RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780622|ref|YP_003065035.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Candidatus Liberibacter asiaticus str. psy62] (405 letters) >gnl|CDD|30801 COG0452, Dfp, Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism]. Length = 392 Score = 332 bits (853), Expect = 1e-91 Identities = 178/402 (44%), Positives = 249/402 (61%), Gaps = 14/402 (3%) Query: 3 LSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRVYT 62 L GK+I L + GS+A YKS++L+R LR GA V VMT+SA+KFITPL A+S VYT Sbjct: 2 LEGKRILLGVTGSIAAYKSVELVRLLRRSGAEVRVVMTESARKFITPLTFQALSGNPVYT 61 Query: 63 HLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVLIA 122 L G HI+LA DLL+VAPA+AN IA +A G+ +L++ LLA P+++A Sbjct: 62 LLDEELTG-SVEHIELARWADLLLVAPATANTIAKLAVGIADNLSTTTLLAA-KAPLVLA 119 Query: 123 PAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITWLL 182 PAMN +M+ PATQ N++ L+ +G FI P G +A+ G GR++EP +I+ LL Sbjct: 120 PAMNVIMYTHPATQENLQRLKSEGVLFIEPIEGELADV---GDGRLAEPEEIVEAALALL 176 Query: 183 YKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPV 242 LKGK+ L+T+GPT E +DP+R+I+NRSSG+ G A+A + GA V L+SGP Sbjct: 177 KTPD---LKGKKVLITAGPTREYIDPVRFISNRSSGKMGFALAAAAKRRGASVTLVSGPT 233 Query: 243 SIADPPNVMTIHVERAEDMLQEVLK-ALPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGDT 301 S+ P V + VE AE+ML VL+ ALP DI + +AV+D+R +A KI K G+ Sbjct: 234 SLKIPAGVEVVKVESAEEMLNAVLEAALPADIFISAAAVADYRPKWVAEAKI--KKQGEP 291 Query: 302 MRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPDT 361 +++L+ NPDIL + + +I+VGFAAET I + AREKL K D IV+N + Sbjct: 292 FKLELVPNPDILASVARDYPKKNILVGFAAETGDIVEYAREKLERKNLDLIVANDV--SE 349 Query: 362 GFVGKEWNKVSIVFPDK-IEEYPELPKAEVADRLCHLIVEHL 402 G + N+V I+ D E PE+ K E+A+R+ I E L Sbjct: 350 IGFGSDDNEVRIIDKDGEDVELPEMSKEELAERILDEIAELL 391 >gnl|CDD|146655 pfam04127, DFP, DNA / pantothenate metabolism flavoprotein. The DNA/pantothenate metabolism flavoprotein (EC:4.1.1.36) affects synthesis of DNA, and pantothenate metabolism. Length = 197 Score = 136 bits (344), Expect = 1e-32 Identities = 73/193 (37%), Positives = 108/193 (55%), Gaps = 18/193 (9%) Query: 191 KGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVS--IADPP 248 KG+R LVTSG T EP+DP+R+I+N SSG+ G AIA+ GA+V LI+G S Sbjct: 1 KGRRVLVTSGGTREPIDPVRFISNFSSGKMGAAIAEEFLKRGADVTLIAGKGSLKPEPSG 60 Query: 249 NVMTIHVERAEDMLQEVLKALP--VDIAVMVSAVSDWRFPKIAGTKIKRKDIGDTMRIDL 306 N++ I VE AE+ML + + P D+ ++ +AVSD+R ++A KI G + ++L Sbjct: 61 NLLIIPVETAEEMLNALKEIAPDLHDVFILAAAVSDFRPKEMAEHKISS---GSELTLEL 117 Query: 307 MENPDILKIIGHHQCRPSI-VVGFAAETQCIEQN----AREKLLNKGADFIVSNCILPDT 361 NP I+ + P+ +VGF AET E+ AR+KL D +++N D Sbjct: 118 KPNPKIISYVKEWN--PNAFLVGFKAETGVDEEELIDKARKKLEKYNHDLVIAN----DV 171 Query: 362 GFVGKEWNKVSIV 374 G + N+V IV Sbjct: 172 EGFGTDKNRVIIV 184 >gnl|CDD|145534 pfam02441, Flavoprotein, Flavoprotein. This family contains diverse flavoprotein enzymes. This family includes epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN. This enzyme catalyses the removal of two reducing equivalents from the cysteine residue of the C-terminal meso-lanthionine of epidermin to form a --C==C-- double bond. This family also includes the B chain of dipicolinate synthase a small polar molecule that accumulates to high concentrations in bacterial endospores, and is thought to play a role in spore heat resistance, or the maintenance of heat resistance. dipicolinate synthase catalyses the formation of dipicolinic acid from dihydroxydipicolinic acid. This family also includes phenylacrylic acid decarboxylase (EC:4.1.1.-). Length = 118 Score = 117 bits (296), Expect = 6e-27 Identities = 50/121 (41%), Positives = 76/121 (62%), Gaps = 5/121 (4%) Query: 6 KKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRVYTHLL 65 KKI L + GS A K+L L+R L++ GA V +++K+A+KFITP + A+ VYT Sbjct: 1 KKILLGITGSSAAIKALRLLRELKKEGAEVRVILSKAAKKFITPETLEALLGNPVYT--- 57 Query: 66 SYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLA--KGDQPVLIAP 123 + HI+L+ DL+VVAPA+AN +A +A+G+ +L + LA K +P++IAP Sbjct: 58 DENDEGAPIHIELSRWADLMVVAPATANTLAKIANGIADNLLTRAALAALKERKPLVIAP 117 Query: 124 A 124 A Sbjct: 118 A 118 >gnl|CDD|35891 KOG0672, KOG0672, KOG0672, Halotolerance protein HAL3 (contains flavoprotein domain) [Inorganic ion transport and metabolism, Cell cycle control, cell division, chromosome partitioning]. Length = 218 Score = 75.4 bits (185), Expect = 2e-14 Identities = 59/186 (31%), Positives = 100/186 (53%), Gaps = 14/186 (7%) Query: 8 IALIMCGSVAVYKSLDLIRRLRE---RGAVVIPV-MTKSAQKFITPLIVGAISNRRVYTH 63 + L GSVAV K LI++L E R + I V +TKSA F+ L + +YT Sbjct: 23 VLLGATGSVAVIKLPLLIKKLEEIYGRDKISIQVVVTKSATHFLEKLKLNKHVQ--LYTD 80 Query: 64 LLSYKEGYESN----HIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLA-KGDQP 118 +K + HI+L D+L++AP SAN +A +A+G+ +L ++++ A +P Sbjct: 81 EDEWKMWKSRSDPVLHIELRRWADILLIAPLSANTLAKIANGLCDNLLTSVIRAWDPSKP 140 Query: 119 VLIAPAMNFMMWAKPATQRNVEILQKD--GCYFIGPESGAMAESNGYGVGRMSEPCDIIR 176 +L+APAMN +MW P T++++ L+++ G I P + + G+G M+E I+ Sbjct: 141 ILLAPAMNTLMWNNPMTKKHLTSLKEEYPGITVIKPIEKVLICGD-IGLGGMAEWGTIVS 199 Query: 177 QITWLL 182 ++ L Sbjct: 200 KVRRKL 205 >gnl|CDD|31239 COG1036, COG1036, Archaeal flavoproteins [Energy production and conversion]. Length = 187 Score = 38.0 bits (88), Expect = 0.005 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Query: 83 DLLVVAPASANFIAHVAHGMVYDLA--SAILLAKGDQPVLIAP 123 D L+VAPA++N +A +A+G+ L + KG PV I P Sbjct: 90 DFLLVAPATSNTVAKIAYGIADTLVTNAVAQAGKGKVPVYIVP 132 >gnl|CDD|37939 KOG2728, KOG2728, KOG2728, Uncharacterized conserved protein with similarity to phosphopantothenoylcysteine synthetase/decarboxylase [General function prediction only]. Length = 302 Score = 34.2 bits (78), Expect = 0.060 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 3/52 (5%) Query: 190 LKGKR-ALVTSGPTYEPLD--PMRYIANRSSGQQGHAIAKSLAYFGAEVILI 238 L+G+R LVTSG T PL+ +R+I N S+G +G A A+ G VI + Sbjct: 28 LQGRRIVLVTSGGTTVPLEQNTVRFIDNFSAGTRGAASAEYFLAAGYAVIFL 79 >gnl|CDD|30512 COG0163, UbiX, 3-polyprenyl-4-hydroxybenzoate decarboxylase [Coenzyme metabolism]. Length = 191 Score = 32.5 bits (74), Expect = 0.22 Identities = 23/104 (22%), Positives = 45/104 (43%), Gaps = 4/104 (3%) Query: 6 KKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFI---TPLIVGAISNRRVYT 62 K+I + + G+ + L+ LRE G V++K+A+K + T + Sbjct: 3 KRIIVGISGASGAIYGVRLLEVLRELGVETHLVISKAAKKTLKYETGNDESLGEVLALAD 62 Query: 63 HLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDL 106 + K+ + + D +++AP S +A +AHG +L Sbjct: 63 VVHDEKD-IGAPIASGSFRTDGMIIAPCSMKTLAAIAHGFADNL 105 >gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose. Prokaryotic UDP-Glucose Pyrophosphorylase (UGPase) catalyzes a reversible production of UDP-Glucose and pyrophosphate (PPi) from glucose-1-phosphate and UTP. UDP-glucose plays pivotal roles in galactose utilization, in glycogen synthesis, and in the synthesis of the carbohydrate moieties of glycolipids , glycoproteins , and proteoglycans. UGPase is found in both prokaryotes and eukaryotes, although prokaryotic and eukaryotic forms of UGPase catalyze the same reaction, they share low sequence similarity. Length = 267 Score = 32.1 bits (74), Expect = 0.31 Identities = 22/97 (22%), Positives = 40/97 (41%), Gaps = 5/97 (5%) Query: 74 NHIQLANECDLL--VVAPASANFIAHVAHGMVYDLASAILLAK---GDQPVLIAPAMNFM 128 ++ + DLL V + I +V L A+L AK GD+P + + + Sbjct: 72 ETLEKKGKTDLLEEVRIISDLANIHYVRQKEPLGLGHAVLCAKPFIGDEPFAVLLGDDLI 131 Query: 129 MWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGV 165 +P ++ +E +K G I E + + YG+ Sbjct: 132 DSKEPCLKQLIEAYEKTGASVIAVEEVPPEDVSKYGI 168 >gnl|CDD|31231 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]. Length = 251 Score = 29.8 bits (66), Expect = 1.4 Identities = 29/156 (18%), Positives = 54/156 (34%), Gaps = 38/156 (24%) Query: 190 LKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVSIADPPN 249 L GK ALVT SSG G AIA++LA GA V++ + Sbjct: 3 LSGKVALVTGA---------------SSGI-GRAIARALAREGARVVVAARRSEEEAAEA 46 Query: 250 V------------------MTIHVERAEDMLQEVLKAL-PVDIAVMVSAVSDWRFPKIAG 290 + ++ E E ++ + +DI V + ++ P Sbjct: 47 LAAAIKEAGGGRAAAVAADVSDDEESVEALVAAAEEEFGRIDILVNNAGIAGPDAP---L 103 Query: 291 TKIKRKDIGDTMRIDLMENPDILKIIGHHQCRPSIV 326 ++ +D + ++L+ + + + IV Sbjct: 104 EELTEEDWDRVIDVNLLGAFLLTRAALPLMKKQRIV 139 >gnl|CDD|144716 pfam01225, Mur_ligase, Mur ligase family, catalytic domain. This family contains a number of related ligase enzymes which have EC numbers 6.3.2.*. This family includes: MurC, MurD, MurE, MurF, Mpl and FolC. MurC, MurD, Mure and MurF catalyse consecutive steps in the synthesis of peptidoglycan. Peptidoglycan consists of a sheet of two sugar derivatives, with one of these N-acetylmuramic acid attaching to a small pentapeptide. The pentapeptide is is made of L-alanine, D-glutamic acid, Meso-diaminopimelic acid and D-alanyl alanine. The peptide moiety is synthesized by successively adding these amino acids to UDP-N-acetylmuramic acid. MurC transfers the L-alanine, MurD transfers the D-glutamate, MurE transfers the diaminopimelic acid, and MurF transfers the D-alanyl alanine. This family also includes Folylpolyglutamate synthase that transfers glutamate to folylpolyglutamate. Length = 76 Score = 29.4 bits (67), Expect = 1.9 Identities = 12/49 (24%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Query: 220 QGHAIAKSLAYFGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVLKA 268 G A+S GA + +S + P V I V + L E+ Sbjct: 27 DGSDFAESAIALGAVAV-VSSAIPRDPNPEVPGIPVIDRREALAELAAR 74 >gnl|CDD|36999 KOG1788, KOG1788, KOG1788, Uncharacterized conserved protein [Function unknown]. Length = 2799 Score = 29.3 bits (65), Expect = 2.1 Identities = 20/83 (24%), Positives = 37/83 (44%), Gaps = 8/83 (9%) Query: 196 LVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILIS-------GPVSIADPP 248 + T P++ + +++SSG QG + +L +V+L + GP S A Sbjct: 2028 ISTPHPSHISVSEFDASSDQSSGSQGSSAVHTLFTISPKVLLETDESGYGGGPCS-AGAS 2086 Query: 249 NVMTIHVERAEDMLQEVLKALPV 271 V+ E D++ E +KA+ Sbjct: 2087 AVLDFMAEVCADIMTEQIKAVQA 2109 >gnl|CDD|30968 COG0623, FabI, Enoyl-[acyl-carrier-protein]. Length = 259 Score = 29.0 bits (65), Expect = 2.5 Identities = 25/95 (26%), Positives = 37/95 (38%), Gaps = 28/95 (29%) Query: 188 LLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVSIADP 247 LL+GKR L+ +AN S IAK+LA GAE+ Sbjct: 2 GLLEGKRILIMG------------VANNRS--IAWGIAKALAEQGAELAF---------- 37 Query: 248 PNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVSD 282 T ER E ++E+ + L D+ + +D Sbjct: 38 ----TYQGERLEKRVEELAEELGSDLVLPCDVTND 68 >gnl|CDD|145578 pfam02514, CobN-Mg_chel, CobN/Magnesium Chelatase. This family contains a domain common to the cobN protein and to magnesium protoporphyrin chelatase. CobN is implicated in the conversion of hydrogenobyrinic acid a,c-diamide to cobyrinic acid. Magnesium protoporphyrin chelatase is involved in chlorophyll biosynthesis. Length = 1064 Score = 28.7 bits (65), Expect = 3.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Query: 24 LIRRLRERGAVVIPV 38 LIR L RG VIPV Sbjct: 91 LIRALEARGLNVIPV 105 >gnl|CDD|31163 COG0821, GcpE, Enzyme involved in the deoxyxylulose pathway of isoprenoid biosynthesis [Lipid metabolism]. Length = 361 Score = 28.6 bits (64), Expect = 3.4 Identities = 28/130 (21%), Positives = 46/130 (35%), Gaps = 25/130 (19%) Query: 296 KDIGDTMRIDLMENP--------DILKIIGHHQCRPSIV-------VGFAAETQCIEQNA 340 + IGDT+R+ L +P +IL+ +G ++ F E Sbjct: 224 EGIGDTIRVSLTADPVEEVKVAQEILQSLGLRSRGVEVIACPTCGRTEFDVIQTLNEVEQ 283 Query: 341 REKLLNKGADFIVSNCIL--------PDTGFVGKEWNKVSIVFPDKIEEYPELPKAEVAD 392 R + L V C++ D G G K S K E +LP+ ++ + Sbjct: 284 RLEHLKTPLKVAVMGCVVNGPGEAKHADIGIAGG--GKGSGPVFVKGEIIKKLPEEDIVE 341 Query: 393 RLCHLIVEHL 402 L LI + Sbjct: 342 ELEALIEAYA 351 >gnl|CDD|143916 pfam00148, Oxidored_nitro, Nitrogenase component 1 type Oxidoreductase. Length = 398 Score = 28.4 bits (64), Expect = 4.0 Identities = 16/92 (17%), Positives = 29/92 (31%), Gaps = 25/92 (27%) Query: 190 LKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISGPVS------ 243 L GKR + P +A+ L G EV+ + Sbjct: 270 LAGKRVAIYGDPDLA-----------------WGLARFLEELGMEVVAVGTGTGHPDDYE 312 Query: 244 --IADPPNVMTIHVERAEDMLQEVLKALPVDI 273 A + + + + L+E++K L D+ Sbjct: 313 RLKALLDGTLRVIDDADLEELEELIKELKPDL 344 >gnl|CDD|32697 COG2870, RfaE, ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane]. Length = 467 Score = 27.9 bits (62), Expect = 4.5 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Query: 258 AEDMLQEVLKALPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGDTMRIDLMENPDILKIIG 317 ED +E+++A+ DI V D++ KI G I G+ + I E KII Sbjct: 405 DEDTPEELIEAVKPDILV---KGGDYKIEKIVGADIVEAYGGEVLLIPFEEGKSTTKIIE 461 >gnl|CDD|153131 cd01581, AcnB, Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle. Aconitase B catalytic domain. Aconitate hydratase B catalyses the formation of cis-aconitate from citrate as part of the TCA cycle. Aconitase has an active (4FE-4S) and an inactive (3FE-4S) form. The active cluster is part of the catalytic site that interconverts citrate, cis-aconitase and isocitrate. The domain architecture of aconitase B is different from other aconitases in that the catalytic domain is normally found at C-terminus for other aconitases, but it is at N-terminus for B family. It also has a HEAT domain before domain 4 which plays a role in protein-protein interaction. This alignment is the core domain including domains 1,2 and 3. Length = 436 Score = 27.8 bits (62), Expect = 5.4 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 11/66 (16%) Query: 97 HVAHGMVYDLASAILLAKGDQPVLIAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGA 156 ++ H + A+ IL K +P + W P T+ + ILQ++G Y I ++GA Sbjct: 330 NIGH---FRAAAKILRGKEFKPTRL--------WVAPPTRMDWAILQEEGYYSIFGDAGA 378 Query: 157 MAESNG 162 E G Sbjct: 379 RTEMPG 384 >gnl|CDD|147488 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3. This family consists of several eukaryotic proteins which are homologous to the yeast RRN3 protein. RRN3 is one of the RRN genes specifically required for the transcription of rDNA by RNA polymerase I (Pol I) in Saccharomyces cerevisiae. Length = 550 Score = 27.6 bits (62), Expect = 5.7 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 16/46 (34%) Query: 309 NPDILKIIGHHQCRPSIVVGFAAETQ------C---IEQNAREKLL 345 NP LK C PS+V FA + C IE+N RE+L Sbjct: 464 NP--LKY-----CLPSVVTEFARIARHLQLVYCYSIIERNKRERLS 502 >gnl|CDD|147425 pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase. Length = 430 Score = 27.4 bits (61), Expect = 6.6 Identities = 27/120 (22%), Positives = 35/120 (29%), Gaps = 21/120 (17%) Query: 218 GQQGHAIAKSLAYFGAEVILISGPVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMV 277 G G A SL GA VI V+ DP LQ ++ V + Sbjct: 219 GDVGKGCAASLRGQGARVI-----VTEIDPICA-----------LQAAMEGYQV--VTLE 260 Query: 278 SAVSDWRFPKIAGTKIKRKDIGDTMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIE 337 V D I T DI M+ I+ IGH C + + Sbjct: 261 EVVKD---ADIFVTTTGCVDIIVGRHFMNMKKDAIVCNIGHFDCEIDVGWLNYNAKKITN 317 >gnl|CDD|34719 COG5117, NOC3, Protein involved in the nuclear export of pre-ribosomes [Translation, ribosomal structure and biogenesis / Intracellular trafficking and secretion]. Length = 657 Score = 27.4 bits (60), Expect = 8.2 Identities = 10/46 (21%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Query: 269 LPVDIAVMVSAVSDW---RFPKIAGTKIKRKDIGDTMRIDLMENPD 311 P + + +S R+ + K DIG + NPD Sbjct: 576 SPEEFKGAILDISAKLDIRYSDCSNLKCSEFDIGAGNVDSIPSNPD 621 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0737 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,902,438 Number of extensions: 260752 Number of successful extensions: 755 Number of sequences better than 10.0: 1 Number of HSP's gapped: 739 Number of HSP's successfully gapped: 34 Length of query: 405 Length of database: 6,263,737 Length adjustment: 96 Effective length of query: 309 Effective length of database: 4,189,273 Effective search space: 1294485357 Effective search space used: 1294485357 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 58 (26.1 bits)