RPSBLAST alignment for GI: 254780619 and conserved domain: PRK10689

>gnl|CDD|182649 PRK10689, PRK10689, transcription-repair coupling factor; Provisional. Length = 1147
 Score = 54.4 bits (131), Expect = 1e-07
 Identities = 37/118 (31%), Positives = 57/118 (48%), Gaps = 5/118 (4%)

Query: 222 LISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRFGVKPA--EWHS 279
           L+ G  G GKTEV +      +   KQV +L+P   L     + F+ RF   P   E  S
Sbjct: 625 LVCGDVGFGKTEVAMRAAFLAVENHKQVAVLVPTTLLAQQHYDNFRDRFANWPVRIEMLS 684

Query: 280 SL-STSMREKIWRQVARGAISVIVGVRSALF--LPFKKLGLIVIDEEHDISYKQEEGI 334
              S   + +I  + A G I +++G    L   + +K LGL+++DEEH    + +E I
Sbjct: 685 RFRSAKEQTQILAEAAEGKIDILIGTHKLLQSDVKWKDLGLLIVDEEHRFGVRHKERI 742