RPSBLAST alignment for GI: 254780619 and conserved domain: COG1197

>gnl|CDD|31390 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]. Length = 1139
 Score = 67.6 bits (165), Expect = 1e-11
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 222 LISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLTSAILERFQKRF---GVKPAEWH 278
           LI G  G GKTEV +      +  GKQV +L+P   L     E F++RF    V+     
Sbjct: 619 LICGDVGFGKTEVAMRAAFKAVMDGKQVAVLVPTTLLAQQHYETFKERFAGFPVRIEVLS 678

Query: 279 SSLSTSMREKIWRQVARGAISVIVGVRSALF--LPFKKLGLIVIDEEHDISYKQEEGI 334
              S   +++I + +A G + +++G    L   + FK LGL++IDEE     K +E +
Sbjct: 679 RFRSAKEQKEILKGLAEGKVDIVIGTHRLLSKDVKFKDLGLLIIDEEQRFGVKHKEKL 736