HHsearch alignment for GI: 254780622 and conserved domain: KOG1205

>KOG1205 consensus.
Probab=94.19  E-value=0.29  Score=27.96  Aligned_cols=28  Identities=14%  Similarity=0.216  Sum_probs=15.4

Q ss_pred             ECCCCCHHHHHH-HHHHHHHHHHHH--CCCC
Q ss_conf             405660000038-899999998640--0013
Q gi|254780622|r  122 APAMNFMMWAKP-ATQRNVEILQKD--GCYF  149 (405)
Q Consensus       122 aPaMn~~M~~~p-~~~~nl~~L~~~--g~~v  149 (405)
T Consensus       116 ~~~mdtN~~G~V~~Tk~alp~m~~r~~GhIV  146 (282)
T KOG1205         116 RNVMDTNVFGTVYLTKAALPSMKKRNDGHIV  146 (282)
T ss_pred             HHHHHHHCHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             8771000402489999998876632897499