RPSBLAST alignment for GI: 254780619 and conserved domain: COG0556

>gnl|CDD|30902 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]. Length = 663
 Score = 42.9 bits (101), Expect = 3e-04
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 17/100 (17%)

Query: 497 RIAEEVCEYFPLARISI--LSSD---LEGGGGRLQLQLSAIAKGEIDIIIGTQLVAKGHN 551
           ++AE++ EY     I +  L SD   LE    R+++ +  +  GE D+++G  L+ +G +
Sbjct: 457 KMAEDLTEYLKELGIKVRYLHSDIDTLE----RVEI-IRDLRLGEFDVLVGINLLREGLD 511

Query: 552 FPRMSLVGVVDGDLGLTNADLRSSERTFQLLSQVTGRAGR 591
            P +SLV ++D D       LR SER+   L Q  GRA R
Sbjct: 512 LPEVSLVAILDAD---KEGFLR-SERS---LIQTIGRAAR 544