BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780621|ref|YP_003065034.1| small heat shock protein [Candidatus Liberibacter asiaticus str. psy62] (157 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780621|ref|YP_003065034.1| small heat shock protein [Candidatus Liberibacter asiaticus str. psy62] Length = 157 Score = 317 bits (813), Expect = 5e-89, Method: Compositional matrix adjust. Identities = 157/157 (100%), Positives = 157/157 (100%) Query: 1 MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSE 60 MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSE Sbjct: 1 MRLDVSRIYNSAVGYDTVLSMLDGLGAPSQTSAYPPYDIERTGENAYRITIAVSGFHPSE 60 Query: 61 ITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLYL 120 ITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLYL Sbjct: 61 ITIEVDSSILMVRGEKKSEEKETVEYLHRGIAKRAFERRFQLADFVEVMSASLENGLLYL 120 Query: 121 ELLRSVPERMKPRRIEISQSPQESTKMIEEKKKSVAA 157 ELLRSVPERMKPRRIEISQSPQESTKMIEEKKKSVAA Sbjct: 121 ELLRSVPERMKPRRIEISQSPQESTKMIEEKKKSVAA 157 >gi|254780495|ref|YP_003064908.1| superoxide dismutase [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Score = 23.5 bits (49), Expect = 1.8, Method: Compositional matrix adjust. Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 81 KETVEYLHRGIAKRAFERRFQLADFVEVMSASLE 114 KET+EY H K + +LA E++ SLE Sbjct: 21 KETLEYHHDVHHKNYADNALKLASDAEMLHLSLE 54 >gi|254780384|ref|YP_003064797.1| serralysin [Candidatus Liberibacter asiaticus str. psy62] Length = 665 Score = 23.5 bits (49), Expect = 1.9, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 29/69 (42%), Gaps = 9/69 (13%) Query: 1 MRLDVSRIYNSAVGYDTVLSM--------LDGLGAP-SQTSAYPPYDIERTGENAYRITI 51 + D + ++ +G T+LS GL P S YP Y ++ EN +T Sbjct: 102 INFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTS 161 Query: 52 AVSGFHPSE 60 +S F P + Sbjct: 162 VMSYFMPQD 170 >gi|254780684|ref|YP_003065097.1| flagellum-specific ATP synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Score = 21.9 bits (45), Expect = 4.9, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 112 SLENGLLYLELLRSVPERMKPRRIE 136 SL G L +E++ VP M +R+E Sbjct: 118 SLGKGDLSMEIMSKVPPAMNRQRVE 142 >537021.9.peg.817_1 Length = 148 Score = 21.2 bits (43), Expect = 9.0, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 114 ENGLLYLELLRSVPERMKPRR 134 EN L Y E+L + R+ PR+ Sbjct: 34 ENALAYYEILELILFRLIPRK 54 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.131 0.348 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,371 Number of Sequences: 1233 Number of extensions: 3332 Number of successful extensions: 9 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 8 length of query: 157 length of database: 328,796 effective HSP length: 67 effective length of query: 90 effective length of database: 246,185 effective search space: 22156650 effective search space used: 22156650 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 35 (18.1 bits)