HHsearch alignment for GI: 254780623 and conserved domain: cd05168

>cd05168 PI4Kc_III_beta Phosphoinositide 4-kinase (PI4K), Type III, beta isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes. PI4KIIIbeta (also called Pik1p in yeast) is a 110 kDa protein that is localized to the Golgi and the nucleus. It is required for maintaining the structural integrity of the Golgi complex (GC), and is a key regulator of protein transport from the GC to the plasma membrane. PI4KII
Probab=95.26  E-value=0.29  Score=28.91  Aligned_cols=30  Identities=33%  Similarity=0.562  Sum_probs=24.9

Q ss_pred             CCCCCCCEEEEECCCCEEEEECCHHEECCH
Q ss_conf             178786228980289535743403121698
Q gi|254780623|r  285 HADLHPGNLFVDSKGYIVAVDMGITGRLSK  314 (517)
Q Consensus       285 HaDPHpGNi~v~~dg~i~~lDfG~vg~l~~  314 (517)
T Consensus       145 IgDRHn~NImi~~~Ghl~HIDFGfiLg~~p  174 (293)
T cd05168         145 IKDRHNGNILIDNDGHIIHIDFGFMLSNSP  174 (293)
T ss_pred             CCCCCCCCEEECCCCCEEEEEHHHHHCCCC
T ss_conf             566578864788988899874245534588