RPSBLAST alignment for GI: 254780619 and conserved domain: COG1204

>gnl|CDD|31397 COG1204, COG1204, Superfamily II helicase [General function prediction only]. Length = 766
 Score = 42.7 bits (100), Expect = 4e-04
 Identities = 51/230 (22%), Positives = 91/230 (39%), Gaps = 31/230 (13%)

Query: 222 LISGVTGSGKTEV-YLEIVAAVLHLGKQVLILLPEISLTSAILERFQK--RFGVKPAEWH 278
           LIS  TGSGKT +  L I++ +L  G +V+ ++P  +L     E F +    G++     
Sbjct: 51  LISAPTGSGKTLIALLAILSTLLEGGGKVVYIVPLKALAEEKYEEFSRLEELGIRVGIST 110

Query: 279 SSLSTSMREKIWRQVARGAISVIVGVRSALF-------LPFKKLGLIVIDEEHDISYKQE 331
                   E++ R        VIV     L           +++ L+VIDE H +  +  
Sbjct: 111 GDYDLD-DERLARY------DVIVTTPEKLDSLTRKRPSWIEEVDLVVIDEIHLLGDRTR 163

Query: 332 EGILYNARDMSIVRGKIESFPVVLVSAT-PSIES-----RVNGISRRYHSVHLSTRYRNS 385
             +L     ++ +R   E   +V +SAT P+ E          +   +  V L       
Sbjct: 164 GPVL--ESIVARMRRLNELIRIVGLSATLPNAEEVADWLNAKLVESDWRPVPLRRG---- 217

Query: 386 ALPHLQVIDMRGQTIAQGKSLSPEM-IDGIRHTLARNEQTLLFLNRRGYA 434
            +P++               L   + ++ +  +LA   Q L+F++ R  A
Sbjct: 218 -VPYVGAFLGADGKKKTWPLLIDNLALELVLESLAEGGQVLVFVHSRKEA 266