BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780620|ref|YP_003065033.1| iron-responsive transcriptional regulator [Candidatus Liberibacter asiaticus str. psy62] (144 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780620|ref|YP_003065033.1| iron-responsive transcriptional regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 144 Score = 296 bits (758), Expect = 1e-82, Method: Compositional matrix adjust. Identities = 144/144 (100%), Positives = 144/144 (100%) Query: 1 MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGR 60 MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGR Sbjct: 1 MHLTKRTDYGIRVLMYCAIHNDYPNRISQIAEACCISELFLFKILQPLVKAGIVETVRGR 60 Query: 61 RGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFD 120 RGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFD Sbjct: 61 RGGVRLCRPADQITILDVVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFD 120 Query: 121 VLTQYSIECLVRNRSSIKKIFNAG 144 VLTQYSIECLVRNRSSIKKIFNAG Sbjct: 121 VLTQYSIECLVRNRSSIKKIFNAG 144 >gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Score = 23.1 bits (48), Expect = 2.4, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Query: 78 VVKATEESFFVAECFASHKIDCPLVGSCGLTSVLRKALNAFFDVLTQYSIECLVRNRSS 136 VV +T F+ + AS + L SC S++ + + L QY +E N+SS Sbjct: 74 VVSSTVAGIFIVKGIASFVQNYYL--SCAGNSIIAEQQRKIYRRLLQYGMEFYDSNQSS 130 >gi|255764513|ref|YP_003065530.2| glutamyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 22.7 bits (47), Expect = 2.8, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 75 ILDVVKATEESFFVAECFASHKIDCPL 101 I+D++K T+E F V + + I+ L Sbjct: 399 IIDILKTTQEEFEVIQIWKRENIETAL 425 >gi|254781149|ref|YP_003065562.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 266 Score = 22.7 bits (47), Expect = 2.9, Method: Compositional matrix adjust. Identities = 9/36 (25%), Positives = 21/36 (58%), Gaps = 4/36 (11%) Query: 89 AECFASHKIDCPLVGSCGLTSVLRKALNAFFDVLTQ 124 A+ A H D +C +++RK++ +F D++++ Sbjct: 55 AKALALHTSDP----TCNTATLIRKSMQSFEDIISE 86 >gi|254780945|ref|YP_003065358.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Score = 21.9 bits (45), Expect = 5.2, Method: Compositional matrix adjust. Identities = 10/30 (33%), Positives = 17/30 (56%) Query: 74 TILDVVKATEESFFVAECFASHKIDCPLVG 103 T L V+K TE+ F +AE + + ++G Sbjct: 606 TRLSVLKNTEDGFLIAEEDLKQRKEGEILG 635 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.329 0.141 0.428 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,774 Number of Sequences: 1233 Number of extensions: 2838 Number of successful extensions: 10 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 6 length of query: 144 length of database: 328,796 effective HSP length: 66 effective length of query: 78 effective length of database: 247,418 effective search space: 19298604 effective search space used: 19298604 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 34 (17.7 bits)