RPSBLAST alignment for GI: 254780619 and conserved domain: PRK05580

>gnl|CDD|180144 PRK05580, PRK05580, primosome assembly protein PriA; Validated. Length = 679
 Score =  890 bits (2303), Expect = 0.0
 Identities = 296/724 (40%), Positives = 409/724 (56%), Gaps = 54/724 (7%)

Query: 14  SRVIILLLQAVSGPYIYSVPSAMKVELGSIVRVPLRSRTVLGIVWYNSEEKYKIDSLKLR 73
               +LL   +  P+ Y +P  ++V+ G  VRVP  +R ++G+V    EE  ++ + KL+
Sbjct: 3   KIARVLLPVPLPRPFDYLIPEGLEVQPGDRVRVPFGNRKLIGVVV-GVEEGSEVPADKLK 61

Query: 74  PIEYVFDC-PPLSRQMCEFVKWVADYTFSPMGLVARMVVSALSETEKMEEKIQFTGIFPR 132
           PI  V D  P L  ++   + W ADY  SP+G V R+ +                     
Sbjct: 62  PILEVLDLEPLLPPELLRLLDWAADYYLSPLGEVLRLAL--------------------- 100

Query: 133 INTVARLRVLDKIKDGKIWEKRDLIRASQVSSHVIDGLKAQGVIKQIFEVISPVVDSPNL 192
                                 +L  A   SS V+ GL  +G+I+     +  +   P+ 
Sbjct: 101 --------------------LAEL--ALAASSAVLKGLVKKGLIELEEVEVLRLRPPPDP 138

Query: 193 YFSLPILDKNQQDVVEQVVPLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLIL 252
            F  P L+  Q   VE +      GF+  L+ GVTGSGKTEVYL+ +A VL  GKQ L+L
Sbjct: 139 AFEPPTLNPEQAAAVEAIRAA--AGFSPFLLDGVTGSGKTEVYLQAIAEVLAQGKQALVL 196

Query: 253 LPEISLTSAILERFQKRFGVKPAEWHSSLSTSMREKIWRQVARGAISVIVGVRSALFLPF 312
           +PEI+LT  +L RF+ RFG   A  HS LS   R   WR+  RG   V++G RSALFLPF
Sbjct: 197 VPEIALTPQMLARFRARFGAPVAVLHSGLSDGERLDEWRKAKRGEAKVVIGARSALFLPF 256

Query: 313 KKLGLIVIDEEHDISYKQEEGILYNARDMSIVRGKIESFPVVLVSATPSIESRVNGISRR 372
           K LGLI++DEEHD SYKQ+EG  Y+ARD+++VR K+E+ PVVL SATPS+ES  N    R
Sbjct: 257 KNLGLIIVDEEHDSSYKQQEGPRYHARDLAVVRAKLENIPVVLGSATPSLESLANAQQGR 316

Query: 373 YHSVHLSTRYRNSALPHLQVIDMRGQTIAQGKS-LSPEMIDGIRHTLARNEQTLLFLNRR 431
           Y  + L+ R   + LP +++IDMR     +  S LSP +++ I+  L R EQ LLFLNRR
Sbjct: 317 YRLLRLTKRAGGARLPEVEIIDMRELLRGENGSFLSPPLLEAIKQRLERGEQVLLFLNRR 376

Query: 432 GYAPLTLCQVCGNRLKCLHCSCWLVEHRSKKKLYCHQCGHSAIYSQSCVVCGSSGKMIAC 491
           GYAP  LC+ CG   +C HC   L  HR +++L CH CG+     ++C  CGS+  ++  
Sbjct: 377 GYAPFLLCRDCGWVAECPHCDASLTLHRFQRRLRCHHCGYQEPIPKACPECGSTD-LVPV 435

Query: 492 GFGIERIAEEVCEYFPLARISILSSDLEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHN 551
           G G ER+ EE+ E FP ARI  +  D     G L+  L+  A+GE DI+IGTQ++AKGH+
Sbjct: 436 GPGTERLEEELAELFPEARILRIDRDTTRRKGALEQLLAQFARGEADILIGTQMLAKGHD 495

Query: 552 FPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGRFGLKSLGLIQAYQPTHPVMQ 611
           FP ++LVGV+D DLGL + D R+SERTFQLL+QV GRAGR       LIQ Y P HPV+Q
Sbjct: 496 FPNVTLVGVLDADLGLFSPDFRASERTFQLLTQVAGRAGRAEKPGEVLIQTYHPEHPVIQ 555

Query: 612 ALVSGDADSFYESEIRARESVNLPPFGRLAAVIISGTKYQEVENYAYNLKEHAPRS---S 668
           AL++ D D+F E E+  R +   PPFGRLA +  S    ++ E +A  L    P      
Sbjct: 556 ALLAQDYDAFAEQELEERRAAGYPPFGRLALLRASAKDEEKAEKFAQQLAALLPNLLPLL 615

Query: 669 DIVVFGPAESPLFMVRGRYRFRLLIHGKRNSNLQGFFSQMYDNTIKRSNA--LRVQFDID 726
           D+ V GPA +P+  + GRYR++LL+     ++LQ           K   A  +R   D+D
Sbjct: 616 DVEVLGPAPAPIAKIAGRYRYQLLLKSPSRADLQKLLRAWLALLQKLPQARKVRWSIDVD 675

Query: 727 PQNF 730
           PQ+F
Sbjct: 676 PQSF 679