BLAST/PSIBLAST alignment of GI: 254780622 and GI: 327192066 at iteration 1
>gi|327192066|gb|EGE59047.1| phosphopantothenate-cysteine ligase/phosphopantothenoylcysteine decarboxylase protein [Rhizobium etli CNPAF512] Length = 402
 Score =  457 bits (1176), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 227/402 (56%), Positives = 292/402 (72%), Gaps = 2/402 (0%)

Query: 1   MDLSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRV 60
           M LSGK+I LI+ G +A YKSLDLIRRLRERGA V P+MTK AQ+F+TPL VGA++   V
Sbjct: 1   MALSGKRILLIIAGGIAAYKSLDLIRRLRERGASVRPIMTKGAQEFVTPLAVGALAADHV 60

Query: 61  YTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVL 120
           +  L S ++  +  HI+LA +CDL+++APASA+ +A +A+G+  DLAS +LLA   +PVL
Sbjct: 61  FVDLFSRQDEQDVGHIRLARDCDLVLIAPASADLMAKMANGLADDLASTVLLATA-RPVL 119

Query: 121 IAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITW 180
            APAMN  MWA PAT+RN   L++DG  F+GP +G MAES+  G+GRM+EP DI+     
Sbjct: 120 AAPAMNPRMWAHPATRRNAARLREDGIRFVGPMAGEMAESHEAGLGRMAEPLDIVAAAET 179

Query: 181 LLYKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISG 240
           +L +  E  LKG++A+VTSGPT+EP+DP+RYIANRSSG+QGHAIA +LA  GAEV L+SG
Sbjct: 180 ML-EDGEKPLKGRKAIVTSGPTHEPIDPVRYIANRSSGRQGHAIAAALAKLGAEVTLVSG 238

Query: 241 PVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGD 300
           PV+IADP  V T+HVERAE+M   VL ALP DIAVMV+AV+DWR    A  K+K+     
Sbjct: 239 PVTIADPVGVHTVHVERAEEMRDAVLAALPADIAVMVAAVADWRVASAADQKLKKHPGES 298

Query: 301 TMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPD 360
              + L ENPDILK +GHH  RP +V+GFAAETQ +E NAR KL  KGAD IV+N + P 
Sbjct: 299 IPTLALTENPDILKTVGHHTMRPKLVIGFAAETQDVESNARAKLERKGADMIVANDVSPA 358

Query: 361 TGFVGKEWNKVSIVFPDKIEEYPELPKAEVADRLCHLIVEHL 402
           TG +G   N V ++  D +E +P+L K EVA+RL  LI EH 
Sbjct: 359 TGIMGGSRNSVKLIRHDGVERWPDLAKEEVAERLAALIAEHF 400