQQALAALRQGKIW--RDQVAELELNDAALQALRKKGLCDLASETPEFSDWRTN 189

Query: 192 LYFSLPILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
              S   L  N +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L
Sbjct: 190 YAVSGERLRLNTEQATAVGAIHSTADTFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQAL 249

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           +++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RSALF 
Sbjct: 250 VMVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFT 309

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   
Sbjct: 310 PFKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQ 369

Query: 371 RRYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLN 429
           ++Y  + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  + Q +LFLN
Sbjct: 370 KKYRLLRLTRRAGN-ARPAIQHVLDLKGQKVQAG--LAPALITRMRQHLQADNQVILFLN 426

Query: 430 RRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMI 489
           RRG+AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++
Sbjct: 427 RRGFAPALLCHDCGWIAECPRCDHYYTLHQAQQHLRCHHCDSQRPVPRQCPSCGST-HLV 485

Query: 490 ACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKG 549
             G G E++ + +   FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKG
Sbjct: 486 PVGLGTEQLEQTLAPLFPGVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKG 545

Query: 550 HNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPV 609
           H+FP ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P HP+
Sbjct: 546 HHFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPL 605

Query: 610 MQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE---HAPR 666
           +Q L+    D+F E  +  R  + LPP+     V       Q    +   L+     +P 
Sbjct: 606 LQTLLYKGYDAFAEQALAERRMMQLPPWTSHVIVRAEDHNNQHAPLFLQQLRNLILSSPL 665

Query: 667 SSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQF 723
           + D + V GP  +      GR+R+++L+       LQ   +      NTI  S  ++   
Sbjct: 666 ADDKLWVLGPVPTLAPKRGGRWRWQILLQHPSRVRLQHIINGTLALINTIPDSRKVKWVL 725

Query: 724 DIDP 727
           D+DP
Sbjct: 726 DVDP 729


>gi|212712507|ref|ZP_03320635.1| hypothetical protein PROVALCAL_03602 [Providencia alcalifaciens DSM
           30120]
 gi|212684723|gb|EEB44251.1| hypothetical protein PROVALCAL_03602 [Providencia alcalifaciens DSM
           30120]
          Length = 732

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 228/718 (31%), Positives = 384/718 (53%), Gaps = 26/718 (3%)

Query: 28  YIYSVPSAMKVE-LGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y + S M +  +G  V VP   R  LG+V  N  +K +    +L+ +E V D   L  
Sbjct: 16  FDYLLGSNMPIPVIGGRVMVPFGKRQALGVV-VNLSDKSEFPEDQLKTVELVLDSQTLFP 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFP-RINTVARLRVLDK 144
             + + + W + Y   P+G V   +  A+    +  +  +FT I+  ++        L++
Sbjct: 75  DDLWQLLLWSSQYYHYPIGEV---LFHAMPTLLRQGKPAEFTPIWQWQVTEEGNAADLNE 131

Query: 145 IKDG-KIWEKRDLIRASQVSSHVIDGLK-----AQGVIKQIF---EVISPVVDSPNLYFS 195
           +K   K  +   L+R   +  H +  L+      Q + K+ +     + PV +     F+
Sbjct: 132 LKRSPKQQQALALLRRRPIYRHQVGELEISESALQALKKKQYAELHPVQPVAEKWQSQFA 191

Query: 196 LP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           +    +   ++Q      +      F+  L++G+TGSGKTEVYL ++  +L  GKQ L+L
Sbjct: 192 VSGERLRLNSEQATAVGAIRAEDNNFSPWLLAGITGSGKTEVYLSVLENILAQGKQALVL 251

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI LT   + RF++RF V     HS+L+ S R  +W +  +G+  +I+G RSALF PF
Sbjct: 252 VPEIGLTPQTINRFRERFNVPVDVLHSALNDSERLAVWLRAKQGSNGIIIGTRSALFTPF 311

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
             LG+I+IDEEHD SYKQ++G  Y+ARD+++ R K E+ P+++ +ATPS+E+  N    +
Sbjct: 312 AHLGIIIIDEEHDSSYKQQDGWRYHARDLAVFRAKKENIPIIMGTATPSLETLSNVQQNK 371

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  ++L+ R  N+      +ID++GQ +  G  LS  +I  I++ L++N Q +LFLNRRG
Sbjct: 372 YRQLNLTIRAGNARPAEQHLIDLKGQPLKFG--LSHLLIQHIKNHLSQNNQVILFLNRRG 429

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           Y+P  +C  CG   +C  C  +   H++  +L CH C       + C  CGS+  ++  G
Sbjct: 430 YSPALICHECGWIAECQRCDHYYTLHQNFHQLRCHHCDSQRPVPRQCPQCGST-HLVPVG 488

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ E + E FP   ++ +  D     G L+  L+A+ +G   I+IGTQ++AKGH+F
Sbjct: 489 MGTEQLEEGISELFPDVPVTRIDRDTTSRKGELEQHLNAVHEGGARILIGTQMLAKGHHF 548

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L ++D R++ER  QL  QV+GRAGR G +    +Q + P HP++  
Sbjct: 549 PDVTLVALLDVDGALFSSDFRAAERFAQLYVQVSGRAGRAGKQGEVFLQTHHPEHPLLLT 608

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLK----EHAPRSS 668
           L+    D+F    +  R    LPPF     +       Q+   +  N++    +H    S
Sbjct: 609 LLESGYDAFSAEALEERRVAMLPPFTSHILIRSEDHNNQDARQFLQNVRHYISQHPQSDS 668

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
            + + GPA S      GR+R++LL+     + LQ F +Q+    +K+  + +V+++ID
Sbjct: 669 RLWILGPAPSIQAKRGGRFRWQLLLQHPSRAYLQQFMAQLLPELLKQPESRKVKWNID 726


>gi|200388655|ref|ZP_03215267.1| putative primosomal protein N' [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199605753|gb|EDZ04298.1| putative primosomal protein N' [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 732

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 241/725 (33%), Positives = 381/725 (52%), Gaps = 36/725 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEE-KYKIDSLKLRPIEYVFDCPPLS 85
           + Y +P     + G  VRVP  + +  +GIV   S+  +  +D LK   IE + + P  S
Sbjct: 16  FDYLLPEGGVAKAGCRVRVPFGKQQERVGIVVSVSDHSELPLDELK-SVIEILDNEPIFS 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W ADY   P+G V    +  L    K          F         IN++ R
Sbjct: 75  PSIWRLLLWAADYYHHPLGDVLFHALPVLLRQGKPASNAPLWYWFATEEGQAVDINSLKR 134

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +     +   +  L+ +G+ +   E  +P       ++
Sbjct: 135 SAKQQQALAALRQGKIW--RYQVAELDFTDATLQTLRRKGLCELASE--TPAFTDWREHY 190

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   + GF+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AVAGERLRLNTEQATAVGAIHSASDGFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +Y  + L+ R  N A P LQ V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNR
Sbjct: 371 KYRMLRLTRRAGN-ARPALQHVLDLKGQRLQAG--LAPALIARMRQHLQADNQVILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+ 
Sbjct: 428 RGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGST-HMLP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH
Sbjct: 487 VGLGTEQLEQVLAPFFPGVPISRIDRDTTSRKGALEQHLAEVHRGGARILIGTQMLAKGH 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 547 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLL 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P
Sbjct: 607 QTLLYKGYDAFAEQALAERQTLQLPPW--TSHVIIRAEDHNNQQAPVFLQQLRNLIQASP 664

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            S D + + GP  +      GRYR+++L+       LQ   S      NT+  +  ++  
Sbjct: 665 LSDDKLWILGPVPALAPKRGGRYRWQILLQHPSRIRLQHIISGTLALINTLPEARRVKWV 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|207859282|ref|YP_002245933.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|206711085|emb|CAR35459.1| primosomal protein replication factor [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
          Length = 732

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 240/725 (33%), Positives = 381/725 (52%), Gaps = 36/725 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEE-KYKIDSLKLRPIEYVFDCPPLS 85
           + Y +P     + G  VRVP  + +  +GIV   S+  +  +D LK   I+ + + P  S
Sbjct: 16  FDYLLPEGGVAKAGCRVRVPFGKQQERVGIVVSVSDHSELPLDELK-SVIDILDNEPIFS 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W ADY   P+G V    +  L    K          F         IN++ R
Sbjct: 75  PSIWRLLLWAADYYHHPLGDVLFHALPVLLRQGKPASNAPLWYWFATEEGQAVDINSLKR 134

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +     +   +  L+ +G+ +   E  +P       ++
Sbjct: 135 SAKQQQALAALRQGKIW--RYQVAELDFTDATLQTLRRKGLCELASE--APAFTDWREHY 190

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   + GF+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AIAGERLRLNTEQATAVGAIHSASDGFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +Y  + L+ R  N A P LQ V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNR
Sbjct: 371 KYRMLRLTRRAGN-ARPALQHVLDLKGQRLQAG--LAPALIARMRQHLQADNQVILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+ 
Sbjct: 428 RGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGST-HMLP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH
Sbjct: 487 VGLGTEQLEQVLAPFFPGVPISRIDRDTTSRKGALEQHLAEVHRGGARILIGTQMLAKGH 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 547 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLL 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P
Sbjct: 607 QTLLYKGYDAFAEQALAERQTLQLPPW--TSHVIIRAEDHNNQQAPVFLQQLRNLIQASP 664

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            S D + + GP  +      GRYR+++L+       LQ   S      NT+  +  ++  
Sbjct: 665 LSDDKLWILGPVPALAPKRGGRYRWQILLQHPSRIRLQHIISGTLALINTLPEARKVKWV 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|251787768|ref|YP_003002489.1| primosome assembly protein PriA [Dickeya zeae Ech1591]
 gi|247536389|gb|ACT05010.1| primosomal protein N' [Dickeya zeae Ech1591]
          Length = 732

 Score =  382 bits (982), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 235/712 (33%), Positives = 378/712 (53%), Gaps = 33/712 (4%)

Query: 41  GSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SRQMCEFVKWVADYT 99
           G  V VP  +R ++GIV  +     ++   +L+P+  V D  PL    +   + W A+Y 
Sbjct: 30  GVRVSVPFGNRKMIGIV-TSLSAGSELPLAQLKPLHDVLDDAPLFPDSLWRILLWAAEYY 88

Query: 100 FSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVARL----RVLDKIKDG 148
             P+G V    +  L    K          F         +N + R     + L  +  G
Sbjct: 89  HYPLGEVLFHALPILLRQGKPAHSAPLWQWFATEQGRATPLNALKRAPKQQQALASLLQG 148

Query: 149 KIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLP---ILDKNQQD 205
            I+  R  +  ++++   +  L+ +G + ++      V D  N  FSL    +    +Q 
Sbjct: 149 PIY--RHQVAEAELTEAALQALREKG-LSELRAQPRHVQDWRN-TFSLAGERLRLNTEQA 204

Query: 206 VVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILER 265
                +      FA  L++G+TGSGKTEVYL ++  +L  GKQ L+L+PEI LT   + R
Sbjct: 205 TAVGAIRSEDDHFAAWLLAGITGSGKTEVYLSVLENILAQGKQALVLVPEIGLTPQTIAR 264

Query: 266 FQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHD 325
           F+ RF       HS L+ S R  +W +  +G  ++++G RSALF PF +LGLIVIDEEHD
Sbjct: 265 FRDRFNAPVEALHSGLNDSERLSVWLRARQGEAAIVIGTRSALFTPFARLGLIVIDEEHD 324

Query: 326 ISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNS 385
            SYKQ+EG  Y+ARD+++ R + E+ P+V+ SATP++E+  N    +Y  + LS R  N+
Sbjct: 325 GSYKQQEGWRYHARDLAVFRARQENIPIVMGSATPALETLYNVQIGKYRQLRLSKRAGNA 384

Query: 386 ALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNR 445
            L    ++D++G  +  G  LS  +I+ IRH LA + Q +LFLNRRG+AP+ LC  CG  
Sbjct: 385 RLAQQHLLDLKGLPLTSG--LSQPLINRIRHHLAEDNQVILFLNRRGFAPVVLCHECGWI 442

Query: 446 LKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEY 505
            +C  C  +   H+ ++ + CH C       Q C  CGS+  ++  G G E++ + +   
Sbjct: 443 AECQRCDSYYTLHQHQRMMRCHHCDSQRPIPQQCPQCGST-HLVPVGLGTEQLEQVLPAL 501

Query: 506 FPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDL 565
           FP A I+ +  D     G L+ QL+ + +G   I+IGTQ++AKGH+FP ++LV ++D D 
Sbjct: 502 FPDAPITRIDRDTTSRKGALEQQLAQVRQGGARILIGTQMLAKGHHFPDVTLVALLDVDS 561

Query: 566 GLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESE 625
            L +AD R++ER  QL +QV+GRAGR G     ++Q + P HP++Q L+    D+F    
Sbjct: 562 ALFSADFRATERFAQLYTQVSGRAGRAGKAGEVVLQTHHPEHPLLQTLLHQGYDAFASQT 621

Query: 626 IRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP-RSSDIVVFGPAESP 679
           ++ R+SV LPPF   + V+     +   +   +     NL E +P R   + + GPA + 
Sbjct: 622 LKERQSVFLPPF--TSHVLFRADDHDNQQASLFLQQLRNLLEASPLRDDALWLMGPAPAL 679

Query: 680 LFMVRGRYRFRLLIHGKRNSNLQGFF--SQMYDNTIKRSNALRVQFDIDPQN 729
                GR+R++LL+     + LQ     S +  +T+ ++  ++   D+DP +
Sbjct: 680 QPKRAGRFRWQLLLQHPSRATLQRLIRNSMLLIDTLPQTRKVKWVMDVDPTD 731


>gi|303251035|ref|ZP_07337221.1| primosome assembly protein PriA [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307252670|ref|ZP_07534562.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|302650045|gb|EFL80215.1| primosome assembly protein PriA [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306859846|gb|EFM91867.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
          Length = 732

 Score =  382 bits (981), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 241/732 (32%), Positives = 388/732 (53%), Gaps = 44/732 (6%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P  +    G  V VP  ++T +G+   +  E   +   KL+PI+ V D  P+   
Sbjct: 11  FDYLLPPFLSAVKGVRVEVPFGNQTKIGVA-VDFPETSDVPEDKLKPIKAVLDLEPIFDE 69

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQ---FTGIFPRINTVARLRVLD 143
           ++   ++W A Y  +P+G VA   +          E+ Q   FT     +    R  +L 
Sbjct: 70  EIWTLLRWAARYYHAPIGEVAINALPVKLRNGDSTERSQPDYFT-----VTEAGRAALLS 124

Query: 144 KIKDGKIWEKRDLI-----------RASQVSSHVIDGLKAQGVIKQI---FEVI---SPV 186
             ++ +  +++DL+           + +  S     GL  +  I+ +   FE+      +
Sbjct: 125 G-ENKRAKKQQDLLAKLAEIANFFEKPTACSQSAWKGLLEKNYIEPVNVPFELQHWQKKL 183

Query: 187 VDSP--NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
            + P  NL+  L +L+K Q  VV ++      GF   L++GVTGSGKTEVYL+++  VL 
Sbjct: 184 QNRPLVNLHNRL-VLNKQQTLVVSRLA--VQNGFEAFLLNGVTGSGKTEVYLQVIEEVLK 240

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            G+QVL+L+PEI LT   ++RF+ RF V+    HS+++ + R   W +   G  ++++G 
Sbjct: 241 RGEQVLVLVPEIGLTPQTVQRFKARFNVEIDVLHSNMNETERLNAWLRAKNGESAIVIGT 300

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALF  F+KLGLI+IDEEHD S+KQ++G  Y+ARD++I+R K    P++L SATPS+ES
Sbjct: 301 RSALFSQFEKLGLIIIDEEHDSSFKQQDGWRYHARDLAILRAKNLHIPIILGSATPSLES 360

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
             N  + ++  + L+ R  N+     Q+ID++ Q I  G  LS  ++  ++  L +  Q 
Sbjct: 361 VQNVQNGKFIELSLTARAGNAQQAKQQLIDLKTQRITAG--LSDRLLAMMKQHLEQGNQV 418

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           +LFLNRRG+AP+ LC  CG   +C  C      H+ +K L CH C    +  + C  CGS
Sbjct: 419 MLFLNRRGFAPVLLCHECGWMCECDACEKPYTYHQKQKILRCHHCASQRVIPRQCGHCGS 478

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
           +  +I  G G E++ + + E FP  +IS +  D     G L+  L+ I +G+  I+IGTQ
Sbjct: 479 TN-LITTGVGTEQLEQVLSEQFPTYQISRIDRDSTARKGALENHLNDIREGKSQILIGTQ 537

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+FP ++LV +V+ D  L + D R+ ER  QL  QV GRAGR   +   ++Q + 
Sbjct: 538 MLAKGHHFPNVTLVAIVNVDSALFSTDFRAEERLAQLYVQVAGRAGRAEKQGEVVLQTHY 597

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P HP+++ L+     +F +  ++ R+ + LPPF     +  +G   Q+V N   NL  + 
Sbjct: 598 PEHPLLKTLLEQGYLAFAQEALKMRKVMGLPPFAAQVLLRATGKDNQQVVNLLQNLTAYF 657

Query: 665 PRS------SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ--MYDNTIKRS 716
            +        DI +  P  +P+    G YR+ LLI  +    LQ    Q  +    +   
Sbjct: 658 QQKCTELGLQDIQLLPPFSAPMAKKAGHYRWLLLIQHRSRGVLQQLIDQFDLDKANLGLQ 717

Query: 717 NALRVQFDIDPQ 728
           N +R+  DIDPQ
Sbjct: 718 NNIRLTLDIDPQ 729


>gi|307263700|ref|ZP_07545308.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 13
           str. N273]
 gi|306870954|gb|EFN02690.1| Primosomal protein N' [Actinobacillus pleuropneumoniae serovar 13
           str. N273]
          Length = 732

 Score =  382 bits (981), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 241/732 (32%), Positives = 388/732 (53%), Gaps = 44/732 (6%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P  +    G  V VP  ++T +G+   +  E   +   KL+PI+ V D  P+   
Sbjct: 11  FDYLLPPFLSAVKGVRVEVPFGNQTKIGVA-VDFPETSDVPEDKLKPIKAVLDLEPIFDE 69

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQ---FTGIFPRINTVARLRVLD 143
           ++   ++W A Y  +P+G VA   +          E+ Q   FT     +    R  +L 
Sbjct: 70  EIWTLLRWAARYYHAPIGEVAINALPVKLRNGDSTERSQPDYFT-----VTEAGRAALLS 124

Query: 144 KIKDGKIWEKRDLI-----------RASQVSSHVIDGLKAQGVIKQI---FEVI---SPV 186
             ++ +  +++DL+           + +  S     GL  +  I+ +   FE+      +
Sbjct: 125 G-ENKRAKKQQDLLAKLAEIANFFEKPTACSQSAWKGLLEKNYIEPVNVPFELQHWQKKL 183

Query: 187 VDSP--NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
            + P  NL+  L +L+K Q  VV ++      GF   L++GVTGSGKTEVYL+++  VL 
Sbjct: 184 QNRPLVNLHNRL-VLNKQQTLVVSRLA--VQNGFEAFLLNGVTGSGKTEVYLQVIEEVLK 240

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            G+QVL+L+PEI LT   ++RF+ RF V+    HS+++ + R   W +   G  ++++G 
Sbjct: 241 RGEQVLVLVPEIGLTPQTVQRFKARFNVEIDVLHSNMNETERLNAWWRAKNGESAIVIGT 300

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALF  F+KLGLI+IDEEHD S+KQ++G  Y+ARD++I+R K    P++L SATPS+ES
Sbjct: 301 RSALFSQFEKLGLIIIDEEHDSSFKQQDGWRYHARDLAILRAKNLHIPIILGSATPSLES 360

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
             N  + ++  + L+ R  N+     Q+ID++ Q I  G  LS  ++  ++  L +  Q 
Sbjct: 361 VQNVQNGKFIELSLTARAGNAQQAKQQLIDLKTQRITAG--LSDRLLAMMKQHLEQGNQV 418

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           +LFLNRRG+AP+ LC  CG   +C  C      H+ +K L CH C    +  + C  CGS
Sbjct: 419 MLFLNRRGFAPVLLCHECGWMCECDACEKPYTYHQKQKILRCHHCASQRVIPRQCGHCGS 478

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
           +  +I  G G E++ + + E FP  +IS +  D     G L+  L+ I +G+  I+IGTQ
Sbjct: 479 TN-LITTGVGTEQLEQVLSEQFPTYQISRIDRDSTARKGALENHLNDIREGKSQILIGTQ 537

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+FP ++LV +V+ D  L + D R+ ER  QL  QV GRAGR   +   ++Q + 
Sbjct: 538 MLAKGHHFPNVTLVAIVNVDSALFSTDFRAEERLAQLYVQVAGRAGRAEKQGEVVLQTHY 597

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P HP+++ L+     +F +  ++ R+ + LPPF     +  +G   Q+V N   NL  + 
Sbjct: 598 PEHPLLKTLLEQGYLAFAQEALKMRKVMGLPPFAAQVLLRATGKDNQQVVNLLQNLTAYF 657

Query: 665 PRS------SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ--MYDNTIKRS 716
            +        DI +  P  +P+    G YR+ LLI  +    LQ    Q  +    +   
Sbjct: 658 QQKCTELGLQDIQLLPPFSAPMAKKAGHYRWLLLIQHRSRGVLQQLIDQFDLDKANLGLQ 717

Query: 717 NALRVQFDIDPQ 728
           N +R+  DIDPQ
Sbjct: 718 NNIRLTLDIDPQ 729


>gi|15839278|ref|NP_299966.1| primosome assembly protein PriA [Xylella fastidiosa 9a5c]
 gi|9107930|gb|AAF85486.1|AE004075_1 primosomal protein N' [Xylella fastidiosa 9a5c]
          Length = 733

 Score =  382 bits (981), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 231/728 (31%), Positives = 378/728 (51%), Gaps = 38/728 (5%)

Query: 28  YIYSVPSAMKVE---LGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR-PIEYVFDCPP 83
           + Y  PS + +    LG  VRVP   R ++G+V    E      S+ LR    ++   P 
Sbjct: 18  FDYLPPSGIPLPDSTLGCRVRVPFGKRELIGVV---VELPSAEMSVPLREAFAWIDRIPI 74

Query: 84  LSRQMCEFVKWVADYTFSPMG-LVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVL 142
           L  ++ + ++W++ YT +P+G ++A  +   L   + + E   +T    R+    R    
Sbjct: 75  LDGELAQSLQWLSHYTHTPLGEILATALPGLLRHGKPLPET--WTCWAWRLTETGRTAAP 132

Query: 143 DKIKDGKIWEKRDLIRASQVSSHVID-----------GLKAQGVIKQIFEVISPVVDSPN 191
              ++ +  +  +L+  S  +   ++            L  +G +++I +  +  +    
Sbjct: 133 KLRRNSRSAQLAELLTTSDQTEDALNTRMNHWRTVARNLTKRGYVERIKKPTTVSLIIQT 192

Query: 192 LYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
              ++P+L+  QQ  VE +      GF   L+ GVTGSGKTEVYL+ +A  L   KQ L+
Sbjct: 193 TSNTVPVLNTEQQKAVETLN--ANVGFKTYLLDGVTGSGKTEVYLQAIATCLAASKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           L+PEI LT  +L  F  R G+     HS L+ + R ++W     G   +++G RSA+F P
Sbjct: 251 LVPEIGLTPQLLTNFHARLGIPVHALHSKLADNERARVWAAARCGEARLVLGTRSAVFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
               GLI++DEEHD SYKQ++GI YNARD ++VRGK  + PV+L SATPS+ES  N  + 
Sbjct: 311 LPHAGLIIVDEEHDTSYKQQDGIRYNARDFALVRGKALNVPVILGSATPSLESLYNAHNG 370

Query: 372 RYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRR 431
           RY  + L+ R   +  P ++V+D+R + +  G  LSPE++ GI  TLAR+EQ L+F NRR
Sbjct: 371 RYKHLRLTYRAGQAYAPQVRVLDVRKRPLKDG--LSPEVLTGINATLARDEQVLVFKNRR 428

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLY-------CHQCGHSAIYSQSCVVCGS 484
           GY+P+ LC  CG    C  CS  +  HR+   +Y       CH C        SC  CGS
Sbjct: 429 GYSPVLLCHDCGWTATCQQCSTSV--HRTPMTVYTGGTYLQCHHCDARQPMPLSCPDCGS 486

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
           +  +   G G ER+   + E FP   +  +  +       L+ Q + +      I++GTQ
Sbjct: 487 TA-LQPQGIGTERLEARLIEAFPKHPVVRIDRNTTQHRDALKTQFTELGNAA-GILVGTQ 544

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+ PR+++V VV  D GL +AD R++E+  Q L QV GRAGR        +Q + 
Sbjct: 545 ILAKGHHLPRLTMVVVVGIDEGLFSADFRATEKLSQQLIQVAGRAGRAKHAGEVWLQTHH 604

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P HP++Q L++G   +F  +E++ R++  LPPF  LA +          + +   +++H 
Sbjct: 605 PDHPLLQTLINGGYHTFANTELQQRQAAGLPPFAHLALLRAEAKDTTSTQQFLATVRKHI 664

Query: 665 PRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
           P  + +  +GP  +P+    G  R++LL+   + + L    + +    + +  +  +R  
Sbjct: 665 PIDNAVECYGPMSAPMPRRAGYERYQLLLSSSQRNTLHRTLNVLIPAIHALPEARRVRWS 724

Query: 723 FDIDPQNF 730
            D+DP + 
Sbjct: 725 LDVDPVDL 732


>gi|296133301|ref|YP_003640548.1| primosomal protein N' [Thermincola sp. JR]
 gi|296031879|gb|ADG82647.1| primosomal protein N' [Thermincola potens JR]
          Length = 829

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 218/587 (37%), Positives = 329/587 (56%), Gaps = 23/587 (3%)

Query: 163 SSHVIDGLKAQGVIK--QIFEVISPVVDSPNLYFSLPI-LDKNQQDVVEQVVPLCTKGFA 219
           S   +  L+ +G+IK  +I ++  P  +   + +  P  L   Q +V+  +     +G +
Sbjct: 248 SPTAVHALQEKGLIKIEEIEDIRDPFQECRPVEYEPPKQLTSEQAEVLADISCSIERGTS 307

Query: 220 -VSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPAEWH 278
            V L+ G TGSGKTEVYL+ +   L +GKQ + L+PEI+LT  +++R + RFG K A  H
Sbjct: 308 DVFLLHGATGSGKTEVYLQAIDKALIMGKQAIFLVPEIALTPQMVQRVRGRFGEKVAVLH 367

Query: 279 SSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDEEHDISYKQEEGILYNA 338
           S+LS   R   WRQ+  GA+ V+VG RSA+F P  KLGLI++DEEH+ +YKQEE   Y+A
Sbjct: 368 SALSLGERFDQWRQIKEGAVQVVVGARSAVFAPVPKLGLIIVDEEHESTYKQEENPKYHA 427

Query: 339 RDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQ 398
           R+++I R ++   PV+L SATPS+ES       +Y    +  R  N  +P + ++D+R +
Sbjct: 428 REVAIYRSRMAGCPVILGSATPSVESYYLAREGKYKLKTMPNRIGNRPMPEVHIVDLRRE 487

Query: 399 TIAQGKSL-SPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVE 457
                +S+ S  + + I   L + EQ +LFLNRRGY+   +C+ CG  +KC +C+  L  
Sbjct: 488 MEQGNRSIFSSRLQEEIAAVLQKKEQIILFLNRRGYSTFVVCRDCGFVVKCRYCNISLTY 547

Query: 458 HRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEEVCEYFPLARISILSSD 517
           H   +K+ CH CG+ A   Q C VC  S  +   G G +R+ +E+ + FP AR+  +  D
Sbjct: 548 HAHGEKMICHYCGYKAKVPQVCPVC-RSKHIRYFGLGTQRVEDEIKKLFPQARVLRMDVD 606

Query: 518 LEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSER 577
                G  +  L+  A G+ DI+IGTQ++AKG +FP+++LVGV+  D  L   D R++ER
Sbjct: 607 TTSRKGAHEKILTDFAAGKADILIGTQMIAKGLDFPKVTLVGVISADTSLNLPDFRAAER 666

Query: 578 TFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSFYESEIRARESVNLPPF 637
           TFQLL+QV GRAGR G     ++Q Y P H  ++     D   FY  EI  R  +  PPF
Sbjct: 667 TFQLLTQVAGRAGRAGAPGKVIVQTYAPAHYSVRTAQKHDFPGFYGIEIETRREMEYPPF 726

Query: 638 GRLAAVIISGTKYQEVENYAYNLKEHAPRSSDIV-------VFGPAESPLFMVRGRYRFR 690
            RL  ++ISG    +V   A+ L E+       V       + GPA +PL  +R +YR++
Sbjct: 727 SRLLRIVISGFDENKVIRAAHILAENVQAQLRGVEERLEQPLLGPAPAPLTKLRNKYRWQ 786

Query: 691 LLIHGKRNSNLQGFFSQMYDNTIKRS------NALRVQFDIDPQNFL 731
           L I  K        F  + D+ + +S      N L+   +IDPQ+ L
Sbjct: 787 LCIKAKNRK----VFGPLVDSALYKSGLREQFNDLKFNVEIDPQSLL 829


>gi|238892338|ref|YP_002917072.1| primosome assembly protein PriA [Klebsiella pneumoniae NTUH-K2044]
 gi|238544654|dbj|BAH61005.1| primosome assembly protein [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 755

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 237/725 (32%), Positives = 378/725 (52%), Gaps = 37/725 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEE-KYKIDSLKLRPI-EYVFDCPPLS 85
           + Y +P  M V+ G  VRVP   +  +GIV   SE  +  +D LK  P+ E + D P  S
Sbjct: 40  FDYLLPEGMAVKAGCRVRVPFGKQERIGIVAAVSERSELPLDELK--PVAEALDDEPVFS 97

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W A+Y   P+G V    +  +    K          F         +N + R
Sbjct: 98  TTVWRLLMWAAEYYHHPIGDVLFHALPVMLRQGKPASATPLWYWFATEQGQVVDLNGLKR 157

Query: 139 LR----VLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
            R     L  ++ GKIW  R  +   + +   +  L+ +G+ +   E  +P +      +
Sbjct: 158 SRKQQQALAALRQGKIW--RHQVGELEFNEAALQALRGKGLAELACE--APALTDWRSAY 213

Query: 195 SLP----ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVL 250
           S+      L+  Q   V  +     + F+  L++G+TGSGKTEVYL ++  VL  G+Q L
Sbjct: 214 SVAGERLRLNTEQATAVGAIHSAADR-FSAWLLAGITGSGKTEVYLSVLENVLAQGRQAL 272

Query: 251 ILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFL 310
           +++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF 
Sbjct: 273 VMVPEIGLTPQTIARFRQRFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFT 332

Query: 311 PFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGIS 370
           PFK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   
Sbjct: 333 PFKDLGVIVIDEEHDSSYKQQEGWRYHARDLAVWRAHSEQIPIILGSATPALETLHNVRQ 392

Query: 371 RRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
            +Y  + LS R  N+      V+D++G  +  G  LSP +I  +R  L  + Q +LFLNR
Sbjct: 393 GKYRQLTLSKRAGNARPAQQHVLDLKGLPLQAG--LSPALISRMRQHLQADNQVILFLNR 450

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  ++ 
Sbjct: 451 RGFAPALLCHDCGWIAECPRCDSYYTLHQAQHHLRCHHCDSQRPIPRQCPSCGST-HLVP 509

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +   FP   IS +  D     G L+  L+A+ +G   I+IGTQ++AKGH
Sbjct: 510 VGIGTEQLEQALAPLFPEVPISRIDRDTTSRKGALEEHLAAVHRGGARILIGTQMLAKGH 569

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 570 HFPDVTLVSLLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVILQTHHPEHPLL 629

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + V+I    +   +   +     NL + +P
Sbjct: 630 QTLLYKGYDAFAEQALAERQTMQLPPW--TSHVLIRAEDHNNQQAPLFLQQLRNLLQASP 687

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            + + + V GP  +      GR+R+++L+       LQ   S      NT+  +  ++  
Sbjct: 688 LADEKLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIVSGTLALINTLPEARKVKWV 747

Query: 723 FDIDP 727
            D+DP
Sbjct: 748 LDVDP 752


>gi|204930216|ref|ZP_03221193.1| putative primosomal protein N' [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204320620|gb|EDZ05822.1| putative primosomal protein N' [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 732

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 241/725 (33%), Positives = 380/725 (52%), Gaps = 36/725 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEE-KYKIDSLKLRPIEYVFDCPPLS 85
           + Y +P     + G  VRVP  + +  +GIV   S+  +  +D LK   IE + + P  S
Sbjct: 16  FDYLLPEGEVAKAGCRVRVPFGKQQERVGIVVSVSDHSELPLDELK-SVIEILDNEPIFS 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W ADY   P+G V    +  L    K          F         IN++ R
Sbjct: 75  PSIWRLLLWAADYYHHPLGDVLFHALPVLLRQGKPASNAPLWYWFATEEGQAADINSLKR 134

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +     +   +  L+ +G+ +   E  +P        +
Sbjct: 135 SAKQQQALAALRQGKIW--RYQVAELDFTDATLQTLRRKGLCELASE--TPAFTDWRERY 190

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   + GF+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AVAGERLRLNTEQATAVGAIHSASDGFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +Y  + L+ R  N A P LQ V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNR
Sbjct: 371 KYRMLRLTRRAGN-ARPALQHVLDLKGQRLQAG--LAPALIARMRQHLQADNQVILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+ 
Sbjct: 428 RGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGST-HMLP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH
Sbjct: 487 VGLGTEQLEQVLAPFFPGVPISRIDRDTTSRKGALEQHLAEVHRGGARILIGTQMLAKGH 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 547 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLL 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P
Sbjct: 607 QTLLYKGYDAFAEQALAERQTLQLPPW--TSHVIIRAEDHNNQQAPVFLQQLRNLIQASP 664

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            S D + + GP  +      GRYR+++L+       LQ   S      NT+  +  ++  
Sbjct: 665 LSDDKLWILGPVPALAPKRGGRYRWQILLQHPSRIRLQHIISGTLALINTLPEARKVKWV 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|190150357|ref|YP_001968882.1| primosomal protein N' [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|189915488|gb|ACE61740.1| primosomal protein N' [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
          Length = 738

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 241/732 (32%), Positives = 388/732 (53%), Gaps = 44/732 (6%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P  +    G  V VP  ++T +G+   +  E   +   KL+PI+ V D  P+   
Sbjct: 17  FDYLLPPFLSAVKGVRVEVPFGNQTKIGVA-VDFPETSDVPEDKLKPIKAVLDLEPIFDE 75

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQ---FTGIFPRINTVARLRVLD 143
           ++   ++W A Y  +P+G VA   +          E+ Q   FT     +    R  +L 
Sbjct: 76  EIWTLLRWAARYYHAPIGEVAINALPVKLRNGDSTERSQPDYFT-----VTEAGRAALLS 130

Query: 144 KIKDGKIWEKRDLI-----------RASQVSSHVIDGLKAQGVIKQI---FEVI---SPV 186
             ++ +  +++DL+           + +  S     GL  +  I+ +   FE+      +
Sbjct: 131 G-ENKRAKKQQDLLAKLAEIANFFEKPTACSQSAWKGLLEKNYIEPVNVPFELQHWQKKL 189

Query: 187 VDSP--NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
            + P  NL+  L +L+K Q  VV ++      GF   L++GVTGSGKTEVYL+++  VL 
Sbjct: 190 QNRPLVNLHNRL-VLNKQQTLVVSRLA--VQNGFEAFLLNGVTGSGKTEVYLQVIEEVLK 246

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            G+QVL+L+PEI LT   ++RF+ RF V+    HS+++ + R   W +   G  ++++G 
Sbjct: 247 RGEQVLVLVPEIGLTPQTVQRFKARFNVEIDVLHSNMNETERLNAWWRAKNGESAIVIGT 306

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSALF  F+KLGLI+IDEEHD S+KQ++G  Y+ARD++I+R K    P++L SATPS+ES
Sbjct: 307 RSALFSQFEKLGLIIIDEEHDSSFKQQDGWRYHARDLAILRAKNLHIPIILGSATPSLES 366

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQT 424
             N  + ++  + L+ R  N+     Q+ID++ Q I  G  LS  ++  ++  L +  Q 
Sbjct: 367 VQNVQNGKFIELSLTARAGNAQQAKQQLIDLKTQRITAG--LSDRLLAMMKQHLEQGNQV 424

Query: 425 LLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGS 484
           +LFLNRRG+AP+ LC  CG   +C  C      H+ +K L CH C    +  + C  CGS
Sbjct: 425 MLFLNRRGFAPVLLCHECGWMCECDACEKPYTYHQKQKILRCHHCASQRVIPRQCGHCGS 484

Query: 485 SGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQ 544
           +  +I  G G E++ + + E FP  +IS +  D     G L+  L+ I +G+  I+IGTQ
Sbjct: 485 TN-LITTGVGTEQLEQVLSEQFPTYQISRIDRDSTARKGALENHLNDIREGKSQILIGTQ 543

Query: 545 LVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQ 604
           ++AKGH+FP ++LV +V+ D  L + D R+ ER  QL  QV GRAGR   +   ++Q + 
Sbjct: 544 MLAKGHHFPNVTLVAIVNVDSALFSTDFRAEERLAQLYVQVAGRAGRAEKQGEVVLQTHY 603

Query: 605 PTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHA 664
           P HP+++ L+     +F +  ++ R+ + LPPF     +  +G   Q+V N   NL  + 
Sbjct: 604 PEHPLLKTLLEQGYLAFAQEALKMRKVMGLPPFAAQVLLRATGKDNQQVVNLLQNLTAYF 663

Query: 665 PRS------SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ--MYDNTIKRS 716
            +        DI +  P  +P+    G YR+ LLI  +    LQ    Q  +    +   
Sbjct: 664 QQKCTELGLQDIQLLPPFSAPMAKKAGHYRWLLLIQHRSRGVLQQLIDQFDLDKANLGLQ 723

Query: 717 NALRVQFDIDPQ 728
           N +R+  DIDPQ
Sbjct: 724 NNIRLTLDIDPQ 735


>gi|29655102|ref|NP_820794.1| primosomal protein N' [Coxiella burnetii RSA 493]
 gi|161830570|ref|YP_001597638.1| primosomal protein N' [Coxiella burnetii RSA 331]
 gi|29542371|gb|AAO91308.1| primosomal protein N' [Coxiella burnetii RSA 493]
 gi|161762437|gb|ABX78079.1| primosomal protein N' [Coxiella burnetii RSA 331]
          Length = 662

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 202/532 (37%), Positives = 302/532 (56%), Gaps = 7/532 (1%)

Query: 199 LDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISL 258
           L++ QQ+ V Q+  + +KGF   L++GVTGSGKTEVYL  +  ++   KQ LIL+PEI L
Sbjct: 133 LNEYQQNAVNQI--MASKGFQTFLLAGVTGSGKTEVYLRCIEKLIQQEKQALILVPEIGL 190

Query: 259 TSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLI 318
           T   L RF++RF V  A  HSSL+   R + W    RG   +++G RSA+F P    G+I
Sbjct: 191 TPQTLNRFRERFNVPTAVLHSSLTDKKRAQAWMMAKRGTAKIVIGTRSAIFTPLLNPGII 250

Query: 319 VIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHL 378
           ++DEEHD S+KQ+ G  Y+ARD++++RG+ E+ PVVL SATPS+ES  N   RRY  + L
Sbjct: 251 ILDEEHDTSFKQQSGFRYSARDLAVMRGQFENIPVVLGSATPSLESLYNVERRRYQLLSL 310

Query: 379 STRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTL 438
             R   + LP L ++D+R + +  G  +S +++  I   +    Q LLFLNRRGYAP  L
Sbjct: 311 PGRAGKAKLPSLTIVDLRQKKLIAG--MSEDLLISIEKHIKNKGQVLLFLNRRGYAPTLL 368

Query: 439 CQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERI 498
           C  CG  + C  C   L  H   K+LYCH CG +     +C  C    ++I  G G ER+
Sbjct: 369 CHGCGWVMHCDRCDARLTLHYFPKRLYCHHCGAAKKIPPTCPQCHQQ-ELIDVGLGTERL 427

Query: 499 AEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLV 558
              + + FP   I  +  D       ++ +L+ I   E  I+IGTQ++AKGH+F  ++LV
Sbjct: 428 EAALQQRFPNDDIVRIDRDSTRTKNSMENKLNLIHNREAPILIGTQMIAKGHHFSHLTLV 487

Query: 559 GVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDA 618
            ++D D GL +AD R++ER  QLL+QV GRAGR   +   LIQ +QP +P +  L+    
Sbjct: 488 AIIDADSGLYSADFRATERMGQLLTQVAGRAGRVDRQGEVLIQTHQPNNPFLTLLLQEGY 547

Query: 619 DSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS--SDIVVFGPA 676
           ++F ++ ++ R+ V LPPF  LA +     K     ++   +KE        ++ + GP 
Sbjct: 548 EAFAQALLKERQLVQLPPFTYLALLRTEAVKQNLPLDFLTKIKELMVNELKEEVDLLGPV 607

Query: 677 ESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
            + +    GRYR++LL   K   +L    +++      +   +R   DIDPQ
Sbjct: 608 SAGMERKAGRYRYQLLFQSKHRKHLHSVLNKLISLLATQRTKVRWSLDIDPQ 659


>gi|332084176|gb|EGI89381.1| primosomal protein N' [Shigella boydii 5216-82]
          Length = 732

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 239/721 (33%), Positives = 371/721 (51%), Gaps = 28/721 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  VRVP  + +  +GIV  +  +  ++   +L+ +  V D  P+ +
Sbjct: 16  FDYLLPEGMTVKAGCRVRVPFGKQQERIGIV-VSVSDASELPLNELKAVVEVLDSEPVFT 74

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 75  HSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEQGQAVDLNSLKR 134

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E         N   
Sbjct: 135 SPKQQQALAALRQGKIW--RDQVATLEFNDAALQALRKKGLCDLASETPEFSDWRKNYAV 192

Query: 195 SLPILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           S   L  N +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L+++
Sbjct: 193 SSERLRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALVMV 252

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RSALF PFK
Sbjct: 253 PEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFK 312

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   ++Y
Sbjct: 313 NLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQKKY 372

Query: 374 HSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
             + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  N Q +LFLNRRG
Sbjct: 373 RLLRLTRRAGN-ARPAIQHVLDLKGQKVQAG--LAPALITRMRQHLQANNQVILFLNRRG 429

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++  G
Sbjct: 430 FAPALLCHDCGWIAECPRCDHYYTLHQAQQHLRCHHCDSQRPVPRQCPSCGST-HLVPVG 488

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ + +   FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH+F
Sbjct: 489 LGTEQLEQTLAPMFPGVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHHF 548

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L + D RS+ER  QL +QV GRAGR G +   ++Q + P HP++Q 
Sbjct: 549 PDVTLVALLDVDGALFSVDFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQT 608

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE---HAPRSSD 669
           L+    D+F E  +  R  + LPP+     V       Q    +   L+     +P + D
Sbjct: 609 LLYKGYDAFAEQALAERRMMQLPPWTSHVIVRAEDHNNQHAPLFLQQLRNLILSSPLADD 668

Query: 670 -IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDID 726
            + V GP  +      GR+R+++L+       LQ   S      NTI  S  ++   D+D
Sbjct: 669 KLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIISGTLALINTIPDSRKVKWVLDVD 728

Query: 727 P 727
           P
Sbjct: 729 P 729


>gi|320180698|gb|EFW55624.1| Helicase PriA essential for oriC/DnaA-independent DNA replication
           [Shigella boydii ATCC 9905]
          Length = 732

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 240/723 (33%), Positives = 374/723 (51%), Gaps = 32/723 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  VRVP  + +  +GIV  +  +  ++   +L+ +  V D  P+ +
Sbjct: 16  FDYLLPEGMTVKAGCRVRVPFGKQQERIGIV-VSVSDASELPLNELKAVVEVLDSEPVFT 74

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 75  HSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEQGQAVDLNSLKR 134

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E         N   
Sbjct: 135 SPKQQQALAALRQGKIW--RDQVATLEFNDAALQALRKKGLCDLASETPEFSDWRKNYAV 192

Query: 195 SLPILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           S   L  N +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L+++
Sbjct: 193 SSERLRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALVMV 252

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RSALF PFK
Sbjct: 253 PEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFK 312

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   ++Y
Sbjct: 313 NLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQKKY 372

Query: 374 HSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
             + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  N Q +LFLNRRG
Sbjct: 373 RLLRLTRRAGN-ARPAIQHVLDLKGQKVQAG--LAPALITRMRQHLQANNQVILFLNRRG 429

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++  G
Sbjct: 430 FAPALLCHDCGWIAECPRCDHYYTLHQAQQHLRCHHCDSQRPVPRQCPSCGST-HLVPVG 488

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ + +   FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH+F
Sbjct: 489 LGTEQLEQTLAPMFPGVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHHF 548

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L + D RS+ER  QL +QV GRAGR G +   ++Q + P HP++Q 
Sbjct: 549 PDVTLVALLDVDGALFSVDFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQT 608

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAPRS 667
           L+    D+F E  +  R  + LPP+   + VI+    +       +     NL   +P +
Sbjct: 609 LLYKGYDAFAEQALAERRMMQLPPW--TSHVIVRAEDHNNQHAPLFLQQLCNLILSSPLA 666

Query: 668 SD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFD 724
            D + V GP  +      GR+R+++L+       LQ   S      NTI  S  ++   D
Sbjct: 667 DDKLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIISGTLALINTIPDSRKVKWVLD 726

Query: 725 IDP 727
           +DP
Sbjct: 727 VDP 729


>gi|294638261|ref|ZP_06716514.1| primosomal protein [Edwardsiella tarda ATCC 23685]
 gi|291088514|gb|EFE21075.1| primosomal protein [Edwardsiella tarda ATCC 23685]
          Length = 731

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 235/717 (32%), Positives = 362/717 (50%), Gaps = 21/717 (2%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P+ M  + G  VRVP   RT++G++   SE   ++    L+ +E   D  PL S 
Sbjct: 16  FDYLLPADMLAQPGCRVRVPFGHRTMIGLIVATSEHS-ELAPENLKSVEQCLDSEPLFSP 74

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKM-----EEKIQFTGIFPRINTVARLRV 141
                ++W ADY   P+G V    +  L    K        +   T    R++     R 
Sbjct: 75  TQWRLLRWAADYYHHPIGEVLFHALPMLLRQGKAACHPPRWRWHLTPQGERVDPATLTRA 134

Query: 142 LDKIKDGKIWEKRDLIRAS----QVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYFSLP 197
             + +   I  ++ L R       +S      LK +G+I    E  +P            
Sbjct: 135 PKQQQVLAILARQTLYRHQVEEFDLSDSAFTALKNKGLIALESESAAPKEWRSTFIPHTD 194

Query: 198 ILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEI 256
            L  N +Q      +    + F+  L++GVTGSGKTEVYL ++  +L  GKQ L+L+PEI
Sbjct: 195 RLTLNAEQATAVGAIRADDEQFSPWLLAGVTGSGKTEVYLSVIENLLARGKQALVLVPEI 254

Query: 257 SLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLG 316
            LT   + RF++RF V     HS L+ S R   W +   G  ++++G RSALF PF +LG
Sbjct: 255 GLTPQTIARFRQRFNVPVDVLHSGLNDSERLATWLRARDGESAIVIGTRSALFTPFARLG 314

Query: 317 LIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSV 376
            I+IDEEHD SYKQ+EG  Y+ARD++++R  +E  P++L SATP++E+  N    +Y  +
Sbjct: 315 GIIIDEEHDGSYKQQEGWRYHARDLAVLRAHLEGIPILLGSATPALETLHNVEVGKYRRL 374

Query: 377 HLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPL 436
            L+ R  N+      +ID++G  +  G  L+P +I+ IR       Q +LFLNRRGYAP 
Sbjct: 375 CLTQRAGNAKPATQHLIDLKGLPLKAG--LAPPLIERIRQHTDAGNQVILFLNRRGYAPA 432

Query: 437 TLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIE 496
            LC  CG   +C  C  +   H+ +  L CH C       + C  CGS+  ++  G G E
Sbjct: 433 LLCHECGWIAECPRCDHFYTLHQGQHLLRCHHCDSQRPVPRQCPQCGST-HLVPVGLGTE 491

Query: 497 RIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMS 556
           ++  E+ E FP   ++ +  D     G L+ QL+ + +G   I+IGTQ++AKGH+FP ++
Sbjct: 492 QLEHELAEMFPQVPLTRIDRDTTSRKGALEQQLAEVHQGGARILIGTQMLAKGHHFPNVT 551

Query: 557 LVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSG 616
           LV ++D D  L +AD  ++ER  QL +QV GRAGR G +   L+Q + P HP++Q L+  
Sbjct: 552 LVALLDVDGALFSADFHAAERFAQLYTQVAGRAGRAGKRGEVLLQTHHPDHPLLQTLLHQ 611

Query: 617 DADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLK----EHAPRSSDIVV 672
             D+F    ++ R+SV LPPF     V       Q+   +   L+     H  R   + +
Sbjct: 612 GYDAFACQALQERQSVFLPPFTHHVMVRADDHDNQQANAFLQQLRTLLETHPLRDEGLWL 671

Query: 673 FGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDIDP 727
            GP  +      GRYR++LL+     + LQ           T+     ++   D+DP
Sbjct: 672 LGPVPALQAKRGGRYRWQLLLQHPSRARLQQLLQATLPLLPTLPAYKRVKWSLDVDP 728


>gi|16767361|ref|NP_462976.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167991672|ref|ZP_02572771.1| primosomal protein N' [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|16422662|gb|AAL22935.1| primosomal protein N' [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|205329942|gb|EDZ16706.1| primosomal protein N' [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|261249211|emb|CBG27073.1| primosomal protein replication factor [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267996395|gb|ACY91280.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301160602|emb|CBW20133.1| primosomal protein replication factor [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312915211|dbj|BAJ39185.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321225387|gb|EFX50445.1| Helicase PriA essential for oriC/DnaA-independent DNA replication
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|323132441|gb|ADX19871.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|332990924|gb|AEF09907.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 732

 Score =  382 bits (980), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 241/725 (33%), Positives = 380/725 (52%), Gaps = 36/725 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEE-KYKIDSLKLRPIEYVFDCPPLS 85
           + Y +P     + G  VRVP  + +  +GIV   S+  +  +D LK   IE + + P  S
Sbjct: 16  FDYLLPEGGVAKAGCRVRVPFGKQQERVGIVVSISDHSELPLDELK-SVIEILDNEPIFS 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W ADY   P+G V    +  L    K          F         IN++ R
Sbjct: 75  PSIWRLLLWAADYYHHPLGDVLFHALPVLLRQGKPASNAPLWYWFATEEGQAVDINSLKR 134

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +     +   +  L+ +G+ +   E  +P        +
Sbjct: 135 SAKQQQALAALRQGKIW--RYQVAELDFTDATLQTLRRKGLCELASE--TPAFTDWRERY 190

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   + GF+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AVAGERLRLNTEQATAVGAIHSASDGFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +Y  + L+ R  N A P LQ V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNR
Sbjct: 371 KYRMLRLTRRAGN-ARPALQHVLDLKGQRLQAG--LAPALIARMRQHLQADNQVILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+ 
Sbjct: 428 RGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGST-HMLP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH
Sbjct: 487 VGLGTEQLEQVLAPFFPGVPISRIDRDTTSRKGALEQHLAEVHRGGARILIGTQMLAKGH 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 547 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLL 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P
Sbjct: 607 QTLLYKGYDAFAEQALAERQTLQLPPW--TSHVIIRAEDHNNQQAPVFLQQLRNLIQASP 664

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            S D + + GP  +      GRYR+++L+       LQ   S      NT+  +  ++  
Sbjct: 665 LSDDKLWILGPVPALAPKRGGRYRWQILLQHPSRIRLQHIISGTLALINTLPEARKVKWV 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|262280790|ref|ZP_06058573.1| primosomal protein N' (replication factor Y)- superfamily II
           helicase [Acinetobacter calcoaceticus RUH2202]
 gi|262257690|gb|EEY76425.1| primosomal protein N' (replication factor Y)- superfamily II
           helicase [Acinetobacter calcoaceticus RUH2202]
          Length = 742

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 238/714 (33%), Positives = 382/714 (53%), Gaps = 29/714 (4%)

Query: 37  KVELGSIVRVPLRSRTVLGIVW--YNSEEKYKIDSLKLRPIEYVFDCPP-LSRQMCEFVK 93
           +  +GS V +    + ++GI+    N  E +     +L+ I  + D  P L  Q+   + 
Sbjct: 37  RAHVGSRVAISFGRQNLIGIITEKVNPHEPF-TGKFQLKAISELLDEQPILDEQVLSLLT 95

Query: 94  WVADYTFSPMGLVARMVVSA-LSETEKMEEKIQFTGIFPRINTVARLRVLDKIKDGKIWE 152
           W A Y   P+G V +  + A L + + M+       I P  N  A L+   K +D     
Sbjct: 96  WSAQYYQFPVGEVMQTALPAILRQGKPMDVLFHLWKITPCDNVEALLKRSVKQQDAYQIL 155

Query: 153 K-------RDLIRASQVSSHVIDGLKAQGVIKQIFEV--ISPVVDSPNLYFSLPI-LDKN 202
           K        +++  S V +  +  L+ +G+++   E    SP   +P     +P+ L+++
Sbjct: 156 KLHPAGTTENILNLSGVETATLKALEKKGLVECTLEPHDFSP---TPVQLAQMPLTLNED 212

Query: 203 QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAI 262
           Q+   +QV+      +   L+ G+TGSGKTEVYL I+  VL  GKQVL+L+PEI LT   
Sbjct: 213 QKQATQQVIK-AQHQYQAFLLDGLTGSGKTEVYLHIMHEVLKQGKQVLVLVPEIGLTPQT 271

Query: 263 LERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLIVIDE 322
           + RF+ RF    A  HS L+ S R + W+Q   G  S+I+G RSA++ P  +LGLI++DE
Sbjct: 272 ISRFKSRFNCDIALLHSGLNDSKRLQAWQQAQTGKASIILGTRSAIYTPLPRLGLIILDE 331

Query: 323 EHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHLSTRY 382
           EHD+SYKQ+EG  Y+ARD+++ RG ++S PV+L SATPSI+S     + +  S+ L+ R 
Sbjct: 332 EHDLSYKQQEGFRYHARDVALYRGHLQSCPVILGSATPSIDSYYLVETGKLTSLQLNKRA 391

Query: 383 RNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTLCQVC 442
            ++ LP + +ID++   + +   +S  +I+ I+HTLAR EQ L+FLNRRGYAP+ +C+ C
Sbjct: 392 GHALLPKMHLIDLK--IVKKQHGISQPLIEQIKHTLARKEQVLIFLNRRGYAPVLVCESC 449

Query: 443 GNRLKCLHCSCWLVEH-RSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERIAEE 501
           G +  C HC      H +    L+CH CG        C  C     +   G G  ++ E 
Sbjct: 450 GWQANCPHCDAHFTLHIQPYSYLHCHHCGTIHRLPDHCPECQQKS-LKTLGAGTAKVEEH 508

Query: 502 VCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLVGVV 561
           + E FP   +  +  D     G  Q     I + +  I++GTQ++AKGH+FP ++LV ++
Sbjct: 509 LQELFPDHDVIRVDRDSTSRVGSWQKIYDRIHQNKPTILLGTQMLAKGHHFPHVTLVAIL 568

Query: 562 DGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDADSF 621
           D D GL + D+R+ ERT QL+ QV GRAGR   K    +Q  +P HP++  L+  D  + 
Sbjct: 569 DIDAGLLSVDIRAPERTAQLIVQVAGRAGRGEHKGHVYLQTLRPDHPLLTTLIEKDYRAV 628

Query: 622 YESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPR--SSDIV-VFGPAES 678
            +  +  R+   LPP+ R A +I + +K ++   +  N      R  + +I+ ++GP  +
Sbjct: 629 AKQTLAERKVALLPPY-RYAVLIRAESKDRDYTLHFLNEAAEQLRQVAGEIIDIWGPIPA 687

Query: 679 PLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIK--RSNALRVQFDIDPQNF 730
           P+    GRYR  ++I     + L  +  Q +   +   R + LR+  D+DPQ F
Sbjct: 688 PMERKAGRYRAHMVILSADRARLHFYLRQWWSQLVHAPRQHQLRLSIDVDPQEF 741


>gi|328471831|gb|EGF42708.1| primosome assembly protein PriA [Vibrio parahaemolyticus 10329]
          Length = 734

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 238/730 (32%), Positives = 383/730 (52%), Gaps = 41/730 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYN-SEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y++P  +   +G  V VP   +T++GIV    +   +  D LK  PI+ V D  P+ S
Sbjct: 18  FDYAIPGHLFPIIGGRVSVPFGRQTLVGIVTAMVNHSDFPKDQLK--PIKAVLDSQPVWS 75

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSA------------LSE---TEKMEEKIQFTGIF 130
            ++   + W + +   P+G      + A            L E   TE  ++K+   G+ 
Sbjct: 76  EKLYSLLTWCSQFYQYPLGDTLHNAMPAALRKGKPADFATLQEWQITESGKDKL-MQGLD 134

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
            R   V + +VL  + +G +  +       +++S V+  L+ +G I++I +   PV+   
Sbjct: 135 RR--AVKQQKVLQMLVNGALPHQE--FVDQEIASTVLKSLEEKGWIERIEK--KPVITKW 188

Query: 191 NLYFSL----PILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLG 246
             +       P L+  Q   +  V      GFA  L+ GVTGSGKTEVYL ++  VL  G
Sbjct: 189 GQHVECDVEKPKLNHEQALAIASVN--SQTGFACYLLEGVTGSGKTEVYLNLIKPVLEKG 246

Query: 247 KQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRS 306
           KQ L+L+PEI LT   + RF++RF V     HS L+ + R   W      A  +I+G RS
Sbjct: 247 KQALVLVPEIGLTPQTINRFKRRFNVPVDVIHSGLNETERLNAWLSARDKAAGIIIGTRS 306

Query: 307 ALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRV 366
           AL  PF  LG+I++DEEHD SYKQ++ + Y+ARD++++R   E  P+VL SATP++E+  
Sbjct: 307 ALLAPFADLGIIIVDEEHDTSYKQQDSLRYHARDVAVMRAHKEQVPIVLGSATPALETLH 366

Query: 367 NGISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLL 426
           N +S +YH + L+ R  ++     +V+D++GQ +  G  LS  +I  +R  L    Q +L
Sbjct: 367 NALSGKYHHLTLTQRAGSAVPTTNKVLDVKGQYLESG--LSAPLIAEMRKHLKAGNQVML 424

Query: 427 FLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSG 486
           FLNRRG++P  +C  CG   +C  C  +   H+   ++ CH CG        C  CGS+ 
Sbjct: 425 FLNRRGFSPALMCHECGWIAECKRCDAYYTFHQYSNEIRCHHCGSQQPVIHQCQGCGST- 483

Query: 487 KMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLV 546
           +++  G G E++ +++ + FP  +   +  D     G L+  L +I KGE  I+IGTQ++
Sbjct: 484 QLVTVGVGTEQLEQQLAQLFPEYKAIRIDRDSTRRKGSLEDALESIRKGEYQILIGTQML 543

Query: 547 AKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPT 606
           AKGH+FP ++LV ++D D  L ++D R+SER  QL  QV GRAGR       ++Q + P 
Sbjct: 544 AKGHHFPNVTLVALLDVDGSLYSSDFRASERLAQLFIQVAGRAGRASKPGEVVLQTHHPE 603

Query: 607 HPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENY----AYNLKE 662
           H ++QAL+  D   F  + +  R+   LPP+  L        + + VE++     + L+ 
Sbjct: 604 HSLLQALLEKDYRHFAMTALEERKLAQLPPYSFLTLFKAEANQSEIVEDFLRQVRFTLES 663

Query: 663 HAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQ 722
           H       +V GP  SPL    G+YR++LL+  +  S +Q   +          NA +V+
Sbjct: 664 HPLFDDTCMVLGPTPSPLAKRAGKYRWQLLLQTQHRSLMQKLLTSAKPAIELLPNAKKVR 723

Query: 723 F--DIDPQNF 730
           +  DI+PQ+ 
Sbjct: 724 WNLDIEPQDL 733


>gi|154705781|ref|YP_001423480.1| primosomal protein N' [Coxiella burnetii Dugway 5J108-111]
 gi|154355067|gb|ABS76529.1| primosomal protein N' [Coxiella burnetii Dugway 5J108-111]
          Length = 662

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 202/532 (37%), Positives = 302/532 (56%), Gaps = 7/532 (1%)

Query: 199 LDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISL 258
           L++ QQ+ V Q+  + +KGF   L++GVTGSGKTEVYL  +  ++   KQ LIL+PEI L
Sbjct: 133 LNEYQQNAVNQI--MASKGFQTFLLAGVTGSGKTEVYLRCIEKLIQQEKQALILVPEIGL 190

Query: 259 TSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFKKLGLI 318
           T   L RF++RF V  A  HSSL+   R + W    RG   +++G RSA+F P    G+I
Sbjct: 191 TPQTLNRFRERFNVPTAVLHSSLTDKKRAQAWMMAKRGTAKIVIGTRSAIFTPLLNPGII 250

Query: 319 VIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRYHSVHL 378
           ++DEEHD S+KQ+ G  Y+ARD++++RG+ E+ PVVL SATPS+ES  N   RRY  + L
Sbjct: 251 ILDEEHDTSFKQQSGFRYSARDLAVMRGQFENIPVVLGSATPSLESLYNVERRRYQLLSL 310

Query: 379 STRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRGYAPLTL 438
             R   + LP L ++D+R + +  G  +S +++  I   +    Q LLFLNRRGYAP  L
Sbjct: 311 PGRAGKAKLPSLTIVDLRQKKLIAG--MSEDLLISIEKHIKNKGQVLLFLNRRGYAPTLL 368

Query: 439 CQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACGFGIERI 498
           C  CG  + C  C   L  H   K+LYCH CG +     +C  C    ++I  G G ER+
Sbjct: 369 CHGCGWVMHCDRCDARLTLHYFPKRLYCHHCGAAKKIPPTCPQCHQQ-ELIDVGLGTERL 427

Query: 499 AEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNFPRMSLV 558
              + + FP   I  +  D       ++ +L+ I   E  I+IGTQ++AKGH+F  ++LV
Sbjct: 428 EAALQQRFPNDDIVRIDRDSTRTKNSMENKLNLIHNREAPILIGTQMIAKGHHFSHLTLV 487

Query: 559 GVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQALVSGDA 618
            ++D D GL +AD R++ER  QLL+QV GRAGR   +   LIQ +QP +P +  L+    
Sbjct: 488 AIIDADSGLYSADFRATERMGQLLTQVAGRAGRVDRQGEVLIQTHQPNNPFLTLLLQEGY 547

Query: 619 DSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS--SDIVVFGPA 676
           ++F ++ ++ R+ V LPPF  LA +     K     ++   +KE        ++ + GP 
Sbjct: 548 EAFAQALLKERQLVQLPPFTYLALLRTEAVKQNLPLDFLTKIKELMVNELKEEVDLLGPV 607

Query: 677 ESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDIDPQ 728
            + +    GRYR++LL   K   +L    +++      +   +R   DIDPQ
Sbjct: 608 PAGMERKAGRYRYQLLFQSKHRKHLHSVLNKLISLLATQRTKVRWSLDIDPQ 659


>gi|322515197|ref|ZP_08068196.1| primosome assembly protein PriA [Actinobacillus ureae ATCC 25976]
 gi|322118807|gb|EFX91008.1| primosome assembly protein PriA [Actinobacillus ureae ATCC 25976]
          Length = 738

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 238/729 (32%), Positives = 384/729 (52%), Gaps = 38/729 (5%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P  +    G  V VP  ++T +G+   +  E   +   KL+PI+ V D  P+   
Sbjct: 17  FDYLLPPFLSAVKGVRVAVPFGNQTKIGVA-VDFPETSDVPEDKLKPIKAVLDLEPIFDE 75

Query: 87  QMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPRINTVARLRVLDKIK 146
           ++   ++W A Y  +P+G VA   +          E+ Q    +  +    R  +L   +
Sbjct: 76  EIWTLLRWAARYYHAPIGEVAINALPVKLRNGDSTERSQPD--YFAVTEAGRAALLSG-E 132

Query: 147 DGKIWEKRDLI-----------RASQVSSHVIDGLKAQGVIKQIFEVISP------VVDS 189
           + +  +++DL+           + +  S     GL  +  I+ +     P      + + 
Sbjct: 133 NKRAKKQQDLLAELAEIANFFEKPTDCSQSAWKGLLEKNYIEPVNVPFEPQHWQKKLQNR 192

Query: 190 P--NLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGK 247
           P  NL   L +L+K Q  VV ++      GF   L++GVTGSGKTEVYL+++  VL  G+
Sbjct: 193 PLVNLQNRL-VLNKQQTLVVSRLT--VQNGFETFLLNGVTGSGKTEVYLQVIEEVLKRGE 249

Query: 248 QVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSA 307
           QVL+L+PEI LT   ++RF+ RF V+    HS+++ + R   W +   G  ++++G RSA
Sbjct: 250 QVLVLVPEIGLTPQTVQRFKARFNVEIDVLHSNMNETERLNAWLRAKNGESAIVIGTRSA 309

Query: 308 LFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVN 367
           LF  F+KLGLI+IDEEHD S+KQ++G  Y+ARD++I+R K    P++L SATPS+ES  N
Sbjct: 310 LFSQFEKLGLIIIDEEHDSSFKQQDGWRYHARDLAILRAKNLHIPIILGSATPSLESVQN 369

Query: 368 GISRRYHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLF 427
             + ++  + L+ R  N+     Q+ID++ Q I  G  LS  ++  ++  L +  Q +LF
Sbjct: 370 AQNGKFIELSLTARAGNAQQAKQQLIDLKTQRITAG--LSDRLLAMMKQHLEQGNQVMLF 427

Query: 428 LNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGK 487
           LNRRG+AP+ LC  CG   +C  C      H+ +K L CH C    +  + C  CGS+  
Sbjct: 428 LNRRGFAPVLLCHECGWMCECDACEKPYTYHQKQKILRCHHCSSQRVIPRQCGHCGSTN- 486

Query: 488 MIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVA 547
           +I  G G E++ + + E FP  +IS +  D     G L+  L+ I +G+  I+IGTQ++A
Sbjct: 487 LITTGVGTEQLEQVLSEQFPTYQISRIDRDSTARKGALENHLNDIREGKSQILIGTQMLA 546

Query: 548 KGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTH 607
           KGH+FP ++LV +V+ D  L + D R+ ER  QL  QV GRAGR   +   ++Q + P H
Sbjct: 547 KGHHFPNVTLVAIVNVDSALFSTDFRAEERLAQLYVQVAGRAGRAEKQGEVVLQTHYPEH 606

Query: 608 PVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS 667
           P+++ L+     +F +  ++ R+ + LPPF     +  +G   Q+V N   NL  +  + 
Sbjct: 607 PLLKTLLEQGYLAFAQEALKMRKVMGLPPFAAQVLLRATGKDNQQVVNLLQNLTAYFQQK 666

Query: 668 ------SDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQ--MYDNTIKRSNAL 719
                  DI +  P  +P+    G YR+ LLI  +    LQ    Q  +    +   N +
Sbjct: 667 CTELGFQDIQLLPPFSAPMAKKAGHYRWLLLIQHRSRGVLQQLIDQFDLDKANLGLQNNI 726

Query: 720 RVQFDIDPQ 728
           R+  DIDPQ
Sbjct: 727 RLTLDIDPQ 735


>gi|300721292|ref|YP_003710563.1| primosomal protein N' [Xenorhabdus nematophila ATCC 19061]
 gi|297627780|emb|CBJ88311.1| primosomal protein N' (factor Y) directs replication fork assembly
           at D-loops, ATP-dependent [Xenorhabdus nematophila ATCC
           19061]
          Length = 732

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 232/720 (32%), Positives = 381/720 (52%), Gaps = 30/720 (4%)

Query: 28  YIYSVPSAMKVE-LGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +PS + V  +G  V VP   R  +G+V     +  +    +L+ +  V D  PL  
Sbjct: 16  FDYLLPSELPVPAIGVRVLVPFGKRNAIGVV-VGIADSSEFPPEQLKSVSSVLDTQPLFP 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFP-RINTVARLRVLDK 144
             + + + W A Y   P+G V    +  L    K  E   F  ++  +I T  R   L++
Sbjct: 75  DDLWQLLLWSAHYYHYPLGEVLFHAMPVLLRQGKNAE---FAPLWQWQITTEGRELPLEQ 131

Query: 145 IK-DGKIWEKRDLIRASQVSSHVIDGLKA-----QGVIKQIFEVISPV-VDSPNLYFSLP 197
           +K   K  +    +R   +  H +  L+      Q + K+    ++PV  ++ N + S  
Sbjct: 132 LKRSAKQQQALATLRQKPIYRHQVSELELSESALQSLKKKALIALNPVQPEAENWHTSFT 191

Query: 198 ILDKNQQDVVEQVVPLCT-----KGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
           I+        EQ   +       + F+  LI+G+TGSGKTEVYL ++  +L  GKQ LIL
Sbjct: 192 IIGARLTLNAEQATAVGAIRAEDRTFSPWLIAGITGSGKTEVYLSVLENILAQGKQALIL 251

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI LT   + RF++RF       HS+L+ S R   W +  RG  ++++G RSALF PF
Sbjct: 252 VPEIGLTPQTIRRFRERFKAPIDVLHSALNDSERLAAWLRAKRGENAIVIGTRSALFTPF 311

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
            +LG+I+IDEEHD SYKQ+EG  Y+ARD+++ R K E  P+++ +ATP++E+  N    +
Sbjct: 312 ARLGMIIIDEEHDGSYKQQEGWRYHARDLAVFRAKKEGIPIIMGTATPALETLYNVQQNK 371

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
           Y  + L+ R  ++      ++D++G  +  G  LS  +I+ I   L  + Q +LFLNRRG
Sbjct: 372 YRQLTLTKRAGHAQPATQHLLDLKGLPLTVG--LSQPLINRIHEHLKADNQVILFLNRRG 429

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           Y+P  LC  CG   +C  C  +   H++ + L CH C       + C  CGS+  ++  G
Sbjct: 430 YSPALLCHECGWIAECQRCDHYYTLHQNHRHLRCHHCDSQRPVPRQCPQCGST-NLMPVG 488

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ + + + FP   I+ +  D     G L+ QL+ + +G   I+IGTQ++AKGH+F
Sbjct: 489 LGTEQLEDGITKLFPNTPITRIDRDTTSRKGALEQQLAEVHQGGARILIGTQMLAKGHHF 548

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L +AD R++ER  QL +QV+GRAGR G +   ++Q + P HP++Q 
Sbjct: 549 PDVTLVALLDVDGALFSADFRAAERFAQLYTQVSGRAGRAGKRGEVVLQTHHPEHPLLQV 608

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP-R 666
           L+    D+F +  +  R+ V+LPPF   + +++    +   +  A+      L EH P R
Sbjct: 609 LLEKGYDAFAQQAMEERQQVHLPPFA--SHILLRSEDHDNQQAPAFLQHMRQLFEHHPQR 666

Query: 667 SSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNALRVQFDID 726
            + + + GP  +      GRYR++L+I       LQ   + +Y        A +V+++ID
Sbjct: 667 DNHLWIMGPVPALQAKRSGRYRWQLMIQHPSRIFLQKIMTGIYPQITAMPQARKVKWNID 726


>gi|300919133|ref|ZP_07135670.1| primosomal protein [Escherichia coli MS 115-1]
 gi|300413767|gb|EFJ97077.1| primosomal protein [Escherichia coli MS 115-1]
          Length = 732

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 239/721 (33%), Positives = 372/721 (51%), Gaps = 28/721 (3%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-S 85
           + Y +P  M V+ G  VRVP  + +  +GIV  +  +  ++   +L+ +  V D  P+ +
Sbjct: 16  FDYLLPEGMTVKAGCRVRVPFGKQQERIGIV-VSVSDASELPLNELKAVVEVLDSEPVFT 74

Query: 86  RQMCEFVKWVADYTFSPMGLV-----------ARMVVSALSETEKMEEKIQFTGIFPRIN 134
             +   + W ADY   P+G V            R   +A        E+ Q   +     
Sbjct: 75  HSVWRLLLWAADYYHHPIGDVLFHALPILLRQGRPAANAPMWYWFATEQGQAVDLNSLKR 134

Query: 135 TVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
           +  + + L  ++ GKIW  RD +   + +   +  L+ +G+     E         N   
Sbjct: 135 SPKQQQALAALRQGKIW--RDQVATLEFNDAALQALRKKGLCDLASETPEFSDWRTNYAV 192

Query: 195 SLPILDKN-QQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILL 253
           S   L  N +Q      +      F+  L++GVTGSGKTEVYL ++  VL  GKQ L+++
Sbjct: 193 SGERLRLNTEQATAVGAIHSAADTFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALVMV 252

Query: 254 PEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPFK 313
           PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RSALF PFK
Sbjct: 253 PEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSALFTPFK 312

Query: 314 KLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRRY 373
            LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   ++Y
Sbjct: 313 NLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVQQKKY 372

Query: 374 HSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNRRG 432
             + L+ R  N A P +Q V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNRRG
Sbjct: 373 RLLRLTRRAGN-ARPAIQHVLDLKGQKVQAG--LAPALITRMRQHLQADNQVILFLNRRG 429

Query: 433 YAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIACG 492
           +AP  LC  CG   +C  C  +   H++++ L CH C       + C  CGS+  ++  G
Sbjct: 430 FAPALLCHDCGWIAECPRCDHYYTLHQAQQHLRCHHCDSQRPVPRQCPSCGST-HLVPVG 488

Query: 493 FGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHNF 552
            G E++ + +   FP   IS +  D     G L+ QL+ + +G   I+IGTQ++AKGH+F
Sbjct: 489 LGTEQLEQTLAPLFPGVPISRIDRDTTSRKGALEQQLAEVHRGGARILIGTQMLAKGHHF 548

Query: 553 PRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQA 612
           P ++LV ++D D  L +AD RS+ER  QL +QV GRAGR G +   ++Q + P HP++Q 
Sbjct: 549 PDVTLVALLDVDGALFSADFRSAERFAQLYTQVAGRAGRAGKQGEVVLQTHHPEHPLLQT 608

Query: 613 LVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKE---HAPRSSD 669
           L+    D+F E  +  R  + LPP+     V       Q    +   L+     +P + D
Sbjct: 609 LLYKGYDAFAEQALAERRMMQLPPWTSHVIVRAEDHNNQHAPLFLQQLRNLILSSPLADD 668

Query: 670 -IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQFDID 726
            + V GP  +      GR+R+++L+       LQ   S      NTI  S  ++   D+D
Sbjct: 669 KLWVLGPVPALAPKRGGRWRWQILLQHPSRVRLQHIISGTLALINTIPDSRKVKWVLDVD 728

Query: 727 P 727
           P
Sbjct: 729 P 729


>gi|260770838|ref|ZP_05879767.1| helicase PriA essential for oriC/DnaA-independent DNA replication
           [Vibrio furnissii CIP 102972]
 gi|260614075|gb|EEX39265.1| helicase PriA essential for oriC/DnaA-independent DNA replication
           [Vibrio furnissii CIP 102972]
          Length = 733

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 236/733 (32%), Positives = 382/733 (52%), Gaps = 48/733 (6%)

Query: 28  YIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRPIEYVFDCPPL-SR 86
           + Y +P+ +   +G  V VP   +T++G+V   ++E       +L+ I+ V D  P+   
Sbjct: 18  FDYLIPNHLFPIIGGRVSVPFGRQTLVGVVTALAQES-AFPREQLKAIKAVLDSQPVWPE 76

Query: 87  QMCEFVKWVADYTFSPMG-LVARMVVSAL----------SETEKMEEK--IQFTGIFPRI 133
            +   ++W + +   P+G  +A  + SAL          S+   M E+   Q    F R 
Sbjct: 77  TLYRLLQWCSQFYQYPLGDTLANAMPSALRKGKPADFASSKEWHMTERGRDQLMQGFGR- 135

Query: 134 NTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVI---------KQIFEVIS 184
             V + +V+  ++ G +     ++   +VSS  ++ L+ +G I         +   +V+ 
Sbjct: 136 -AVKQAQVMHLLEPGPV--AHQIMLDEEVSSATLNTLQDKGWIEVTEKQPQFRPWPKVVE 192

Query: 185 PVVDSPNLYFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLH 244
             VD P L         NQ+  +        +GF   L+ GVTGSGKTEVYL ++  VL 
Sbjct: 193 ADVDKPKL---------NQEQAIAIASINSQRGFGCYLLHGVTGSGKTEVYLNLIKPVLE 243

Query: 245 LGKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGV 304
            GKQ L+L+PEI LT   + RF+KRF V     HS L+ + R   W         +++G 
Sbjct: 244 AGKQALVLVPEIGLTPQTINRFRKRFTVPVEVIHSGLNDTERLNAWLAARDKVAGIVIGT 303

Query: 305 RSALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIES 364
           RSAL  PF  LG+I++DEEHD SYKQ++ + Y+ARD++++R  +E  P+VL SATP++E+
Sbjct: 304 RSALLTPFADLGIIIVDEEHDASYKQQDSLRYHARDVAVMRANLEQVPIVLGSATPALET 363

Query: 365 RVNGISRRYHSVHLSTRYRNSALPHL-QVIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQ 423
             N ++ +YH + L+ R   +ALP   +V+D++G  +  G  LS  +I  +R  L++  Q
Sbjct: 364 LHNALTGKYHHLQLTQRA-GTALPTTNRVLDVKGLYLESG--LSAPLIAEMRRHLSQGNQ 420

Query: 424 TLLFLNRRGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCG 483
            LLFLNRRG++P  +C  CG    C  C  +   H+   ++ CH CG        C  CG
Sbjct: 421 VLLFLNRRGFSPALMCHECGWIANCQRCDAYYTYHQHSSEIRCHHCGSQRPVIHQCQGCG 480

Query: 484 SSGKMIACGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGT 543
           S+  ++  G G E++  ++ E FP  +   +  D     G L+  L AI +GE  I+IGT
Sbjct: 481 ST-HLVTVGVGTEQLEAQLSELFPEYKAIRIDRDSTRRKGSLESALGAIRRGEYQILIGT 539

Query: 544 QLVAKGHNFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAY 603
           Q++AKGH+FP ++LV ++D D  L ++D R+SER  QL  QV GRAGR       ++Q +
Sbjct: 540 QMLAKGHHFPDVTLVALLDVDGSLYSSDFRASERLAQLFIQVAGRAGRASKPGEVVLQTH 599

Query: 604 QPTHPVMQALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENY----AYN 659
            P H ++QAL+  D   F E+ +  R+   LPP+  L      G + Q VE++     + 
Sbjct: 600 HPEHTLLQALLHNDYSQFAETALAERKLAQLPPYTYLTLFRAEGNQSQPVEDFLRQVRHT 659

Query: 660 LKEHAPRSSDIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSN 717
           L+ H       +V GP  +PL    G++R++LL+     S +Q   +        +  ++
Sbjct: 660 LEAHPLCEQGCLVLGPTPAPLAKRAGKFRWQLLLQAPSRSVMQKLLASAKPAIQLLPLAS 719

Query: 718 ALRVQFDIDPQNF 730
            +R   DI+PQ+ 
Sbjct: 720 KVRWSLDIEPQDL 732


>gi|168233041|ref|ZP_02658099.1| putative primosomal protein N' [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194442479|ref|YP_002043358.1| primosome assembly protein PriA [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194472960|ref|ZP_03078944.1| primosomal protein N' [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194401142|gb|ACF61364.1| primosomal protein N' [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194459324|gb|EDX48163.1| primosomal protein N' [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|205332780|gb|EDZ19544.1| putative primosomal protein N' [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 732

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 241/725 (33%), Positives = 380/725 (52%), Gaps = 36/725 (4%)

Query: 28  YIYSVPSAMKVELGSIVRVPL-RSRTVLGIVWYNSEE-KYKIDSLKLRPIEYVFDCPPLS 85
           + Y +P     + G  VRVP  + +  +GIV   S+  +  +D LK   IE + + P  S
Sbjct: 16  FDYLLPEGGVAKAGCRVRVPFGKQQERVGIVVSVSDHSELPLDELK-SVIEILDNEPIFS 74

Query: 86  RQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR-------INTVAR 138
             +   + W ADY   P+G V    +  L    K          F         IN++ R
Sbjct: 75  PSIWRLLLWAADYYHHPLGDVLFHALPVLLRQGKPASNAPLWYWFATEEGQAVDINSLKR 134

Query: 139 ----LRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNLYF 194
                + L  ++ GKIW  R  +     +   +  L+ +G+ +   E  +P        +
Sbjct: 135 SAKQQQALAALRQGKIW--RYQVAELDFTDATLQTLRRKGLCELASE--TPAFTDWRERY 190

Query: 195 SLP---ILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLI 251
           ++    +    +Q      +   + GF+  L++GVTGSGKTEVYL ++  VL  GKQ L+
Sbjct: 191 AVAGERLRLNTEQATAVGAIHSASDGFSAWLLAGVTGSGKTEVYLSVLENVLAQGKQALV 250

Query: 252 LLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLP 311
           ++PEI LT   + RF++RF       HS L+ S R   W +   G  ++++G RS+LF P
Sbjct: 251 MVPEIGLTPQTIARFRERFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTP 310

Query: 312 FKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISR 371
           FK LG+IVIDEEHD SYKQ+EG  Y+ARD+++ R   E  P++L SATP++E+  N   +
Sbjct: 311 FKNLGVIVIDEEHDSSYKQQEGWRYHARDLAVYRAHSEQIPIILGSATPALETLCNVRQK 370

Query: 372 RYHSVHLSTRYRNSALPHLQ-VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQTLLFLNR 430
           +Y  + L+ R  N A P LQ V+D++GQ +  G  L+P +I  +R  L  + Q +LFLNR
Sbjct: 371 KYRMLRLTRRAGN-ARPALQHVLDLKGQRLQAG--LAPALIARMRQHLQADNQVILFLNR 427

Query: 431 RGYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIA 490
           RG+AP  LC  CG   +C  C  +   H+++  L CH C       + C  CGS+  M+ 
Sbjct: 428 RGFAPALLCHDCGWIAECPRCDHYYTLHQAQHHLRCHHCDSQRPVPRQCPSCGST-HMLP 486

Query: 491 CGFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGH 550
            G G E++ + +  +FP   IS +  D     G L+  L+ + +G   I+IGTQ++AKGH
Sbjct: 487 VGLGTEQLEQVLAPFFPGVPISRIDRDTTSRKGALEQHLAEVHRGGARILIGTQMLAKGH 546

Query: 551 NFPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVM 610
           +FP ++LV ++D D  L +AD RS+ER  QL +QV+GRAGR G +   ++Q + P HP++
Sbjct: 547 HFPDVTLVALLDVDGALFSADFRSAERFAQLYTQVSGRAGRAGKQGEVVLQTHHPEHPLL 606

Query: 611 QALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAY-----NLKEHAP 665
           Q L+    D+F E  +  R+++ LPP+   + VII    +   +   +     NL + +P
Sbjct: 607 QTLLYKGYDAFAEQALAERQTLQLPPW--TSHVIIRAEDHNNQQAPVFLQQLRNLIQASP 664

Query: 666 RSSD-IVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYD--NTIKRSNALRVQ 722
            S D + + GP  +      GRYR+++L+       LQ   S      NT+  +  ++  
Sbjct: 665 LSDDKLWILGPVPALAPKRGGRYRWQILLQHPSRIRLQHIISGTLALINTLPEARKVKWV 724

Query: 723 FDIDP 727
            D+DP
Sbjct: 725 LDVDP 729


>gi|146291658|ref|YP_001182082.1| primosomal protein N' [Shewanella putrefaciens CN-32]
 gi|145563348|gb|ABP74283.1| primosomal protein N' [Shewanella putrefaciens CN-32]
          Length = 731

 Score =  381 bits (979), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 236/730 (32%), Positives = 381/730 (52%), Gaps = 41/730 (5%)

Query: 28  YIYSVPSA--MKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLRP------IEYVF 79
           + Y VP       ++G  V+VP   + ++G+V   +      D+  L P      I+++ 
Sbjct: 17  FSYRVPETYPQTPQIGVRVKVPFGRQQLIGLVTAVT------DTCSLEPKQIKAVIDFID 70

Query: 80  DCPPLSRQMCEFVKWVADYTFSPMG--LVARMVVSALSETEKMEEKIQF-------TGIF 130
           D P L   + +   W A Y F   G  L   + V+     +   +KIQ+         I 
Sbjct: 71  DTPLLPESLYKLTLWAARYYFCSQGQMLTQALPVALRKGLDAAPQKIQYWQLTELGQNIA 130

Query: 131 PRINTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSP 190
           P I   A  +        K    ++ +    +S   +  L+ +G + +  ++    +D  
Sbjct: 131 PEIVKRAPAQKKLLELLKKTSLTQEEVITFAISKTALKALEDKGWVARHEKIAELNLD-- 188

Query: 191 NLYFSLPILDK-----NQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHL 245
             + +  +LD+     N++  +   +    +G+  +L+ G+TGSGKTEVYL ++  +L  
Sbjct: 189 --WRTQLVLDETPHRLNKEQAIAVTILNQQQGYHCTLLEGITGSGKTEVYLAVLEEILKQ 246

Query: 246 GKQVLILLPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVR 305
           GKQ LIL+PEI LT   + RF++RF V  A  HS L+ + R + WRQ   G  ++I+G R
Sbjct: 247 GKQALILVPEIGLTPQTINRFKRRFKVNVAVLHSGLTDNQRLEAWRQARCGQAAIIIGTR 306

Query: 306 SALFLPFKKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESR 365
           SALF P    G+I++DEEHD S+KQ+EG+ Y+ARD++++RG +ES PV+L SATPS+ES 
Sbjct: 307 SALFTPMAYPGMIILDEEHDSSFKQQEGVGYHARDLAVMRGHLESIPVILGSATPSLESL 366

Query: 366 VNGISRRYHSVHLSTRYRNSALPHLQ--VIDMRGQTIAQGKSLSPEMIDGIRHTLARNEQ 423
            N