RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780621|ref|YP_003065034.1| small heat shock protein [Candidatus Liberibacter asiaticus str. psy62] (157 letters) >gnl|CDD|182691 PRK10743, PRK10743, heat shock protein IbpA; Provisional. Length = 137 Score = 139 bits (351), Expect = 4e-34 Identities = 66/138 (47%), Positives = 93/138 (67%), Gaps = 3/138 (2%) Query: 1 MR-LDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPS 59 MR D+S +Y SA+G+D + ++L+ YPPY++E EN YRI IAV+GF S Sbjct: 1 MRNFDLSPLYRSAIGFDRLFNLLEN-NQSQSNGGYPPYNVELVDENHYRIAIAVAGFAES 59 Query: 60 EITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLY 119 E+ I ++L+V+G E+KE YL++GIA+R FER+FQLA+ + V A+L NGLLY Sbjct: 60 ELEITAQDNLLVVKGAHADEQKER-TYLYQGIAERNFERKFQLAENIHVRGANLVNGLLY 118 Query: 120 LELLRSVPERMKPRRIEI 137 ++L R +PE KPRRIEI Sbjct: 119 IDLERVIPEAKKPRRIEI 136 >gnl|CDD|183223 PRK11597, PRK11597, heat shock chaperone IbpB; Provisional. Length = 142 Score = 120 bits (303), Expect = 2e-28 Identities = 53/142 (37%), Positives = 92/142 (64%), Gaps = 5/142 (3%) Query: 1 MR-LDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPS 59 MR D+S + +G+D + + L G ++PPY+IE++ +N YRIT+A++GF Sbjct: 1 MRNYDLSPLLRQWIGFDKLANALQNAGESQ---SFPPYNIEKSDDNHYRITLALAGFRQE 57 Query: 60 EITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLY 119 ++ I+++ + L V+G + EKE V++LH+G+ + F F LA+ +EV A+ NGLL+ Sbjct: 58 DLDIQLEGTRLTVKGTPEQPEKE-VKWLHQGLVNQPFSLSFTLAENMEVSGATFVNGLLH 116 Query: 120 LELLRSVPERMKPRRIEISQSP 141 ++L+R+ PE + P+RI IS+ P Sbjct: 117 IDLIRNEPEAIAPQRIAISERP 138 >gnl|CDD|148048 pfam06209, COBRA1, Cofactor of BRCA1 (COBRA1). This family consists of several cofactor of BRCA1 (COBRA1) like proteins. It is thought that COBRA1 along with BRCA1 is involved in chromatin unfolding. COBRA1 is recruited to the chromosome site by the first BRCT repeat of BRCA1, and is itself sufficient to induce chromatin unfolding. BRCA1 mutations that enhance chromatin unfolding also increase its affinity for, and recruitment of, COBRA1. It is thought that that reorganisation of higher levels of chromatin structure is an important regulated step in BRCA1-mediated nuclear functions. Length = 475 Score = 34.0 bits (78), Expect = 0.018 Identities = 26/88 (29%), Positives = 35/88 (39%), Gaps = 16/88 (18%) Query: 19 LSMLD-GLGA----PSQTSAYPPYDIERTGENAYRITIAVSGFHPSEITIEVDSSILMVR 73 L ML G GA SQ P D E V+ F P+ +++ VD S + Sbjct: 237 LRMLSLGQGAWDMIDSQVFKEPRLDDE-----------LVTKFLPALMSLMVDDSTFNLE 285 Query: 74 GEKKSEEKETVEYLHRGIAKRAFERRFQ 101 + +EKE+V Y AF R Q Sbjct: 286 QKLPEDEKESVLYSDPTTLPDAFTRFLQ 313 >gnl|CDD|180884 PRK07207, PRK07207, ribonucleotide-diphosphate reductase subunit alpha; Validated. Length = 965 Score = 30.7 bits (70), Expect = 0.17 Identities = 22/77 (28%), Positives = 32/77 (41%), Gaps = 13/77 (16%) Query: 27 APSQTSAYPPYD-IERTGENAYRITIAVSGFHPSEITIEVDSSILMVRGEKKSEE---KE 82 A + Y I R G +V F PS+I + + + L V G + + +E Sbjct: 24 AAAAPGQLADYKVIRRNG--------SVVPFEPSKIAVAMTKAFLAVEGGQAAASARVRE 75 Query: 83 TVEYLHRGIAKRAFERR 99 TVE L + RA RR Sbjct: 76 TVEQLTEQVV-RALVRR 91 >gnl|CDD|183437 PRK12322, PRK12322, NADH dehydrogenase subunit D; Provisional. Length = 366 Score = 28.9 bits (65), Expect = 0.52 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 10/87 (11%) Query: 57 HPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRF-QLADFVEVMS--ASL 113 HPS T V +L + GE E + YLHRG K A ++ Q+ + + M +++ Sbjct: 15 HPS--THGVFRLVLKIDGEIIVEATPVIGYLHRGTEKLAESLQYTQIIPYTDRMDYLSAM 72 Query: 114 ENGLLYLELLRS-----VPERMKPRRI 135 N +Y + + VPER + R+ Sbjct: 73 TNNYVYCHAVETMMGLEVPERAEYLRV 99 >gnl|CDD|148968 pfam07654, C1-set, Immunoglobulin C1-set domain. Length = 83 Score = 28.8 bits (65), Expect = 0.58 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 5/38 (13%) Query: 53 VSGFHPSEITIEVDSSILMVRGEKKSEEKETVEYLHRG 90 V+GF+P +IT+ + G++ +E E+ E L G Sbjct: 17 VTGFYPPDITVT-----WLKNGQEVTEGVESTEELPNG 49 >gnl|CDD|149449 pfam08389, Xpo1, Exportin 1-like protein. The sequences featured in this family are similar to a region close to the N-terminus of yeast exportin 1 (Xpo1, Crm1). This region is found just C-terminal to an importin-beta N-terminal domain (pfam03810) in many members of this family. Exportin 1 is a nuclear export receptor that interacts with leucine-rich nuclear export signal (NES) sequences, and Ran-GTP, and is involved in translocation of proteins out of the nucleus. Length = 147 Score = 28.3 bits (64), Expect = 0.96 Identities = 12/54 (22%), Positives = 25/54 (46%), Gaps = 9/54 (16%) Query: 102 LADFVEVMSASLENGLLYLELLRSVPERMKPRRIEISQSPQESTKMIEEKKKSV 155 D V ++S+S L L +L+ +PE EI + T + ++++ + Sbjct: 28 FPDLVSLLSSSPSGCELLLRILKVLPE-------EIFDFSR--TPLTQQRRNRL 72 >gnl|CDD|128685 smart00407, IGc1, Immunoglobulin C-Type. Length = 75 Score = 27.3 bits (61), Expect = 1.6 Identities = 9/33 (27%), Positives = 17/33 (51%), Gaps = 5/33 (15%) Query: 53 VSGFHPSEITIEVDSSILMVRGEKKSEEKETVE 85 VSGF+P +IT+ + G++ + T + Sbjct: 8 VSGFYPPDITVT-----WLRNGQEVTSGVSTTD 35 >gnl|CDD|179089 PRK00698, tmk, thymidylate kinase; Validated. Length = 205 Score = 26.7 bits (60), Expect = 2.4 Identities = 25/106 (23%), Positives = 40/106 (37%), Gaps = 34/106 (32%) Query: 51 IAVSGFHPSEITI--EVDSSILMVR----GEKKSEEKETVEYLHRGIAKRAFERRFQLAD 104 A+ GF P ++T+ +V + + R GE E+E +++ R Sbjct: 121 FALGGFRP-DLTLYLDVPPEVGLARIRARGELDRIEQEGLDFFERVREG----------- 168 Query: 105 FVEVMSASLENGLLYLELLRSVPERMKPRRIEISQSPQESTKMIEE 150 YLEL PER+ I+ SQS +E + I Sbjct: 169 --------------YLELAEKEPERIV--VIDASQSLEEVHEDILA 198 >gnl|CDD|184639 PRK14346, PRK14346, lipoate-protein ligase B; Provisional. Length = 230 Score = 26.6 bits (59), Expect = 2.6 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Query: 28 PSQTSAYPPYDIERTG----ENAYRITIAV 53 P Q AYP D+ R G E YRI AV Sbjct: 77 PGQVVAYPLIDLRRAGYFVKEYVYRIEEAV 106 >gnl|CDD|178037 PLN02416, PLN02416, probable pectinesterase/pectinesterase inhibitor. Length = 541 Score = 26.8 bits (59), Expect = 2.6 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Query: 83 TVEYLHRGIAK-RAFERRFQLADFVEVMSASLENGLLYLELLRSVPERMKPR 133 TV L R +++ +A + R +LAD +SA+L N LE L S +KP+ Sbjct: 119 TVSSLKRSVSRIQAGDSR-KLADARAYLSAALTNKNTCLEGLDSASGPLKPK 169 >gnl|CDD|181617 PRK09034, PRK09034, aspartate kinase; Reviewed. Length = 454 Score = 26.3 bits (59), Expect = 3.3 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 8/40 (20%) Query: 57 HPSEITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAF 96 +P E+ IE D +I+MV GE + G+A + Sbjct: 375 NPDELEIEHDLAIIMVVGEGMRQ--------TVGVAAKIT 406 >gnl|CDD|183856 PRK13055, PRK13055, putative lipid kinase; Reviewed. Length = 334 Score = 25.0 bits (55), Expect = 8.5 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 38 DIERTGENAYRITIAVSGFHPSEITIEVDSSI 69 DI R E+ Y I IA G +E+T V S + Sbjct: 126 DIGRANEDKYFINIAAGG-SLTELTYSVPSQL 156 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.131 0.348 Gapped Lambda K H 0.267 0.0799 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,484,418 Number of extensions: 151148 Number of successful extensions: 255 Number of sequences better than 10.0: 1 Number of HSP's gapped: 252 Number of HSP's successfully gapped: 25 Length of query: 157 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 71 Effective length of database: 4,136,185 Effective search space: 293669135 Effective search space used: 293669135 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (24.1 bits)