RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780620|ref|YP_003065033.1| iron-responsive transcriptional regulator [Candidatus Liberibacter asiaticus str. psy62] (144 letters) >gnl|CDD|32142 COG1959, COG1959, Predicted transcriptional regulator [Transcription]. Length = 150 Score = 130 bits (327), Expect = 2e-31 Identities = 54/134 (40%), Positives = 81/134 (60%), Gaps = 2/134 (1%) Query: 1 MHLTKRTDYGIRVLMYCAIH-NDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRG 59 M LT + +Y +R L+Y A+ P ++IAE IS +L KIL L KAG+V++VRG Sbjct: 1 MKLTSKGEYALRALLYLALLPGGGPVSSAEIAERQGISPSYLEKILSKLRKAGLVKSVRG 60 Query: 60 RRGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFF 119 + GG RL RP ++IT+ DVV+A E + ECF+ +C +CG+ + KAL+AF Sbjct: 61 KGGGYRLARPPEEITLGDVVRALEGPLALVECFSITNNECN-TPTCGIRAAWLKALDAFL 119 Query: 120 DVLTQYSIECLVRN 133 +VL ++ LV + Sbjct: 120 EVLDNITLADLVED 133 >gnl|CDD|145313 pfam02082, Rrf2, Transcriptional regulator. This family is related to pfam001022 and other transcription regulation families (personal obs: Yeats C). Length = 82 Score = 101 bits (255), Expect = 7e-23 Identities = 39/81 (48%), Positives = 55/81 (67%), Gaps = 1/81 (1%) Query: 3 LTKRTDYGIRVLMYCAIH-NDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGRR 61 L+ +TDY + L+Y A+H + P +IAE IS ++L KIL L KAG+V++VRG Sbjct: 2 LSTKTDYALHALLYLALHPGEGPVTSEEIAERQNISPVYLRKILAKLRKAGLVKSVRGPG 61 Query: 62 GGVRLCRPADQITILDVVKAT 82 GG RL RP ++IT+LDVV+A Sbjct: 62 GGYRLARPPEEITLLDVVRAV 82 >gnl|CDD|33924 COG4189, COG4189, Predicted transcriptional regulator [Transcription]. Length = 308 Score = 36.1 bits (83), Expect = 0.003 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 4/104 (3%) Query: 11 IRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVET--VRGRRGGVRLCR 68 +RV + +H P +++IAEA + + + ++ L KAG++ T V+ R+G ++C Sbjct: 24 VRVAILQLLHRKGPLNVNEIAEALGLPQSTMSANIKVLEKAGLIRTETVKARKGSQKICI 83 Query: 69 PADQITILDVVKATEESFFVAECFAS--HKIDCPLVGSCGLTSV 110 ++ TE + D + CGL S Sbjct: 84 STTDEIEINFPDRTESLDLYIQVAMPLGLYTDFEVEAPCGLCSA 127 >gnl|CDD|38831 KOG3625, KOG3625, KOG3625, Alpha amylase [Carbohydrate transport and metabolism]. Length = 1521 Score = 28.8 bits (64), Expect = 0.63 Identities = 12/34 (35%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 86 FFVAECFA-SHKIDCPLVGSCGLTSVLRKALNAF 118 + VAE F S +D V G++S++R+A++A+ Sbjct: 559 YVVAELFTGSEDLDNVFVNRLGISSLIREAMSAW 592 >gnl|CDD|28974 cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.. Length = 78 Score = 28.4 bits (63), Expect = 0.70 Identities = 18/71 (25%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Query: 11 IRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVR-GRRGGVRLCRP 69 R+ + + P +S++AE +S+ + + L+ L +AG+VE+ R GRR L Sbjct: 8 TRLRILRLLLEG-PLTVSELAERLGLSQSTVSRHLKKLEEAGLVESRREGRRVYYSLTDA 66 Query: 70 ADQITILDVVK 80 + +L+ + Sbjct: 67 ERLLALLESLL 77 >gnl|CDD|37896 KOG2685, KOG2685, KOG2685, Cystoskeletal protein Tektin [Cytoskeleton]. Length = 421 Score = 28.0 bits (62), Expect = 0.97 Identities = 15/71 (21%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Query: 19 IHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVET---VRGRRGGVRLCRPADQITI 75 + + +IA+A E I + +T R R V LCR Q + Sbjct: 290 LEWQLAKTLEEIADAENNIEALERAIRDKEGPLKVAQTRLENRTYRPNVELCRDQAQYRL 349 Query: 76 LDVVKATEESF 86 +D V +++ Sbjct: 350 VDEVHELDDTV 360 >gnl|CDD|35744 KOG0524, KOG0524, KOG0524, Pyruvate dehydrogenase E1, beta subunit [Energy production and conversion]. Length = 359 Score = 27.2 bits (60), Expect = 1.7 Identities = 12/41 (29%), Positives = 15/41 (36%) Query: 64 VRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGS 104 +R RP D TI VK T V E + I + Sbjct: 270 LRSIRPFDIETIGASVKKTNRLVTVEEGWPQFGIGAEICAQ 310 >gnl|CDD|147785 pfam05822, UMPH-1, Pyrimidine 5'-nucleotidase (UMPH-1). This family consists of several eukaryotic pyrimidine 5'-nucleotidase proteins. P5'N-1, also known as uridine monophosphate hydrolase-1 (UMPH-1), is a member of a large functional group of enzymes, characterized by the ability to dephosphorylate nucleic acids. P5'N-1 catalyses the dephosphorylation of pyrimidine nucleoside monophosphates to the corresponding nucleosides. Deficiencies in this proteins function can lead to several different disorders in humans. Length = 246 Score = 26.9 bits (60), Expect = 2.4 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 9/34 (26%) Query: 111 LRKALNAFFDVLTQYSIECLVRNRSSIKKIFNAG 144 LR + FFD L Q +I L IF+AG Sbjct: 91 LRDGYDEFFDKLQQLNIPVL---------IFSAG 115 >gnl|CDD|144617 pfam01090, Ribosomal_S19e, Ribosomal protein S19e. Length = 140 Score = 26.3 bits (59), Expect = 3.1 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Query: 43 KILQPLVKAGIVETV--RGRR 61 K LQ L KAG+VE GRR Sbjct: 99 KALQQLEKAGLVEKDPKGGRR 119 >gnl|CDD|146014 pfam03177, Nucleoporin_C, Non-repetitive/WGA-negative nucleoporin C-terminal. This is the C-termainl half of a family of nucleoporin proteins. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins. Two nucleoporin classes are known: one is characterized by the FG repeat pfam03093; the other is represented by this family, and lacks any repeats. RNA undergoing nuclear export first encounters the basket of the nuclear pore and many nucleoporins are accessible on the basket side of the pore. Length = 548 Score = 26.3 bits (58), Expect = 3.2 Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 3/55 (5%) Query: 5 KRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRG 59 KR + +R L A ND + + E I EL +Q + ++ Sbjct: 395 KRIELLLRKLAALASENDTSDLQELLKE---IEELLEVAKIQEDLLEQLLPADSR 446 >gnl|CDD|63887 cd03556, L-fucose_isomerase, L-fucose isomerase (FucIase); FucIase converts L-fucose, an aldohexose, to its ketose form, which prepares it for aldol cleavage (similar to the isomerization of glucose during glycolysis). L-fucose (or 6-deoxy-L-galactose) is found in blood group determinants as well as in various oligo- and polysaccharides, and glycosides in mammals, bacteria and plants.. Length = 584 Score = 26.1 bits (57), Expect = 3.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Query: 50 KAGIVETVRGRRGGVR 65 K GI T+ GRRGGVR Sbjct: 2 KIGIRPTIDGRRGGVR 17 >gnl|CDD|33238 COG3432, COG3432, Predicted transcriptional regulator [Transcription]. Length = 95 Score = 26.0 bits (57), Expect = 3.5 Identities = 13/64 (20%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Query: 1 MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGR 60 M +R+ I + AI I++I ++ K ++ LV+ G++ Sbjct: 9 MVRKRRSRLEIIFDILKAISEG-GIGITRIIYGANLNYKRAQKYIEMLVEKGLIIKQDNG 67 Query: 61 RGGV 64 R V Sbjct: 68 RRKV 71 >gnl|CDD|31568 COG1378, COG1378, Predicted transcriptional regulators [Transcription]. Length = 247 Score = 25.8 bits (56), Expect = 4.4 Identities = 17/67 (25%), Positives = 30/67 (44%), Gaps = 2/67 (2%) Query: 7 TDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGRRGGVRL 66 T+Y +V + +I+EA + ++ +L+ L K G+VE + GR R Sbjct: 15 TEYEAKVYLALLCLG--EATAKEISEASGVPRPKVYDVLRSLEKKGLVEVIEGRPKKYRA 72 Query: 67 CRPADQI 73 P + I Sbjct: 73 VPPEELI 79 >gnl|CDD|38492 KOG3282, KOG3282, KOG3282, Uncharacterized conserved protein [Function unknown]. Length = 190 Score = 25.7 bits (56), Expect = 4.9 Identities = 10/43 (23%), Positives = 15/43 (34%) Query: 4 TKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQ 46 D M + ND +IA C + L ++K L Sbjct: 67 EVLGDLKGNFKMVLVVRNDLKMGKGKIAAQCAHAALGVYKHLM 109 >gnl|CDD|110930 pfam01978, TrmB, Sugar-specific transcriptional regulator TrmB. One member of this family, TrmB, has been shown to be a sugar-specific transcriptional regulator of the trehalose/maltose ABC transporter in Thermococcus litoralis. Length = 68 Score = 25.6 bits (57), Expect = 5.1 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Query: 7 TDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGR 60 ++Y +V + P +IAE + ++++L+ L K G+VE +GR Sbjct: 7 SEYEAKVYLALLKLG--PATADEIAEESGVPRSKVYEVLRSLEKKGLVEREKGR 58 >gnl|CDD|34621 COG5016, COG5016, Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion]. Length = 472 Score = 25.2 bits (55), Expect = 6.7 Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 49 VKAGIVETVRGRRGGVRLCRPADQI 73 + A ++E + G CRPAD + Sbjct: 383 INAELIEKILGDEEKPITCRPADLL 407 >gnl|CDD|145440 pfam02286, Dehydratase_LU, Dehydratase large subunit. This family contains the large subunit of the trimeric diol dehydratases and glycerol dehydratases. These enzymes are produced by some enterobacteria in response to growth substances. Length = 554 Score = 24.7 bits (54), Expect = 8.6 Identities = 12/21 (57%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Query: 72 QITILDVVKATEESFF--VAE 90 IT LDVVKA ++ F VAE Sbjct: 467 GITGLDVVKALAKTGFTDVAE 487 >gnl|CDD|73264 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins. Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle.. Length = 692 Score = 24.6 bits (53), Expect = 9.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Query: 44 ILQPLVKAGIVETVRGRRGG 63 +L+ L G++ETVR RR G Sbjct: 605 VLRQLRYTGMLETVRIRRAG 624 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.329 0.141 0.428 Gapped Lambda K H 0.267 0.0728 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,647,548 Number of extensions: 77502 Number of successful extensions: 209 Number of sequences better than 10.0: 1 Number of HSP's gapped: 206 Number of HSP's successfully gapped: 23 Length of query: 144 Length of database: 6,263,737 Length adjustment: 85 Effective length of query: 59 Effective length of database: 4,426,972 Effective search space: 261191348 Effective search space used: 261191348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 52 (23.8 bits)