HHsearch alignment for GI: 254780622 and conserved domain: TIGR02197

>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; InterPro: IPR011912 Lipopolysaccharides (LPS) are glycolipids that consitutes the outer monolayer of the outer membranes of most Gram-negative bacteria . They consist of lipid A (endotoxin) which anchors LPS to the outer membrane, a non-repeating core oligosachharide, and an immunogenic O-antigen repeat polymer, which is an oligosaccharide of 1-40 units that variesbetween different strains of bacteria. Although the O-antigen and most of the core domain are not necessary for growth in the lab, they appear to help bacteria resist environmental stresses including the complement system and antibiotics. This family consists of examples of ADP-L-glycero-D-mannoheptose-6-epimerase, an enzyme involved in biosynthesis of the inner core of LPS in Gram-negative bacteria . This enzyme is homologous to UDP-glucose 4-epimerase (IPR005886 from INTERPRO) and belongs to the NAD dependent epimerase/dehydratase family. It participates in the biosynthetic pathway leading to incorporation of heptose, a conserved sugar, into the core region of LPS, performing the reaction shown below: ADP-D-glycero-D-manno-heptose = ADP-L-glycero-D-manno-heptose It is a homopentameric enzyme with each monomer composed of two domains: an N-terminal modified Rossman fold domain for NADP binding, and a C-terminal substrate binding domain.; GO: 0008712 ADP-glyceromanno-heptose 6-epimerase activity, 0050661 NADP binding, 0005975 carbohydrate metabolic process.
Probab=90.18  E-value=0.92  Score=24.68  Aligned_cols=114  Identities=16%  Similarity=0.186  Sum_probs=54.1

Q ss_pred             CCCCCEEEEEECCCHHEECCEEEEECCCCCHHHHHHHHHHHH--CCCCEEEEECCCCCCCCCCEEEEEHHHHHHHHHHHH
Q ss_conf             017977898404201010213576215772788999999982--588389984156677656746754657789999998
Q gi|254780622|r  189 LLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAY--FGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVL  266 (405)
Q Consensus       189 ~l~gk~vlITaG~T~E~ID~VR~ItN~SSGk~G~~iA~~~~~--~Ga~V~li~g~~~~~~~~~~~~i~v~t~~em~~~~~  266 (405)
T Consensus       184 q~~GLrYFNVYGP~E~H-----------KG~MASv~f~~~~q~~~~~~v~LF~~~-~~~~~dGeQ~RDFVYV~DV~~~n~  251 (353)
T TIGR02197       184 QVVGLRYFNVYGPREYH-----------KGKMASVAFHLFNQIKAGGNVKLFKSH-KEGFKDGEQLRDFVYVKDVVKVNL  251 (353)
T ss_pred             CEEEEEECCCCCCCCCC-----------CCCHHHHHHHHHHHHHHCCCCCCCCCC-CCCCCCCCCCCCCEEHHHHHHHHH
T ss_conf             42410211346888675-----------443699999988899737882023566-858988781101155276999999


Q ss_pred             HCCC----CCEE---EEE----HHHHHHHHHHHH--HCC-CCCCCCCCCCEEEEEECHHHHH
Q ss_conf             5058----8879---974----044444322221--011-2334557751045521806898
Q gi|254780622|r  267 KALP----VDIA---VMV----SAVSDWRFPKIA--GTK-IKRKDIGDTMRIDLMENPDILK  314 (405)
Q Consensus       267 ~~~~----~D~~---I~a----AAVSDf~~~~~~--~~K-ikk~s~~~~l~L~L~~~pdIL~  314 (405)
T Consensus       252 ~~~~~~~~SGifN~GtG~ArsF~dla~a~~~~~~~~~~~~LSl~~lv~~~~i~Yi~~Pe~lr  313 (353)
T TIGR02197       252 WLLENPSKSGIFNVGTGKARSFNDLADAVFKALGTNKGEPLSLKELVEDFKIEYIDMPEALR  313 (353)
T ss_pred             HHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHCCCCCEECCCHHHH
T ss_conf             99848898415644778886689999999998731468885779887306720102835740