RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780623|ref|YP_003065036.1| 2-polyprenylphenol 6-hydroxylase [Candidatus Liberibacter asiaticus str. psy62] (517 letters) >gnl|CDD|31005 COG0661, AarF, Predicted unusual protein kinase [General function prediction only]. Length = 517 Score = 430 bits (1107), Expect = e-121 Identities = 198/518 (38%), Positives = 303/518 (58%), Gaps = 14/518 (2%) Query: 1 MKEYYELFRIAWILIREGVIVSLPSDRLPPIIVF--GKKIASLFVRRNIKKCQRSDRLAR 58 + L RI + +R + L +++ S + +R++RL Sbjct: 4 LYAVSRLPRIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLASSEELREKRAERLRL 63 Query: 59 AMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAPIEE 118 A+ LGP+++K+GQ L+TRPDL+ + +E+LA LQD++ FP A + L PIEE Sbjct: 64 ALEELGPTFIKLGQILSTRPDLVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEE 123 Query: 119 LYCEFDD-PIAAASIAQVHPAVVHDINGYRKVAVKIIRPGVRKRFFRDIQVMYLIARIQE 177 L+ EF+ PIA+ASIAQVH AV+ +VAVK+ RPG+R+R D++++ +AR+ + Sbjct: 124 LFSEFEPEPIASASIAQVHRAVLKS---GEEVAVKVQRPGIRERIEADLKLLRRLARLIK 180 Query: 178 KLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVPKIDWNRTER 237 +L P RRL VV E+ + E+D R EAA EN D VPK+ W T R Sbjct: 181 RLPPGGRRLDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTR 240 Query: 238 DVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDS 297 V+TMEWIDG+KISD L++ G D + L+ LV++FL LRDGFFHAD HPGN+ V S Sbjct: 241 RVLTMEWIDGIKISDIAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRS 300 Query: 298 KGYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFSFAQA 357 G IV +D GI GRL + RR+LAE+L F++RDY RVA++H E GYVP +R A A Sbjct: 301 DGRIVLLDFGIVGRLDPKFRRYLAELLLAFLNRDYDRVAELHVELGYVPPDTDRDPLAAA 360 Query: 358 IRAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLNPE 417 IRA+ EPI+G+ + IS G++L LFE+ F M PELV+LQ+T+++VEGV R L+P Sbjct: 361 IRAVLEPIYGKPLEEISFGEILDKLFEVARRFPMRLPPELVLLQRTLLLVEGVGRQLDPR 420 Query: 418 FNMWVSSEPIVEEWIRDHLGAKSCVVDFQDGIKTAFRLVQAAPQLSISVEKILKSLVESS 477 FN+W ++P++ +W++ L K + + +D + P+ +L+ L+++ Sbjct: 421 FNLWAVAQPLLAKWLKKQLSPK-LLRELKDEAVAVLNALPLLPR-------LLRDLLDND 472 Query: 478 VKDKYLDFPKKESSRVYDFLNKLVLWSIFGALLYIISI 515 ++ L ++ + + + +L + SI +L + + Sbjct: 473 REELSLRSSEELALLLLKAVARLSIGSILLVVLAVTVL 510 >gnl|CDD|36449 KOG1235, KOG1235, KOG1235, Predicted unusual protein kinase [General function prediction only]. Length = 538 Score = 211 bits (537), Expect = 5e-55 Identities = 111/402 (27%), Positives = 188/402 (46%), Gaps = 27/402 (6%) Query: 55 RLARAMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKA 114 RL R G +Y+K+GQ L+TRPDL+ K+ + L+ LQD+ FP A L A Sbjct: 96 RLLELFLRNGGTYIKLGQHLSTRPDLLPKEYVKTLSELQDQAPPFPWEEAFKIFEEELGA 155 Query: 115 PIEELYCEFDD-PIAAASIAQVHPAVVHDINGYRKVAVKIIRPGVRKRFFRDIQVMYLIA 173 PIE+++ EFD+ PIAAAS+AQVH A + + VAVK+ PG+ K D++ + L+A Sbjct: 156 PIEDIFSEFDEEPIAAASLAQVHRARLKN---GEDVAVKVQHPGLEKLIMLDLRNLRLLA 212 Query: 174 RIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAA---FSEMAENTVKDQGFRVPKI 230 ++ +K P +V + + E+D EA F E ++ VPK+ Sbjct: 213 KVLQKFFPDFD---LVWLVDEIAKSLPQELDFTKEAKNAERFRENFKDFSLLTYVLVPKV 269 Query: 231 DWNRTERDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHP 290 W+ + + V+TME++DG+KI+D + + G + LV+++L + GFFHAD HP Sbjct: 270 YWDLSTKRVLTMEYVDGIKINDLDAIDKRGISPHDILNKLVEAYLEQIFKTGFFHADPHP 329 Query: 291 GNLFVDSKGY----IVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVP 346 GN+ V IV +D G+ +S + R+ AE+ + D + + + + G Sbjct: 330 GNILVRPNPEGDEEIVLLDHGLYAVISHKTRKDYAELWLALVFEDEKAMQALAEQLGLGL 389 Query: 347 RHH---------NRFSFAQAIRAIGEPIHGQSSDVISMGKLLTMLFE-ITELFDMMTRPE 396 R + I + + G D K+ + F I++L M R Sbjct: 390 DDLYPLFATALTGRPWDSVIGAGITKYLKGLEEDADENQKIASAKFPGISQLLRRMPREI 449 Query: 397 LVMLQKTMVV---VEGVARMLNPEFNMWVSSEPIVEEWIRDH 435 L++L+ ++ + + E + + + + Sbjct: 450 LLILKTNDLLRGLSSNLGIPSSLERSFLEMARLCLRLSLALL 491 >gnl|CDD|111949 pfam03109, ABC1, ABC1 family. This family includes ABC1 from yeast and AarF from E. coli. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex and E. coli AarF is required for ubiquinone production. It has been suggested that members of the ABC1 family are novel chaperonins. These proteins are unrelated to the ABC transporter proteins. Length = 117 Score = 117 bits (295), Expect = 9e-27 Identities = 48/123 (39%), Positives = 68/123 (55%), Gaps = 7/123 (5%) Query: 110 SALKAPIEELYCEFDD-PIAAASIAQVHPAVVHDINGYRKVAVKIIRPGVRKRFFRDIQV 168 L AP+EE++ EFD+ PIAAASIAQVH AV+ D +VAVK+ RPGV+KR D+++ Sbjct: 1 EELGAPVEEVFAEFDEEPIAAASIAQVHRAVLKD---GEEVAVKVQRPGVKKRIRSDLKL 57 Query: 169 MYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVP 228 + +A+I +K P +V + E+D EAA + EN VP Sbjct: 58 LKFLAKILKKFFPGFDLD---WLVDEFRKSLPQELDFLREAANAEKFRENFADLPWVYVP 114 Query: 229 KID 231 K+ Sbjct: 115 KVY 117 >gnl|CDD|36450 KOG1236, KOG1236, KOG1236, Predicted unusual protein kinase [General function prediction only]. Length = 565 Score = 109 bits (274), Expect = 2e-24 Identities = 87/439 (19%), Positives = 172/439 (39%), Gaps = 62/439 (14%) Query: 56 LARAMNRLGPSYVKMGQFLATRPDLIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAP 115 L +A+ GP+++K+GQ+ +TR DL K L+ L + + + A Sbjct: 124 LLKALETAGPTFIKLGQWASTRRDLFSKAFCAQLSKLHSNVTPHSFAFTKKKLRQAFGVK 183 Query: 116 -IEELYCEFDD-PIAAASIAQVHPAVVH-------------DINGYRKVAVKIIRPGVRK 160 IEE++ EF+ PI + IAQV+ A + G + A+K++ P V K Sbjct: 184 KIEEIFSEFNREPIGSGCIAQVYRATLKTAYLEKDSGKEYVQKLGTQSCAIKVLHPNVEK 243 Query: 161 RFFRDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTV 220 + D+ ++ A++ +P + L V+ ++DLR EA N Sbjct: 244 QIRLDLGILGFGAKLIN-NVPDLSWLSLPLEVKQFSVGLNAQVDLRQEALHLPRFTNNFS 302 Query: 221 KDQGFRVPKIDWNRTERDVITMEWIDGVKISDTEKLRACGHDL-ERLSVTLVQSFLLHTL 279 + PK V+ + G+ + K ++ L ++++ V + L + Sbjct: 303 GSKKVLFPKPIAPLHTDLVLVETYERGLSVLRFVKWKSQPEALVKKVAKLGVNALLKMLI 362 Query: 280 RDGFFHADLHPGNL---FVDSKGY------------------------------------ 300 D F HADLHPGN+ F ++ Sbjct: 363 VDNFVHADLHPGNVLIRFNKTEDNLRGVHKAEKASAIKRGLEWFRSEVRDARFTDSPDLE 422 Query: 301 ----IVAVDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFSFAQ 356 +V +D GI +LS + + L + D ++ E + + FA+ Sbjct: 423 YEPTLVFLDTGIVTKLSHQNQMNLLSLFRAVARFDGYDAGELMLERSRQQQCIDPERFAR 482 Query: 357 AI-RAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLN 415 + + + + +S +++G LL+ +F + + + +++V+EG R L+ Sbjct: 483 KVEKLVLKARSTKSLRTLNIGDLLSEMFTMVREHHVRIDSNFTTVVLSILVLEGFGRQLD 542 Query: 416 PEFNMWVSSEPIVE-EWIR 433 P+ +++ ++ WI+ Sbjct: 543 PDLDLFQLRTFLLNVAWIK 561 >gnl|CDD|36448 KOG1234, KOG1234, KOG1234, ABC (ATP binding cassette) 1 protein [General function prediction only]. Length = 363 Score = 63.8 bits (155), Expect = 1e-10 Identities = 70/297 (23%), Positives = 119/297 (40%), Gaps = 19/297 (6%) Query: 80 LIGKKLSEDLALLQDKMDFFPTNTARLSVASALKAPIEELYCEFDD-PIAAASIAQVHPA 138 L+ L + L ++ DF P + L + + FDD P AAASI QVH A Sbjct: 9 LLPPTLGQILERVRQSADFMPPKQLEPVMWGELGGNWAQKFSSFDDGPFAAASIGQVHRA 68 Query: 139 VVHDINGYRKVAVKIIRPGVRKRFFRDIQVMYLIARIQEKLLPSMRRLCFSAVVRALEQV 198 + D +VAVKI PGV + D + + LLP + L ++ + Sbjct: 69 RLAD---GPEVAVKIQYPGVARSIDSDANNLSRLLNFS-GLLP--KGLFLDVLIEVARKE 122 Query: 199 TKMEMDLRLEAAAFSEMAENTVKDQGFRVPKIDWNRTERDVITMEWIDGVKISDTEKLRA 258 K E D + EAA+ + D F VP++ V+T+E G+ I T KL Sbjct: 123 LKWECDYQREAASALKFRPLLSDDPNFYVPRVVDELCTVRVLTLELGQGLPIDKTAKLSQ 182 Query: 259 CGHDL---ERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGY-IVAVDMGITGRLSK 314 + + L + L + F F D + N + + I +D G + + Sbjct: 183 ETRNYIGYKLLELCLREIFEFR-----FMQTDPNWSNFLYNGRTKKIELLDFGASREYGE 237 Query: 315 RERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRF---SFAQAIRAIGEPIHGQ 368 + +L RD + V ++ E G++ + ++ + +++ +GEP Sbjct: 238 KFIDKYIRLLKAAADRDREGVIEMSRELGFLTGYESKVMEDAHVESVMILGEPFASD 294 >gnl|CDD|88274 cd05144, RIO2_C, RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH domains may be involved in RNA recognition. RIO2 is essential for survival and is necessary for rRNA cleavage during 40S ribosomal subunit maturation. The biological substrates of RIO2 are still unknown.. Length = 198 Score = 46.7 bits (111), Expect = 1e-05 Identities = 34/126 (26%), Positives = 52/126 (41%), Gaps = 13/126 (10%) Query: 185 RLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAE----NTVKDQGFRVPK-IDWNRTERDV 239 R F V R + + + L + + E + ++GF VPK IDWNR Sbjct: 51 RTSFRKVKRKRDYLGDRKHASWLYLSRLAAQKEFAALKALYEEGFPVPKPIDWNR---HA 107 Query: 240 ITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKG 299 + ME+IDGV++ L L+ + +V + G H DL N+ VD Sbjct: 108 VVMEYIDGVELYRVRVLEDPEEVLDEILEEIV-----KAYKHGIIHGDLSEFNILVDDDE 162 Query: 300 YIVAVD 305 I +D Sbjct: 163 KIYIID 168 >gnl|CDD|30826 COG0478, COG0478, RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms]. Length = 304 Score = 45.6 bits (108), Expect = 3e-05 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 12/126 (9%) Query: 185 RLCFSAVVRALEQVTKME----MDLRLEAAAFSEMAENTVKDQGFRVPK-IDWNRTERDV 239 R F V R + + E + + AA A + +G +VPK I WNR Sbjct: 127 RTSFRKVKRNRDYLADKEHGSWLYVSRLAAEREFEALQRLYPEGVKVPKPIAWNR---HA 183 Query: 240 ITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKG 299 + ME+I+GV++ +LR + + + +++ + R G H DL N+ V G Sbjct: 184 VVMEYIEGVELY---RLRLDVENPDEILDKILE-EVRKAYRRGIVHGDLSEFNILVTEDG 239 Query: 300 YIVAVD 305 IV +D Sbjct: 240 DIVVID 245 >gnl|CDD|88612 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine.. Length = 155 Score = 39.7 bits (92), Expect = 0.002 Identities = 31/137 (22%), Positives = 49/137 (35%), Gaps = 10/137 (7%) Query: 172 IARIQEKLLPSMRRLCFSAVVRALEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVPKI- 230 I ++ L + L L+ E E + +G VPK+ Sbjct: 3 IKLLKGGLTNRVYLLGTKDEDYVLKINPSREKGADREREV---AILQLLARKGLPVPKVL 59 Query: 231 -DWNRTERDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRD-GFFHADL 288 + MEWI+G + + + E+L+ L + LH L H DL Sbjct: 60 ASGESDGWSYLLMEWIEGETLDEVSEE-EKEDIAEQLAELLAK---LHQLPLLVLCHGDL 115 Query: 289 HPGNLFVDSKGYIVAVD 305 HPGN+ VD + +D Sbjct: 116 HPGNILVDDGKILGIID 132 >gnl|CDD|145007 pfam01636, APH, Phosphotransferase enzyme family. This family consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include: aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation. This family also includes homoserine kinase. This family is related to fructosamine kinase pfam03881. Length = 239 Score = 38.7 bits (90), Expect = 0.003 Identities = 22/77 (28%), Positives = 27/77 (35%), Gaps = 15/77 (19%) Query: 275 LLHTLRDGFFHADLHPGNLFVDSKGYIVAV-------------DMGITGRLSKRER--RF 319 LL L H DLHPGNL VD G + V D+ R E Sbjct: 161 LLPALPPVLVHGDLHPGNLLVDPGGRVSGVIDFEDAGLGDPAYDLASLLRSLGEELGAEL 220 Query: 320 LAEILYGFISRDYQRVA 336 LA L + + R+ Sbjct: 221 LAAYLAAYGAPGPARLR 237 >gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplication. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. This subfamily also contains fungal NDR-like kinases. Length = 364 Score = 37.0 bits (86), Expect = 0.012 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEIL 324 +H L G+ H D+ P NL +D+KG+I D G+ L K R IL Sbjct: 117 IHKL--GYIHRDIKPDNLLLDAKGHIKLSDFGLCTGLKKSHRTEFYRIL 163 >gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates its downstream target, c-Jun N-terminal kinase (JNK), on specific threonine and tyrosine residues. Although MKK7 is capable of dual phosphorylation, it prefers to phosphorylate the threonine residue of JNK. Thus, optimal activation of JNK requires both MKK4 (not included in this subfamily) and MKK7. MKK7 is primarily activated by cytokines. MKK7 is essential for liver formation during embryogenesis. It plays roles in G2/M cell cycle arrest and cell growth. In addition, it is involved in the control of programmed cell death, which is crucial in oncogenesis, cancer chemoresistance, and antagonism to TNFalpha-induced killing, through its inhibition by Gadd45beta and the subsequent suppression of the JNK cascade. Length = 296 Score = 37.0 bits (86), Expect = 0.014 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 4/52 (7%) Query: 263 LERLSVTLVQSFLLHTLRD--GFFHADLHPGNLFVDSKGYIVAVDMGITGRL 312 L +++V +V++ LH L++ G H D+ P N+ +D+ G + D GI+GRL Sbjct: 116 LGKMTVAIVKA--LHYLKEKHGVIHRDVKPSNILLDASGNVKLCDFGISGRL 165 >gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, muscle, lung and spleen. It is not an essential protein because mice deficient of NDR1 remain viable and fertile. However, these mice develop T-cell lymphomas and appear to be hypersenstive to carcinogenic treatment. NDR1 appears to act as a tumor suppressor. NDR1 is also called STK38. Length = 363 Score = 36.6 bits (84), Expect = 0.015 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRER 317 +H L GF H D+ P NL +DSKG++ D G+ L K R Sbjct: 117 IHQL--GFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHR 156 >gnl|CDD|36201 KOG0983, KOG0983, KOG0983, Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms]. Length = 391 Score = 36.5 bits (84), Expect = 0.016 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 4/52 (7%) Query: 263 LERLSVTLVQSFLLHTLRD--GFFHADLHPGNLFVDSKGYIVAVDMGITGRL 312 L +++V +V++ L+ L++ G H D+ P N+ +D +G I D GI+GRL Sbjct: 193 LGKMTVAIVKA--LYYLKEKHGVIHRDVKPSNILLDERGNIKLCDFGISGRL 242 >gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowing autophosphorylation and activation of the kinase. cGKI is a soluble protein expressed in all smooth muscles, platelets, cerebellum, and kidney. It is also expressed at lower concentrations in other tissues. cGKII is a membrane-bound protein that is most abundantly expressed in the intestine. It is also present in the brain nuclei, adrenal cortex, kidney, lung, and prostate. cGKI is involved in the regulation of smooth muscle tone, smooth cell proliferation, and platelet activation. cGKII plays a role in the regulation of secretion, such as renin secretion by the kidney and aldosterone secretion by the adrenal. It also regulates bone growth and the circadian rhythm. Length = 262 Score = 36.4 bits (85), Expect = 0.018 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRER 317 LH G + DL P NL +DS GY+ VD G +L ++ Sbjct: 109 LHNR--GIIYRDLKPENLLLDSNGYVKLVDFGFAKKLKSGQK 148 >gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regulating neuronal growth and differentiation, as well as in facilitating neurite outgrowth. It is also implicated in fear conditioning as it contributes to the coupling of neuronal morphological changes with fear-memory consolidation. NDR2 is also referred to as STK38-like. Length = 360 Score = 36.2 bits (83), Expect = 0.021 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRER 317 +H L GF H D+ P NL +D+KG++ D G+ L K R Sbjct: 117 IHQL--GFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHR 156 >gnl|CDD|35825 KOG0605, KOG0605, KOG0605, NDR and related serine/threonine kinases [General function prediction only]. Length = 550 Score = 36.1 bits (83), Expect = 0.026 Identities = 15/38 (39%), Positives = 24/38 (63%) Query: 280 RDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRER 317 + G+ H D+ P NL +D+KG+I D G++ L K+ R Sbjct: 259 QLGYIHRDIKPDNLLIDAKGHIKLSDFGLSTGLDKKHR 296 >gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downstream targets, extracellular signal-regulated kinase (ERK) 1 and ERK2, on specific threonine and tyrosine residues. The ERK cascade starts with extracellular signals including growth factors, hormones, and neurotransmitters, which act through receptors and ion channels to initiate intracellular signaling that leads to the activation at the MAPKKK (Raf-1 or MOS) level, which leads to the transmission of signals to MEK2, and finally to ERK1/2. The ERK cascade plays an important role in cell proliferation, differentiation, oncogenic transformation, and cell cycle control, as well as in apoptosis and cell survival under certain conditions. Gain-of-function mutations in genes encoding ERK cascade proteins, including MEK2, cause cardiofaciocutaneous (CFC) syndrome, a condition leading to multiple congenital anomalies and mental retardation in patients. Length = 331 Score = 35.8 bits (82), Expect = 0.030 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 2/75 (2%) Query: 240 ITMEWIDGVKISDT--EKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDS 297 I ME +DG + E R L ++S+ +++ + H D+ P N+ V+S Sbjct: 80 ICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNS 139 Query: 298 KGYIVAVDMGITGRL 312 +G I D G++G+L Sbjct: 140 RGEIKLCDFGVSGQL 154 >gnl|CDD|35801 KOG0581, KOG0581, KOG0581, Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms]. Length = 364 Score = 34.9 bits (80), Expect = 0.049 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 4/76 (5%) Query: 240 ITMEWIDGVKISDTEKL--RACGHDLERLSVTLVQSF-LLHTLRDGFFHADLHPGNLFVD 296 I ME++DG + D K R L +++ +++ LH R H D+ P NL V+ Sbjct: 155 ICMEYMDGGSLDDILKRVGRIPEPVLGKIARAVLRGLSYLHEER-KIIHRDIKPSNLLVN 213 Query: 297 SKGYIVAVDMGITGRL 312 SKG + D G++G L Sbjct: 214 SKGEVKICDFGVSGIL 229 >gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downstream targets, extracellular signal-regulated kinase (ERK) 1 and ERK2, on specific threonine and tyrosine residues. The ERK cascade starts with extracellular signals including growth factors, hormones, and neurotransmitters, which act through receptors and ion channels to initiate intracellular signaling that leads to the activation at the MAPKKK (Raf-1 or MOS) level, which leads to the transmission of signals to MEK1, and finally to ERK1/2. The ERK cascade plays an important role in cell proliferation, differentiation, oncogenic transformation, and cell cycle control, as well as in apoptosis and cell survival under certain conditions. Gain-of-function mutations in genes encoding ERK cascade proteins, including MEK1, cause cardiofaciocutaneous (CFC) syndrome, a condition leading to multiple congenital anomalies and mental retardation in patients. MEK1 also plays a role in cell cycle control. Length = 333 Score = 34.6 bits (79), Expect = 0.064 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 2/75 (2%) Query: 240 ITMEWIDGVKISDTEKL--RACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDS 297 I ME +DG + K R L ++S+ +++ + H D+ P N+ V+S Sbjct: 80 ICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNS 139 Query: 298 KGYIVAVDMGITGRL 312 +G I D G++G+L Sbjct: 140 RGEIKLCDFGVSGQL 154 >gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnormal cytokinesis and massive apoptosis in neuronal precursors. A Down syndrome critical region protein TTC3 interacts with CRIK and inhibits CRIK-dependent neuronal differentiation and neurite extension. Length = 330 Score = 34.0 bits (78), Expect = 0.091 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLS 313 +H + G+ H D+ P N+ +D G+I D G RL+ Sbjct: 118 VHQM--GYVHRDIKPENVLIDRTGHIKLADFGSAARLT 153 >gnl|CDD|35836 KOG0616, KOG0616, KOG0616, cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms]. Length = 355 Score = 33.4 bits (76), Expect = 0.16 Identities = 29/99 (29%), Positives = 39/99 (39%), Gaps = 21/99 (21%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKR------ERRFLA-EILYGFI 328 LH+L + DL P NL +D G+I D G R+S R +LA EI+ Sbjct: 160 LHSL--DIIYRDLKPENLLLDQNGHIKITDFGFAKRVSGRTWTLCGTPEYLAPEII---Q 214 Query: 329 SRDYQRVAD--------VHFEAGYVP-RHHNRFSFAQAI 358 S+ Y + D AGY P N + I Sbjct: 215 SKGYNKAVDWWALGVLIYEMLAGYPPFYDDNPIQIYEKI 253 >gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2 phase entry and progression. CDK1/cyclin A2 has also been implicated as an important regulator of S phase events. The CDK1/cyclin B complex is critical for G2 to M phase transition. It induces mitosis by activating nuclear enzymes that regulate chromatin condensation, nuclear membrane degradation, mitosis-specific microtubule and cytoskeletal reorganization. CDK1 also associates with cyclin E and plays a role in the entry into S phase. CDK1 transcription is stable throughout the cell cycle but is modulated in some pathological conditions. It may play a role in regulating apoptosis under these conditions. In breast cancer cells, HER2 can mediate apoptosis by inactivating CDK1. Activation of CDK1 may contribute to HIV-1 induced apoptosis and neuronal apoptosis in neurodegenerative diseases. Length = 285 Score = 33.2 bits (76), Expect = 0.20 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 7/52 (13%) Query: 264 ERLSVTLVQSFLLHTLRDGFF-------HADLHPGNLFVDSKGYIVAVDMGI 308 + + LV+S+L L+ F H DL P NL +D+KG I D G+ Sbjct: 96 QYMDAELVKSYLYQILQGILFCHSRRVLHRDLKPQNLLIDNKGVIKLADFGL 147 >gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a downstream effector of PKA and regulates entry into stationary phase (G0). Thus, it plays a crucial role in regulating yeast proliferation, differentiation, and aging. Cek1 may facilitate progression of mitotic anaphase. Length = 260 Score = 32.8 bits (75), Expect = 0.21 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Query: 275 LLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGIT--GRLSKR 315 LH + G H D+ P NL +D G++ D G++ G +K+ Sbjct: 112 DLH--QRGIIHRDIKPENLLIDQTGHLKLTDFGLSRNGLENKK 152 >gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of heart failure. Length = 286 Score = 32.6 bits (75), Expect = 0.23 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 21/97 (21%) Query: 261 HDLER-LSVTLVQSFLLHTLR-------DGFFHADLHPGNLFVDSKGYIVAVDMGITGRL 312 D ER L V+S++ L+ +G H DL P NL + + G + D G+ Sbjct: 90 RDEERPLPEAQVKSYMRMLLKGVAYMHANGIMHRDLKPANLLISADGVLKIADFGLARLF 149 Query: 313 SKRE----------RRFLA-EILYGFISRDYQRVADV 338 S+ E R + A E+LYG +R Y D+ Sbjct: 150 SEEEPRLYSHQVATRWYRAPELLYG--ARKYDPGVDL 184 >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. Dbf2p is important in regulating the mitotic exit network (MEN) and in cytokinesis. Length = 333 Score = 32.8 bits (75), Expect = 0.23 Identities = 31/102 (30%), Positives = 41/102 (40%), Gaps = 32/102 (31%) Query: 235 TERDVITM---EWIDGVKI----SDTEKLR-----ACGHDLERLSVTL------------ 270 TERD++T EW+ VK+ D E L G D L L Sbjct: 50 TERDILTTTKSEWL--VKLLYAFQDDEYLYLAMEYVPGGDFRTLLNNLGVLSEDHARFYM 107 Query: 271 VQSFL----LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGI 308 + F LH L G+ H DL P N +D+ G+I D G+ Sbjct: 108 AEMFEAVDALHEL--GYIHRDLKPENFLIDASGHIKLTDFGL 147 >gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity PKs that phosphorylate their downstream targets, MAPKs, at specific threonine and tyrosine residues. There are three MAPK subfamilies: extracellular signal-regulated kinase (ERK), c-Jun N-terminal kinase (JNK), and p38. In mammalian cells, there are seven MAPKKs (named MKK1-7) and 20 MAPKKKs. Each MAPK subfamily can be activated by at least two cognate MAPKKs and by multiple MAPKKKs. Length = 265 Score = 32.7 bits (75), Expect = 0.26 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 7/79 (8%) Query: 239 VITMEWIDGV---KISDTEKLRACGHDLERLSVTLVQ--SFLLHTLRDGFFHADLHPGNL 293 I ME++DG KI + R L +++V +++ ++L H D+ P N+ Sbjct: 75 SICMEYMDGGSLDKILKEVQGRIPERILGKIAVAVLKGLTYLHEKH--KIIHRDVKPSNI 132 Query: 294 FVDSKGYIVAVDMGITGRL 312 V+S+G I D G++G+L Sbjct: 133 LVNSRGQIKLCDFGVSGQL 151 >gnl|CDD|33440 COG3642, COG3642, Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]. Length = 204 Score = 32.5 bits (74), Expect = 0.26 Identities = 22/97 (22%), Positives = 38/97 (39%), Gaps = 19/97 (19%) Query: 218 NTVKDQGFRVPKIDWNRTERDVITMEWIDGVKISD------TEKLRACGHDLERLSVTLV 271 ++ G VP + + +I ME+I+G + D + LR G + + Sbjct: 54 AKAREAGVPVPIVYDVDPDNGLIVMEYIEGELLKDALEEARPDLLREVGRLVGK------ 107 Query: 272 QSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGI 308 LH + G H DL N+ + I +D G+ Sbjct: 108 ----LH--KAGIVHGDLTTSNIILSGGR-IYFIDFGL 137 >gnl|CDD|35883 KOG0664, KOG0664, KOG0664, Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms]. Length = 449 Score = 32.7 bits (74), Expect = 0.27 Identities = 23/93 (24%), Positives = 37/93 (39%), Gaps = 20/93 (21%) Query: 264 ERLSVTLVQSFLLHTLRD-------GFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRE 316 + L+ V+ F+ LR H D+ PGNL V+S + D G+ +R+ Sbjct: 151 QALTPDHVKVFVYQILRGLKYLHTANILHRDIKPGNLLVNSNCILKICDFGLARTWDQRD 210 Query: 317 RRFLA-----------EILYGFISRDYQRVADV 338 R + E+L G +R Y D+ Sbjct: 211 RLNMTHEVVTQYYRAPELLMG--ARRYTGAVDI 241 >gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert relative to other kinases. The fungal kinases in this subfamily harbor other domains in addition to a central catalytic domain, which also contains an insert relative to MAST kinases like MASTL. Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. MAST kinases are cytoskeletal associated kinases of unknown function that are also expressed at neuromuscular junctions and postsynaptic densities. The fungal proteins Rim15 and cek1 are involved in the regulation of meiosis and mitosis, respectively. Length = 265 Score = 32.6 bits (75), Expect = 0.27 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 6/39 (15%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSK 314 LH+ G H DL P N+ +DS G++ D G LSK Sbjct: 109 LHSN--GIIHRDLKPDNILIDSNGHLKLTDFG----LSK 141 >gnl|CDD|35888 KOG0669, KOG0669, KOG0669, Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning]. Length = 376 Score = 32.4 bits (73), Expect = 0.33 Identities = 14/74 (18%), Positives = 27/74 (36%), Gaps = 15/74 (20%) Query: 259 CGHDL--------ERLSVTLVQSFLLHTL-------RDGFFHADLHPGNLFVDSKGYIVA 303 C HDL R S++ ++ + + R+ H D+ N+ + G + Sbjct: 106 CEHDLAGLLSNRKVRFSLSEIKKVMKGLMNGLYYIHRNKILHRDMKAANVLITKDGILKL 165 Query: 304 VDMGITGRLSKRER 317 D G+ S + Sbjct: 166 ADFGLARAFSTSKN 179 >gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that are also expressed at neuromuscular junctions and postsynaptic densities. MAST1, MAST2, and MAST3 bind and phosphorylate the tumor suppressor PTEN, and may contribute to the regulation and stabilization of PTEN. MAST2 is involved in the regulation of the Fc-gamma receptor of the innate immune response in macrophages, and may also be involved in the regulation of the Na+/H+ exchanger NHE3. Length = 305 Score = 32.4 bits (74), Expect = 0.34 Identities = 22/57 (38%), Positives = 26/57 (45%), Gaps = 5/57 (8%) Query: 282 GFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEILY-GFISRDYQRVAD 337 G H DL P NL + S G+I D G LSK L LY G I +D + D Sbjct: 121 GIVHRDLKPDNLLITSMGHIKLTDFG----LSKIGLMSLTTNLYEGHIEKDTREFLD 173 >gnl|CDD|35794 KOG0574, KOG0574, KOG0574, STE20-like serine/threonine kinase MST [Signal transduction mechanisms]. Length = 502 Score = 32.4 bits (73), Expect = 0.34 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 6/78 (7%) Query: 240 ITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSF----LLHTLRDGFFHADLHPGNLFV 295 I ME+ ISD + R + +S L + LH L+ H D+ GN+ + Sbjct: 105 IVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKK--IHRDIKAGNILL 162 Query: 296 DSKGYIVAVDMGITGRLS 313 ++ G D G+ G+L+ Sbjct: 163 NTDGIAKLADFGVAGQLT 180 >gnl|CDD|35422 KOG0201, KOG0201, KOG0201, Serine/threonine protein kinase [Signal transduction mechanisms]. Length = 467 Score = 32.3 bits (73), Expect = 0.35 Identities = 19/84 (22%), Positives = 36/84 (42%), Gaps = 9/84 (10%) Query: 240 ITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFL-----LHTLRDGFFHADLHPGNLF 294 I ME+ G + D L++ E +++ L LH+ + H D+ N+ Sbjct: 88 IIMEYCGGGSVLD--LLKSGNILDEFEIAVILREVLKGLDYLHS--EKKIHRDIKAANIL 143 Query: 295 VDSKGYIVAVDMGITGRLSKRERR 318 + G + D G+ G+L+ +R Sbjct: 144 LSESGDVKLADFGVAGQLTNTVKR 167 >gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast Byr2 is regulated by Ras1. It responds to pheromone signaling and controls mating through the MAPK pathway. Budding yeast Ste11 functions in MAPK cascades that regulate mating, high osmolarity glycerol, and filamentous growth responses. Length = 267 Score = 32.1 bits (73), Expect = 0.36 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 7/51 (13%) Query: 269 TLVQSFLLHTLRD-------GFFHADLHPGNLFVDSKGYIVAVDMGITGRL 312 TLV++F+ L+ G H D+ N+ VD+KG I D GI+ +L Sbjct: 106 TLVRNFVRQILKGLNYLHNRGIIHRDIKGANILVDNKGGIKISDFGISKKL 156 >gnl|CDD|35828 KOG0608, KOG0608, KOG0608, Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning]. Length = 1034 Score = 32.0 bits (72), Expect = 0.39 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 282 GFFHADLHPGNLFVDSKGYIVAVDMGI-TG 310 GF H D+ P N+ +D G+I D G+ TG Sbjct: 749 GFIHRDIKPDNILIDRDGHIKLTDFGLCTG 778 >gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include the MAPKKs Polymyxin B resistance protein 2 (PBS2) from Saccharomyces cerevisiae, Wis1 from Schizosaccharomyces pombe, and related proteins. PBS2 and Wis1 are components of stress-activated MAPK cascades in budding and fission yeast, respectively. PBS2 is the specific activator of the MAPK Hog1, which plays a central role in the response of budding yeast to stress including exposure to arsenite and hyperosmotic environments. Wis1 phosphorylates and activates the MAPK Sty1 (also called Spc1 or Phh1), which stimulates a transcriptional response to a wide range of cellular insults through the bZip transcription factors Atf1, Pcr1, and Pap1. Length = 286 Score = 32.1 bits (73), Expect = 0.39 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 15/85 (17%) Query: 240 ITMEWIDGVKISDTEKLRACGHD--------LERLSVTLVQSFLLHTLRD--GFFHADLH 289 + ME++D + +KL A G L R++ +V+ L L++ H D+ Sbjct: 76 MCMEYMDAGSL---DKLYAGGVATEGIPEDVLRRITYAVVKG--LKFLKEEHNIIHRDVK 130 Query: 290 PGNLFVDSKGYIVAVDMGITGRLSK 314 P N+ V+ G + D G++G L Sbjct: 131 PTNVLVNGNGQVKLCDFGVSGNLVA 155 >gnl|CDD|35823 KOG0603, KOG0603, KOG0603, Ribosomal protein S6 kinase [Signal transduction mechanisms]. Length = 612 Score = 31.8 bits (72), Expect = 0.40 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Query: 273 SFLLHTLRDGFFHADLHPGN-LFVDSKGYIVAVDMG 307 S + + G H DL PGN L S G++ G Sbjct: 426 SAVDYLHEQGVVHRDLKPGNILLDGSAGHLRLTYFG 461 >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Proteins in this subfamily are involved in regulating many cellular functions including contraction, motility, division, proliferation, apoptosis, morphogenesis, and cytokinesis. Length = 350 Score = 31.9 bits (73), Expect = 0.45 Identities = 27/127 (21%), Positives = 47/127 (37%), Gaps = 23/127 (18%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRFLAEILYGFISRDYQRV 335 +H L GF H D+ P N+ +D+ G+I D G+ +++K + R L + ++ Sbjct: 117 VHKL--GFIHRDIKPDNILIDADGHIKLADFGLCKKMNKAKDREY--YLNDSHNLLFRDN 172 Query: 336 ADVHFEAGYVPRHHNRFSFAQAIRAIGEP------IH-----GQSSDVISMGKLL-TMLF 383 V R +G P + G D S+G +L ML+ Sbjct: 173 VLVRRRDHKQRRVRANS-------TVGTPDYIAPEVLRGTPYGLECDWWSLGVILYEMLY 225 Query: 384 EITELFD 390 + Sbjct: 226 GFPPFYS 232 >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubiquitously in cells and interacts with many different downstream targets. It plays a role in the regulation of diverse processes such as growth, development, memory, metabolism, gene expression, immunity, and lipolysis. Length = 290 Score = 31.7 bits (73), Expect = 0.49 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKR 315 LH+L + DL P NL +DS GYI D G R+ R Sbjct: 117 LHSL--DIVYRDLKPENLLLDSDGYIKITDFGFAKRVKGR 154 >gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell proliferation, and apoptosis. Length = 323 Score = 31.7 bits (72), Expect = 0.52 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGI 308 LH+L + DL P N+ +DS+G++V D G+ Sbjct: 112 LHSLN--IIYRDLKPENILLDSQGHVVLTDFGL 142 >gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ14813 is associated with autosomal dominant thrombocytopenia. To date, the function of MASTL is unknown. Length = 669 Score = 31.4 bits (71), Expect = 0.57 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRE 316 LH R G H DL P N+ + ++G+I D G++ RE Sbjct: 120 LH--RHGIIHRDLKPDNMLISNEGHIKLTDFGLSKVTLNRE 158 >gnl|CDD|143851 pfam00069, Pkinase, Protein kinase domain. Length = 260 Score = 31.5 bits (72), Expect = 0.59 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 14/87 (16%) Query: 230 IDWNRTERDV-ITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLR-------D 281 ID + + + ME+ +G + L G LS + L LR + Sbjct: 64 IDAFEDKDHLYLVMEYCEG--GDLFDYLSRGG----PLSEDEAKKIALQILRGLEYLHSN 117 Query: 282 GFFHADLHPGNLFVDSKGYIVAVDMGI 308 G H DL P N+ +D G + D G+ Sbjct: 118 GIIHRDLKPENILLDENGVVKIADFGL 144 >gnl|CDD|35834 KOG0614, KOG0614, KOG0614, cGMP-dependent protein kinase [Signal transduction mechanisms]. Length = 732 Score = 31.5 bits (71), Expect = 0.63 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRER 317 LH R G + DL P NL +D++GY+ VD G ++ + Sbjct: 536 LH--RKGIIYRDLKPENLLLDNRGYLKLVDFGFAKKIGSGRK 575 >gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of Ace2p activity and cellular morphogenesis) network. CBK1 and Orb6 play similar roles in coordinating cell morphology with cell cycle progression. Ukc1 is involved in morphogenesis, pathogenicity, and pigment formation. Cot1 plays a role in polar tip extension. Length = 377 Score = 31.4 bits (71), Expect = 0.63 Identities = 11/28 (39%), Positives = 17/28 (60%) Query: 282 GFFHADLHPGNLFVDSKGYIVAVDMGIT 309 GF H D+ P N+ +D G+I D G++ Sbjct: 121 GFIHRDIKPDNILIDRGGHIKLSDFGLS 148 >gnl|CDD|32485 COG2334, COG2334, Putative homoserine kinase type II (protein kinase fold) [General function prediction only]. Length = 331 Score = 31.5 bits (71), Expect = 0.66 Identities = 15/55 (27%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Query: 250 ISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAV 304 + + A L+RL L L L D H DLHP N+ D + Sbjct: 168 VEPEDLRAALLAALDRLLARLPA--HLPALGDQIIHGDLHPDNVLFDDDTDVSGF 220 >gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include the MAPKKs Byr1 from Schizosaccharomyces pombe, FUZ7 from Ustilago maydis, and related proteins. Byr1 phosphorylates its downstream target, the MAPK Spk1, and is regulated by the MAPKKK Byr2. The Spk1 cascade is pheromone-responsive and is essential for sporulation and sexual differentiation in fission yeast. FUZ7 phosphorylates and activates its target, the MAPK Crk1, which is required in mating and virulence in U. maydis. Length = 284 Score = 31.3 bits (71), Expect = 0.69 Identities = 12/28 (42%), Positives = 18/28 (64%) Query: 285 HADLHPGNLFVDSKGYIVAVDMGITGRL 312 H D+ P N+ V+S+G I D G++G L Sbjct: 127 HRDIKPSNILVNSRGQIKLCDFGVSGEL 154 >gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their respective MAPKKs, MEK1/2 and MKK4/MKK7, respectively. MEKK1 is important in regulating cell survival and apoptosis. MEKK1 also plays a role in cell migration, tissue maintenance and homeostasis, and wound healing. Length = 268 Score = 31.0 bits (70), Expect = 0.77 Identities = 36/143 (25%), Positives = 55/143 (38%), Gaps = 33/143 (23%) Query: 240 ITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFL-----LHTLRDGFFHADLHPGNLF 294 + +EW+ G +S L G E + + + L LH + H D+ NL Sbjct: 80 LFVEWMAGGSVSHL--LSKYGAFKEAVIINYTEQLLRGLSYLHENQ--IIHRDVKGANLL 135 Query: 295 VDSKGYIVAV-DMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEAGYVPRHHNRFS 353 +DS G + + D G RL+ + A G Q + + F A V R Sbjct: 136 IDSTGQRLRIADFGAAARLAAKGTG--AGEFQG------QLLGTIAFMAPEVLR------ 181 Query: 354 FAQAIRAIGEPIHGQSSDVISMG 376 GE +G+S DV S+G Sbjct: 182 --------GEQ-YGRSCDVWSVG 195 >gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Length = 376 Score = 30.9 bits (70), Expect = 0.79 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Query: 282 GFFHADLHPGNLFVDSKGYIVAVDMGI-TG 310 GF H D+ P N+ +D G+I D G+ TG Sbjct: 121 GFIHRDIKPDNILIDRDGHIKLTDFGLCTG 150 >gnl|CDD|35881 KOG0662, KOG0662, KOG0662, Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport, Signal transduction mechanisms]. Length = 292 Score = 31.1 bits (70), Expect = 0.79 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 20/99 (20%) Query: 259 CGHDLER--------LSVTLVQSFLLHTLRD-GFFHA------DLHPGNLFVDSKGYIVA 303 C DL++ L +V+SF+L LR GF H+ DL P NL ++ G + Sbjct: 83 CDQDLKKYFDSLNGDLDPEIVRSFMLQLLRGLGFCHSHNVLHRDLKPQNLLINRNGELKL 142 Query: 304 VDMGITGRLSKRERRFLAEILYGFISRDYQRVADVHFEA 342 D G+ R + AE++ + R DV F A Sbjct: 143 ADFGLARAFGIPVRCYSAEVV-----TLWYRPPDVLFGA 176 >gnl|CDD|35814 KOG0594, KOG0594, KOG0594, Protein kinase PCTAIRE and related kinases [General function prediction only]. Length = 323 Score = 31.0 bits (70), Expect = 0.80 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 7/60 (11%) Query: 256 LRACGHDLERLSVTLVQSFLLHTLR-------DGFFHADLHPGNLFVDSKGYIVAVDMGI 308 + + + L L++SF+ LR G H DL P NL + S G + D G+ Sbjct: 107 MDSLPKKPQGLPPRLIKSFMRQLLRGLAFLHSHGILHRDLKPQNLLISSSGVLKLADFGL 166 >gnl|CDD|35880 KOG0661, KOG0661, KOG0661, MAPK related serine/threonine protein kinase [Signal transduction mechanisms]. Length = 538 Score = 30.8 bits (69), Expect = 0.86 Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 275 LLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGI 308 L H + GFFH DL P N+ + I D G+ Sbjct: 123 LAHIHKHGFFHRDLKPENILISGNDVIKIADFGL 156 >gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, and kidney. It mediates signaling from Rho to the actin cytoskeleton. It is implicated in the development of cardiac fibrosis, cardiomyocyte apoptosis, and hyperglycemia. Mice deficient with ROCK1 display eyelids open at birth (EOB) and omphalocele phenotypes due to the disorganization of actin filaments in the eyelids and the umbilical ring. Length = 371 Score = 30.8 bits (69), Expect = 0.87 Identities = 12/39 (30%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSK 314 +H++ GF H D+ P N+ +D G++ D G +++K Sbjct: 158 IHSM--GFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNK 194 >gnl|CDD|88618 cd05155, APH_ChoK_like_1, Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members. The APH/ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). This family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates, such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides, and macrolides leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine.. Length = 235 Score = 31.0 bits (70), Expect = 0.88 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Query: 284 FHADLHPGNLFVDSKGYIVAV-DMGITG 310 FH DL PGNL V G + AV D G G Sbjct: 167 FHGDLAPGNLLVQ-DGRLSAVIDFGCLG 193 >gnl|CDD|35879 KOG0660, KOG0660, KOG0660, Mitogen-activated protein kinase [Signal transduction mechanisms]. Length = 359 Score = 31.0 bits (70), Expect = 0.92 Identities = 18/74 (24%), Positives = 26/74 (35%), Gaps = 10/74 (13%) Query: 251 SDTEKLRACGHDLERLSVTLVQSFLLHTLRD-------GFFHADLHPGNLFVDSKGYIVA 303 +D ++ DL Q FL LR H DL P NL +++ + Sbjct: 110 TDLHQIIKSQQDLTD---DHAQYFLYQILRGLKYIHSANVIHRDLKPSNLLLNADCDLKI 166 Query: 304 VDMGITGRLSKRER 317 D G+ L K Sbjct: 167 CDFGLARYLDKFFE 180 >gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype and poor prognosis. LATS1 induces G2 arrest and promotes cytokinesis. It may be a component of the mitotic exit network in higher eukaryotes. Length = 382 Score = 30.7 bits (69), Expect = 0.93 Identities = 11/27 (40%), Positives = 16/27 (59%) Query: 282 GFFHADLHPGNLFVDSKGYIVAVDMGI 308 GF H D+ P N+ +D G+I D G+ Sbjct: 121 GFIHRDIKPDNILIDRDGHIKLTDFGL 147 >gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a MAPK kinase) and MEKK1 (a MAPK kinase kinase) by acting as a MAPK kinase kinase kinase (MAPKKKK). Activation of JNK by MST1 leads to caspase activation and apoptosis. MST1 has also been implicated in cell proliferation and differentiation. Krs1 may regulate cell growth arrest and apoptosis in response to cellular stress. Length = 256 Score = 30.7 bits (70), Expect = 0.94 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 6/78 (7%) Query: 240 ITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFL----LHTLRDGFFHADLHPGNLFV 295 I ME+ +SD K+ E ++ L Q+ LH+ + H D+ GN+ + Sbjct: 75 IVMEYCGAGSVSDIMKITNKTLTEEEIAAILYQTLKGLEYLHSNK--KIHRDIKAGNILL 132 Query: 296 DSKGYIVAVDMGITGRLS 313 + +G D G++G+L+ Sbjct: 133 NEEGQAKLADFGVSGQLT 150 >gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt sensitivity, memory consolidation, and cardiac repolarization. A common SGK1 variant is associated with increased blood pressure and body weight. SGK1 may also contribute to tumor growth, neurodegeneration, fibrosing disease, and ischemia. Length = 325 Score = 30.8 bits (69), Expect = 0.95 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGI 308 LH+L + DL P N+ +DS+G+IV D G+ Sbjct: 112 LHSL--NIVYRDLKPENILLDSQGHIVLTDFGL 142 >gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant and fungal MAPKKKs. Also included in this subfamily are the cell division control proteins Schizosaccharomyces pombe Cdc7 and Saccharomyces cerevisiae Cdc15. Length = 260 Score = 30.6 bits (70), Expect = 1.0 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 17/83 (20%) Query: 240 ITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTL-------RDGFFHADLHPGN 292 I +E++ G +S L+ G +L +++ + L +G H D+ N Sbjct: 78 IFLEYVSGGSLSS--LLKKFG----KLPEPVIRKYTRQILEGLAYLHSNGIVHRDIKGAN 131 Query: 293 LFVDSKGYIVAVDMGITGRLSKR 315 + VDS G + D G +KR Sbjct: 132 ILVDSDGVVKLADFG----CAKR 150 >gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with poor prognosis in acute lymphoblastic leukemia and breast cancer. Length = 381 Score = 30.8 bits (69), Expect = 1.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Query: 282 GFFHADLHPGNLFVDSKGYIVAVDMGI 308 GF H D+ P N+ +D G+I D G+ Sbjct: 121 GFIHRDIKPDNILIDLDGHIKLTDFGL 147 >gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the downstream targets, ERK(extracellular signal-regulated kinase) 1 and ERK2, on specific threonine and tyrosine residues. The ERK cascade starts with extracellular signals including growth factors, hormones, and neurotransmitters, which act through receptors and ion channels to initiate intracellular signaling that leads to the activation at the MAPKKK (Raf-1 or MOS) level, which leads to the transmission of signals to MEK1/2, and finally to ERK1/2. The ERK cascade plays an important role in cell proliferation, differentiation, oncogenic transformation, and cell cycle control, as well as in apoptosis and cell survival under certain conditions. This cascade has also been implicated in synaptic plasticity, migration, morphological determination, and stress response immunological reactions. Gain-of-function mutations in genes encoding ERK cascade proteins, including MEK1/2, cause cardiofaciocutaneous (CFC) syndrome, a condition leading to multiple congenital anomalies and mental retardation in patients. Length = 308 Score = 30.5 bits (69), Expect = 1.1 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 6/77 (7%) Query: 240 ITMEWIDGVKISDTEKL--RACGHDLERLSVTLVQSFLLHTLRD--GFFHADLHPGNLFV 295 I ME +DG + K R + L ++S+ +++ L LR+ H D+ P N+ V Sbjct: 76 ICMEHMDGGSLDQVLKKAGRIPENILGKISIAVLRG--LTYLREKHKIMHRDVKPSNILV 133 Query: 296 DSKGYIVAVDMGITGRL 312 +S+G I D G++G+L Sbjct: 134 NSRGEIKLCDFGVSGQL 150 >gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex plays a role in regulating DNA replication. CDK2, together with CDK4, also regulates embryonic cell proliferation. Despite these important roles, mice deleted for the cdk2 gene are viable and normal except for being sterile. This may be due to compensation provided by CDK1 (also called Cdc2), which can also bind cyclin E and drive the G1 to S phase transition. CDK3 is regulated by cyclin C and it phosphorylates pRB specifically during the G0/G1 transition. This phosphorylation is required for cells to exit G0 efficiently and enter the G1 phase. Length = 284 Score = 30.2 bits (68), Expect = 1.3 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 7/53 (13%) Query: 263 LERLSVTLVQSFLLHTLRDGFF-------HADLHPGNLFVDSKGYIVAVDMGI 308 L + + L++S+L L+ F H DL P NL ++++G I D G+ Sbjct: 94 LSGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGL 146 >gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels, and receptors. It plays a critical role in hair follicle morphogenesis and hair cycling. Length = 325 Score = 30.4 bits (68), Expect = 1.4 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGI 308 LH++ + DL P N+ +DS+G++V D G+ Sbjct: 112 LHSIN--IVYRDLKPENILLDSQGHVVLTDFGL 142 >gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the early G1 phase by CDK4 or CDK6, the G1/S phase transition by CDK2, or the entry of mitosis by CDK1. They also exhibit overlapping cyclin specificity and functions in certain conditions. Knockout mice with a single CDK deleted remain viable with specific phenotypes, showing that some CDKs can compensate for each other. For example, CDK4 can compensate for the loss of CDK6, however, double knockout mice with both CDK4 and CDK6 deleted die in utero. CDK8 and CDK9 are mainly involved in transcription while CDK5 is implicated in neuronal function. CDK7 plays essential roles in both the cell cycle as a CDK-Activating Kinase (CAK) and in transcription as a component of the general transcription factor TFIIH. Length = 282 Score = 30.1 bits (69), Expect = 1.6 Identities = 17/64 (26%), Positives = 26/64 (40%), Gaps = 15/64 (23%) Query: 259 CGHDLER--------LSVTLVQSFLLHTLR-------DGFFHADLHPGNLFVDSKGYIVA 303 C DL++ LS L++S + LR H DL P N+ ++ G + Sbjct: 80 CDMDLKKYLDKRPGPLSPNLIKSIMYQLLRGLAYCHSHRILHRDLKPQNILINRDGVLKL 139 Query: 304 VDMG 307 D G Sbjct: 140 ADFG 143 >gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via interaction with Rho GTPases and is involved in many cellular functions including contraction, adhesion, migration, motility, proliferation, and apoptosis. The ROCK subfamily consists of two isoforms, ROCK1 and ROCK2, which may be functionally redundant in some systems, but exhibit different tissue distributions. Both isoforms are ubiquitously expressed in most tissues, but ROCK2 is more prominent in brain and skeletal muscle while ROCK1 is more pronounced in the liver, testes, and kidney. Studies in knockout mice result in different phenotypes, suggesting that the two isoforms do not compensate for each other during embryonic development. Length = 370 Score = 29.7 bits (67), Expect = 1.8 Identities = 11/39 (28%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSK 314 +H++ GF H D+ P N+ +D G++ D G ++ Sbjct: 158 IHSM--GFIHRDVKPDNMLLDKSGHLKLADFGTCMKMDA 194 >gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that phosphorylates its downstream target, extracellular signal-regulated kinase 5 (ERK5), on specific threonine and tyrosine residues. MKK5 is activated by MEKK2 and MEKK3 in response to mitogenic and stress stimuli. The ERK5 cascade promotes cell proliferation, differentiation, neuronal survival, and neuroprotection. This cascade plays an essential role in heart development. Mice deficient in either ERK5 or MKK5 die around embryonic day 10 due to cardiovascular defects including underdevelopment of the myocardium. In addition, MKK5 is associated with metastasis and unfavorable prognosis in prostate cancer. Length = 279 Score = 29.8 bits (67), Expect = 1.9 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%) Query: 237 RDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSF-LLHTLRDGFFHADLHPGNLFV 295 R I E++DG + K+ H L R++V +V+ L +L+ H D+ P N+ V Sbjct: 73 RISICTEFMDGGSLDVYRKIPE--HVLGRIAVAVVKGLTYLWSLK--ILHRDVKPSNMLV 128 Query: 296 DSKGYIVAVDMGITGRL 312 +++G + D G++ +L Sbjct: 129 NTRGQVKLCDFGVSTQL 145 >gnl|CDD|35811 KOG0591, KOG0591, KOG0591, NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]. Length = 375 Score = 29.6 bits (66), Expect = 2.0 Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Query: 280 RDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERRF 319 R H D+ P N+F+ + G + D G+ GR + F Sbjct: 146 RGTVMHRDIKPANIFLTANGVVKLGDFGL-GRFLSSKTTF 184 >gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription factors from the TCF/LEF family, inhibiting their ability to activate the transcription of target genes. In prostate cancer cells, NLK is involved in regulating androgen receptor-mediated transcription and its expression is altered during cancer progression. Length = 372 Score = 29.7 bits (67), Expect = 2.1 Identities = 27/93 (29%), Positives = 36/93 (38%), Gaps = 20/93 (21%) Query: 264 ERLSVTLVQSFLLHTLRD-------GFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRE 316 + LS V+ FL LR G H D+ PGNL V+S + D G+ E Sbjct: 98 QPLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEEPDE 157 Query: 317 RRFLA-----------EILYGFISRDYQRVADV 338 + + EIL G SR Y D+ Sbjct: 158 SKHMTQEVVTQYYRAPEILMG--SRHYTSAVDI 188 >gnl|CDD|36202 KOG0984, KOG0984, KOG0984, Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms]. Length = 282 Score = 29.6 bits (66), Expect = 2.2 Identities = 13/50 (26%), Positives = 26/50 (52%) Query: 263 LERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRL 312 L +++V++V + + H D+ P N+ ++ G + D GI+G L Sbjct: 150 LGKIAVSVVHALEFLHSKLSVIHRDVKPSNILINYDGQVKICDFGISGYL 199 >gnl|CDD|35878 KOG0659, KOG0659, KOG0659, Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning, Transcription, Replication, recombination and repair]. Length = 318 Score = 29.5 bits (66), Expect = 2.2 Identities = 24/90 (26%), Positives = 35/90 (38%), Gaps = 19/90 (21%) Query: 266 LSVTLVQSFLLHTLR-------DGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERR 318 LS ++S++L TL+ H DL P NL + S G + D G+ R Sbjct: 98 LSPADIKSYMLMTLKGLAYCHSKWILHRDLKPNNLLISSDGQLKIADFGLARFFGSPNRI 157 Query: 319 FLA----------EILYGFISRDYQRVADV 338 E+L+G SR Y D+ Sbjct: 158 QTHQVVTRWYRAPELLFG--SRQYGTGVDM 185 >gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the turn motif. Phosphorylation at the A-loop is required of most AGC kinases, which results in a disorder-to-order transition of the A-loop. The ordered conformation results in the access of substrates and ATP to the active site. A subset of AGC kinases with C-terminal extensions containing the HM also requires phosphorylation at this site. Phosphorylation at the HM allows the C-terminal extension to form an ordered structure that packs into the hydrophobic pocket of the catalytic domain, which then reconfigures the kinase into an active bi-lobed state. In addition, growth factor-activated AGC kinases such as PKB, p70S6K, RSK, MSK, PKC, and SGK, require phosphorylation at the turn motif (also called tail or zipper site), located N-terminal to the HM at the C-terminal extension. AGC kinases regulate many cellular processes including division, growth, survival, metabolism, motility, and differentiation. Many are implicated in the development of various human diseases. Length = 250 Score = 29.4 bits (67), Expect = 2.3 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKR 315 LH+L G + DL P N+ +D+ G+I D G L+K Sbjct: 109 LHSL--GIIYRDLKPENILLDADGHIKLTDFG----LAKE 142 >gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1. Length = 321 Score = 29.6 bits (66), Expect = 2.3 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGI 308 LH+L + DL P N+ +DS+G++V D G+ Sbjct: 112 LHSL--NIIYRDLKPENILLDSQGHVVLTDFGL 142 >gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Length = 283 Score = 29.2 bits (66), Expect = 2.6 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 7/49 (14%) Query: 266 LSVTLVQSFLLHTL-------RDGFFHADLHPGNLFVDSKGYIVAVDMG 307 L +L++S+L L G H DL P NL ++++G + D G Sbjct: 95 LPESLIKSYLYQLLQGLAFCHSHGILHRDLKPENLLINTEGVLKLADFG 143 >gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates the downstream targets, c-Jun N-terminal kinase (JNK) and p38 MAPK, on specific threonine and tyrosine residues. JNK and p38 are collectively known as stress-activated MAPKs, as they are activated in response to a variety of environmental stresses and pro-inflammatory cytokines. Their activation is associated with the induction of cell death. Mice deficient in MKK4 die during embryogenesis and display anemia, severe liver hemorrhage, and abnormal hepatogenesis. MKK4 may also play roles in the immune system and in cardiac hypertrophy. It plays a major role in cancer as a tumor and metastasis suppressor. Under certain conditions, MKK4 is pro-oncogenic. Length = 288 Score = 29.3 bits (66), Expect = 2.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 285 HADLHPGNLFVDSKGYIVAVDMGITGRL 312 H D+ P N+ +D G I D GI+G+L Sbjct: 131 HRDVKPSNILLDRNGNIKLCDFGISGQL 158 >gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the insulin receptor substrate IRS-1, among others. Mammals contain two isoforms of p70S6K, named S6K1 and S6K2 (or S6K-beta). Length = 323 Score = 29.4 bits (66), Expect = 2.8 Identities = 20/73 (27%), Positives = 30/73 (41%), Gaps = 18/73 (24%) Query: 236 ERDVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFV 295 ER+ I ME D +E A H LH G + DL P N+ + Sbjct: 92 EREGIFME--DTACFYLSEISLALEH--------------LHQQ--GIIYRDLKPENILL 133 Query: 296 DSKGYIVAVDMGI 308 D++G++ D G+ Sbjct: 134 DAQGHVKLTDFGL 146 >gnl|CDD|36224 KOG1006, KOG1006, KOG1006, Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms]. Length = 361 Score = 29.2 bits (65), Expect = 2.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 285 HADLHPGNLFVDSKGYIVAVDMGITGRL 312 H D+ P N+ +D G + D GI G+L Sbjct: 191 HRDVKPSNILLDRHGDVKLCDFGICGQL 218 >gnl|CDD|37556 KOG2345, KOG2345, KOG2345, Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription, Lipid transport and metabolism, Signal transduction mechanisms]. Length = 302 Score = 29.1 bits (65), Expect = 2.8 Identities = 17/70 (24%), Positives = 26/70 (37%), Gaps = 7/70 (10%) Query: 238 DVITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFLLHTLRDGFFHADLHPGNLFVDS 297 D I I G +S+ + L L LH + H D+ P N+ + Sbjct: 112 DEIERLKIKGNFVSEAQILWIFLGICRGLEA-------LHEKEPPYAHRDIKPANILLSD 164 Query: 298 KGYIVAVDMG 307 G V +D+G Sbjct: 165 SGLPVLMDLG 174 >gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also important in synaptic plasticity and learning. CDK5 also participates in protecting against cell death and promoting angiogenesis. Impaired CDK5 activity is implicated in Alzheimer's disease, amyotrophic lateral sclerosis, Parkinson's disease, Huntington's disease and acute neuronal injury. Length = 284 Score = 29.3 bits (66), Expect = 2.8 Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 10/74 (13%) Query: 258 ACGHDLERLSVTLVQSFLLHTLRDGFF-------HADLHPGNLFVDSKGYIVAVDMGITG 310 +C D++ +V+SF+ L+ F H DL P NL ++ G + D G+ Sbjct: 91 SCNGDIDP---EIVKSFMFQLLKGLAFCHSHNVLHRDLKPQNLLINKNGELKLADFGLAR 147 Query: 311 RLSKRERRFLAEIL 324 R + AE++ Sbjct: 148 AFGIPVRCYSAEVV 161 >gnl|CDD|35419 KOG0198, KOG0198, KOG0198, MEKK and related serine/threonine protein kinases [Signal transduction mechanisms]. Length = 313 Score = 29.2 bits (65), Expect = 2.9 Identities = 14/57 (24%), Positives = 23/57 (40%), Gaps = 8/57 (14%) Query: 265 RLSVTLVQSFLLHTL-------RDGFFHADLHPGNLFVDSKGYIVAV-DMGITGRLS 313 +L LV+ + L G H D+ P N+ +D V + D G+ +L Sbjct: 113 KLPEPLVRRYTRQILEGLAYLHSKGIVHCDIKPANILLDPSNGDVKLADFGLAKKLE 169 >gnl|CDD|35420 KOG0199, KOG0199, KOG0199, ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms]. Length = 1039 Score = 28.9 bits (64), Expect = 3.1 Identities = 18/80 (22%), Positives = 26/80 (32%), Gaps = 15/80 (18%) Query: 255 KLRACGHDLERLSVTLVQSFLLHTLRD---------------GFFHADLHPGNLFVDSKG 299 +L G L+RL L+ L D H DL NL + S Sbjct: 190 ELAPLGSLLDRLRKAKKAILLVSRLCDYAMQIAKAMQYLESKRLVHRDLAARNLLLASPR 249 Query: 300 YIVAVDMGITGRLSKRERRF 319 + D G+ L + E + Sbjct: 250 TVKICDFGLMRALGENEDMY 269 >gnl|CDD|35095 COG5536, BET4, Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones]. Length = 328 Score = 28.8 bits (64), Expect = 3.9 Identities = 14/74 (18%), Positives = 27/74 (36%) Query: 371 DVISMGKLLTMLFEITELFDMMTRPELVMLQKTMVVVEGVARMLNPEFNMWVSSEPIVEE 430 D S+ L + +M ++ L K +V++ G L P+ N+ + E Sbjct: 225 DNQSVWGYLRGVSSEFATDIVMIGEKVEDLGKYIVIINGKELDLGPKENLPCLHSLLELE 284 Query: 431 WIRDHLGAKSCVVD 444 ++ A D Sbjct: 285 FLCHAEKALLTERD 298 >gnl|CDD|36121 KOG0903, KOG0903, KOG0903, Phosphatidylinositol 4-kinase, involved in intracellular trafficking and secretion [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport]. Length = 847 Score = 28.8 bits (64), Expect = 4.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 287 DLHPGNLFVDSKGYIVAVDMG 307 D H GN+ +D +G+I+ +D G Sbjct: 701 DRHNGNILIDEEGHIIHIDFG 721 >gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with the membrane though an N-terminal PIP2 binding domain and also binds phospholipids via its C-terminus. GRK5 deficiency is associated with early Alzheimer's disease in humans and mouse models. GRK5 also plays a crucial role in the pathogenesis of sporadic Parkinson's disease. It participates in the regulation and desensitization of PDGFRbeta, a receptor tyrosine kinase involved in a variety of downstream cellular effects including cell growth, chemotaxis, apoptosis, and angiogenesis. GRK5 also regulates Toll-like receptor 4, which is involved in innate and adaptive immunity. Length = 285 Score = 28.8 bits (64), Expect = 4.2 Identities = 12/42 (28%), Positives = 22/42 (52%) Query: 275 LLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRE 316 L R+ + DL P N+ +D G+I D+G+ ++ + E Sbjct: 115 LEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGE 156 >gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may play a role in regulating neurite outgrowth. It can also associate with Trap (Tudor repeat associator with PCTAIRE-2), a physiological partner of PCTAIRE-2; with p11, a small dimeric protein with similarity to S100; and with 14-3-3 proteins, mediators of phosphorylation-dependent interactions in many different proteins. Length = 301 Score = 28.4 bits (63), Expect = 4.3 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 4/57 (7%) Query: 256 LRACGHDLERLSVTLVQSFLLHTL----RDGFFHADLHPGNLFVDSKGYIVAVDMGI 308 L CG+ + +V L LL L R H DL P NL ++ +G + D G+ Sbjct: 94 LDDCGNSINMHNVKLFLFQLLRGLNYCHRRKVLHRDLKPQNLLINERGELKLADFGL 150 >gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, stroke, sciatic axotomy neural death, and neuronal death due to NGF deprivation, oxidative stress, or exposure to beta-amyloid peptide. This suggests that JNK3 may play roles in the pathogenesis of these diseases. Length = 355 Score = 28.5 bits (63), Expect = 4.3 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Query: 262 DLERLSVTLVQSF--LLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGI 308 D ER+S L Q + H G H DL P N+ V S + +D G+ Sbjct: 117 DHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGL 165 >gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylates all known RSK substrates. RSKs act as downstream effectors of mitogen-activated protein kinase (MAPK) and play key roles in mitogen-activated cell growth, differentiation, and survival. Mammals possess four RSK isoforms (RSK1-4) from distinct genes. RSK proteins are also referred to as MAP kinase-activated protein kinases (MAPKAPKs), p90-RSKs, or p90S6Ks. Length = 318 Score = 28.6 bits (64), Expect = 4.4 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGIT 309 LH+L G + DL P N+ +D +G+I D G++ Sbjct: 114 LHSL--GIIYRDLKPENILLDEEGHIKLTDFGLS 145 >gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is also a component of the general transcription factor TFIIH, which phosphorylates the C-terminal domain (CTD) of RNA polymerase II when it is bound with unphosphorylated DNA, as present in the pre-initiation complex. Following phosphorylation, the CTD dissociates from the DNA which allows transcription initiation. Length = 298 Score = 28.7 bits (65), Expect = 4.5 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 15/53 (28%) Query: 262 DLE--------RLSVTLVQSFLLHTLR-------DGFFHADLHPGNLFVDSKG 299 DLE L+ ++S++L TLR + H DL P NL + S G Sbjct: 87 DLEKVIKDKSIVLTPADIKSYMLMTLRGLEYLHSNWILHRDLKPNNLLIASDG 139 >gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jnk1 or Jnk2) could survive but disruption of both genes resulted in lethality. However, recent studies have shown that JNK1 and JNK2 perform distinct functions through specific binding partners and substrates. JNK1 specifically binds with JAMP (JNK1-associated membrane protein), which regulates the duration of JNK1 activity in response to stimuli. Specific JNK1 substrates include Itch and SG10, which are implicated in Th2 responses and airway inflammation, and microtubule dynamics and axodendritic length, respectively. Mice deficient in Jnk1 are protected against arthritis, obesity, type 2 diabetes, cardiac cell death, and non-alcoholic liver disease, suggesting that JNK1 may play roles in the pathogenesis of these diseases. Length = 364 Score = 28.5 bits (63), Expect = 4.7 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Query: 262 DLERLSVTLVQSF--LLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGI 308 D ER+S L Q + H G H DL P N+ V S + +D G+ Sbjct: 124 DHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGL 172 >gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jnk1 or Jnk2) could survive but disruption of both genes resulted in lethality. However, recent studies have shown that JNK1 and JNK2 perform distinct functions through specific binding partners and substrates. JNK2 is specifically translocated to the mitochondria during dopaminergic cell death. Specific substrates include the microtubule-associated proteins DCX and Tau, as well as TIF-IA which is involved in ribosomal RNA synthesis regulation. Mice deficient in Jnk2 show protection against arthritis, type 1 diabetes, atherosclerosis, abdominal aortic aneurysm, cardiac cell death, TNF-induced liver damage, and tumor growth, indicating that JNK2 may play roles in the pathogenesis of these diseases. Length = 359 Score = 28.5 bits (63), Expect = 5.0 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Query: 262 DLERLSVTLVQSF--LLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGI 308 D ER+S L Q + H G H DL P N+ V S + +D G+ Sbjct: 121 DHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGL 169 >gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertility. It functions as a coactivator of the androgen receptor in prostate cells. MRK, also called Intestinal Cell Kinase (ICK), is expressed ubiquitously, with highest expression in the ovary and uterus. A missense mutation in MRK causes endocrine-cerebro-osteodysplasia (ECO), suggesting that this protein plays an important role in the development of many organs. MAK and MRK may be involved in regulating cell cycle and cell fate. Ime2p is a meiosis-specific kinase that is important during meiotic initiation and during the later stages of meiosis. Mde3 functions downstream of the transcription factor Mei-4 which is essential for meiotic prophase I. Length = 283 Score = 28.3 bits (64), Expect = 5.1 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Query: 275 LLHTLRDGFFHADLHPGNLFVDSKGYIV 302 L H + GFFH DL P NL V S +V Sbjct: 112 LAHIHKHGFFHRDLKPENLLV-SGPEVV 138 >gnl|CDD|35255 KOG0032, KOG0032, KOG0032, Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]. Length = 382 Score = 28.1 bits (62), Expect = 5.8 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Query: 276 LHTLRDGFFHADLHPGNLFVDSK----GYIVAVDMGITGRLSKRER 317 LH+L G H DL P NL + SK G I +D G+ + ER Sbjct: 151 LHSL--GVVHRDLKPENLLLASKDEGSGRIKLIDFGLAKFIKPGER 194 >gnl|CDD|36223 KOG1005, KOG1005, KOG1005, Telomerase catalytic subunit/reverse transcriptase TERT [Replication, recombination and repair, Chromatin structure and dynamics]. Length = 888 Score = 28.0 bits (62), Expect = 5.9 Identities = 31/159 (19%), Positives = 53/159 (33%), Gaps = 33/159 (20%) Query: 344 YVPRHHNRFSFAQAIRAIGEPIHGQSSDVISMGKLLTMLFEITELFDMMTRPELVMLQKT 403 +V R A + G +I + + L M Sbjct: 547 FVQRKDAY------TVAGKGRVRGNFVSLIFCSADVEPNAHVVN--------ALKMETSD 592 Query: 404 MVVVEGVARMLNPEFNMWVSSEPIVEEWIRDHLGAKSCVVDFQDGIKTAFRLVQAAPQLS 463 ++V+E V+R + S + IR+ L + ++ + PQ S Sbjct: 593 VLVIENVSR--------EMLSSSDLFSVIRNMLSTNYVKIG-----GKSYVQKKGIPQGS 639 Query: 464 ISVEKILKSLVESSVKDKYLDFPKKESSRVY-----DFL 497 I + +L L ++DKY F K++ S V DFL Sbjct: 640 I-LSSLLCHLYYGDLEDKYFSFEKEDGSIVLLRYVDDFL 677 >gnl|CDD|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins. Serine/Threonine Kinases (STKs), RPK118-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RPK118-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily show similarity to human RPK118, which contains an N-terminal Phox homology (PX) domain, a Microtubule Interacting and Trafficking (MIT) domain, and a kinase domain containing a long insert. Also included in the family is human RPK60 (or ribosomal protein S6 kinase-like 1), which also contains MIT and kinase domains but lacks a PX domain. RPK118 binds sphingosine kinase, a key enzyme in the synthesis of sphingosine 1-phosphate (SPP), a lipid messenger involved in many cellular events. RPK118 may be involved in transmitting SPP-mediated signaling. RPK118 also binds the antioxidant peroxiredoxin-3 (PRDX3). RPK118 may be involved in the transport of PRDX3 from the cytoplasm to its site of function in the mitochondria. Length = 237 Score = 28.3 bits (63), Expect = 6.0 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYI 301 LH R+G DL+P N+ +D +G+I Sbjct: 101 LH--REGIVCRDLNPNNILLDDRGHI 124 >gnl|CDD|36204 KOG0986, KOG0986, KOG0986, G protein-coupled receptor kinase [Signal transduction mechanisms]. Length = 591 Score = 28.0 bits (62), Expect = 6.0 Identities = 11/43 (25%), Positives = 21/43 (48%) Query: 275 LLHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRER 317 L H R + DL P N+ +D G++ D+G+ + + + Sbjct: 300 LEHLHRRRIVYRDLKPENILLDDHGHVRISDLGLAVEIPEGKP 342 >gnl|CDD|35832 KOG0612, KOG0612, KOG0612, Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]. Length = 1317 Score = 28.1 bits (62), Expect = 6.3 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSK 314 LH++ G+ H D+ P N+ +D G+I D G ++ Sbjct: 191 LHSM--GYVHRDIKPDNVLLDKSGHIKLADFGSCLKMDA 227 >gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated either by a small GTP-binding protein or by an adaptor protein, which transmits the signal either directly to a MAP3K to start the triple kinase core cascade or indirectly through a mediator kinase, a MAP4K. MAP4K3 plays a role in the nutrient-responsive pathway of mTOR (mammalian target of rapamycin) signaling. MAP4K3 is required in the activation of S6 kinase by amino acids and for the phosphorylation of the mTOR-regulated inhibitor of eukaryotic initiation factor 4E. mTOR regulates ribosome biogenesis and protein translation, and is frequently deregulated in cancer. Length = 267 Score = 28.1 bits (62), Expect = 6.3 Identities = 18/83 (21%), Positives = 37/83 (44%), Gaps = 5/83 (6%) Query: 234 RTERDVITMEWIDGVKISDTEKLRACGHDLERLSV---TLVQSFLLHTLRDGFFHADLHP 290 R ++ I ME+ G + D + + + V TL + LH+ G H D+ Sbjct: 77 RRDKLWICMEFCGGGSLQDIYHVTGPLSESQIAYVSRETLQGLYYLHS--KGKMHRDIKG 134 Query: 291 GNLFVDSKGYIVAVDMGITGRLS 313 N+ + G++ D G++ +++ Sbjct: 135 ANILLTDNGHVKLADFGVSAQIT 157 >gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include MAPKKs from plants, kinetoplastids, alveolates, and mycetozoa. The MAPKK, LmxPK4, from Leishmania mexicana, is important in differentiation and virulence. Dictyostelium discoideum MEK1 is required for proper chemotaxis. MEK1 null mutants display severe defects in cell polarization and directional movement. Plants contain multiple MAPKKs like other eukaryotes. The Arabidopsis genome encodes for 10 MAPKKs while poplar and rice contain 13 MAPKKs each. The functions of these proteins have not been fully elucidated. There is evidence to suggest that MAPK cascades are involved in plant stress responses. In Arabidopsis, MKK3 plays a role in pathogen signaling, MKK2 is involved in cold and salt stress signaling, MKK4/MKK5 participates in innate immunity, and MKK7 regulates basal and systemic acquired resistance. Length = 264 Score = 27.9 bits (63), Expect = 6.7 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLS 313 LHT R H D+ P NL ++SKG + D GI+ L Sbjct: 115 LHTKRH-IIHRDIKPSNLLINSKGEVKIADFGISKVLE 151 >gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also present in the brain and testis. The human class IIIB myosin gene maps to a region that overlaps the locus for Bardet-Biedl syndrome, which is characterized by dysmorphic extremities, retinal dystrophy, obesity, male hypogenitalism, and renal abnormalities. Length = 291 Score = 28.0 bits (62), Expect = 6.8 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 6/85 (7%) Query: 240 ITMEWIDGVKISDTEK-LRACGHDLERLSVT-LVQSFLL---HTLRDGFFHADLHPGNLF 294 + +E +G +++ K L CG L+ ++ ++ LL H + H D+ N+ Sbjct: 101 LVLELCNGGSVTELVKGLLICGQRLDEAMISYILYGALLGLQHLHNNRIIHRDVKGNNIL 160 Query: 295 VDSKGYIVAVDMGITGRL-SKRERR 318 + ++G + VD G++ +L S R RR Sbjct: 161 LTTEGGVKLVDFGVSAQLTSTRLRR 185 >gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydrophobic motif (HM) of NTD, which facilitates the phosphorylation of the A-loop and activates the NTD, which in turn phosphorylates downstream targets. MSK2 and MSK1 play nonredundant roles in activating histone H3 kinases, which play pivotal roles in compaction of the chromatin fiber. MSK2 is the required H3 kinase in response to stress stimuli and activation of the p38 MAPK pathway. MSK2 also plays a role in the pathogenesis of psoriasis. Length = 332 Score = 28.0 bits (62), Expect = 6.9 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGR-LSKRERR 318 LH L G + D+ N+ +DS+G++V D G++ LS+ + R Sbjct: 121 LHKL--GIVYRDIKLENILLDSEGHVVLTDFGLSKEFLSEEKER 162 >gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the nucleus. CDK4 also shows kinase activity towards Smad3, a signal transducer of transforming growth factor (TGF)-beta signaling which modulates transcription and plays a role in cell proliferation and apoptosis. CDK4 is inhibited by the p21 inhibitor and is specifically mutated in human melanoma. Length = 288 Score = 28.0 bits (62), Expect = 7.1 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 11/83 (13%) Query: 234 RTERDV---ITMEWIDGVKISDTEKLRACGHDLERLSVTLVQSFL-----LHTLRDGFFH 285 RT+R+ + E +D + +K+ G E + L++ FL LH H Sbjct: 75 RTDRETKVTLVFEHVDQDLRTYLDKVPPPGLPAETIK-DLMRQFLRGLDFLHANC--IVH 131 Query: 286 ADLHPGNLFVDSKGYIVAVDMGI 308 DL P N+ V S G + D G+ Sbjct: 132 RDLKPENILVTSGGQVKLADFGL 154 >gnl|CDD|35818 KOG0598, KOG0598, KOG0598, Ribosomal protein S6 kinase and related proteins [General function prediction only, Signal transduction mechanisms]. Length = 357 Score = 28.0 bits (62), Expect = 7.6 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGI 308 LH+ G + DL P N+ +D +G+I D G+ Sbjct: 141 LHSK--GIIYRDLKPENILLDEQGHIKLTDFGL 171 >gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filaments (PHFs) and stimulate Tau phosphorylation. As AD progresses, phosphorylated Tau aggregates and forms PHFs, which leads to the formation of neurofibrillary tangles (NFTs). In human glioma cells, PCTAIRE-3 induces cell cycle arrest and cell death. Length = 288 Score = 27.7 bits (61), Expect = 8.0 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 16/83 (19%) Query: 235 TERDV-ITMEWIDGVKISDTEK-LRACGHDLERLSVTLVQSFLLHTLRD-------GFFH 285 TER + + E++D SD ++ L CG+ +S+ V+ F+ LR H Sbjct: 74 TERCLTLVFEYLD----SDLKQYLDNCGN---LMSMHNVKIFMFQLLRGLSYCHKRKILH 126 Query: 286 ADLHPGNLFVDSKGYIVAVDMGI 308 DL P NL ++ KG + D G+ Sbjct: 127 RDLKPQNLLINEKGELKLADFGL 149 >gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy, and cardiac conduction defects. The genetic basis for DM1 is the mutational expansion of a CTG repeat in the 3'-UTR of DMPK. DMPK is expressed in skeletal and cardiac muscles, and in central nervous tissues. The functional role of DMPK is not fully understood. It may play a role in the signal transduction and homeostasis of calcium. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKgamma is expressed in heart and skeletal muscles, unlike MRCKalpha and MRCKbeta, which are expressed ubiquitously. Length = 331 Score = 27.8 bits (62), Expect = 8.2 Identities = 38/150 (25%), Positives = 54/150 (36%), Gaps = 50/150 (33%) Query: 192 VRALEQVTKMEMDLRLEAAAFSEMAENTVKDQGFRVPKIDWNRTERDVITM---EWIDGV 248 V A++ + K EM R E A F R ERDV+ WI + Sbjct: 28 VYAMKILNKWEMLKRAETACF---------------------REERDVLVNGDRRWITNL 66 Query: 249 KIS--DTEKLRA-----CGHDL--------ERLSVTLVQSFL---------LHTLRDGFF 284 + D L G DL +RL + + +L +H L G+ Sbjct: 67 HYAFQDENNLYLVMDYYVGGDLLTLLSKFEDRLPEDMARFYLAEMVLAIDSVHQL--GYV 124 Query: 285 HADLHPGNLFVDSKGYIVAVDMGITGRLSK 314 H D+ P N+ +D G+I D G RL Sbjct: 125 HRDIKPDNVLLDKNGHIRLADFGSCLRLLA 154 >gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4/MKK7 and MKK3/MKK6. JNK and p38 are collectively known as stress-activated MAPKs, as they are activated in response to a variety of environmental stresses and pro-inflammatory cytokines. MEKK4 also plays roles in the re-polarization of the actin cytoskeleton in response to osmotic stress, in the proper closure of the neural tube, in cardiovascular development, and in immune responses. Length = 264 Score = 27.7 bits (62), Expect = 8.3 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKR 315 LH+ G H D+ P N+F+D G I D G +L Sbjct: 115 LHS--HGIVHRDIKPANIFLDHNGVIKLGDFGCAVKLKNN 152 >gnl|CDD|73199 cd00382, beta_CA, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.. Length = 119 Score = 27.8 bits (62), Expect = 8.4 Identities = 11/29 (37%), Positives = 16/29 (55%) Query: 19 VIVSLPSDRLPPIIVFGKKIASLFVRRNI 47 +I+ R+PP ++FG LFV RN Sbjct: 6 LIIGCSDSRVPPELIFGLGPGDLFVVRNA 34 >gnl|CDD|36120 KOG0902, KOG0902, KOG0902, Phosphatidylinositol 4-kinase [Signal transduction mechanisms]. Length = 1803 Score = 27.7 bits (61), Expect = 8.7 Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 287 DLHPGNLFVDSKGYIVAVDMG 307 D H GN+ +D +G+I+ +D G Sbjct: 1658 DRHNGNIMIDDQGHIIHIDFG 1678 >gnl|CDD|39844 KOG4645, KOG4645, KOG4645, MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms]. Length = 1509 Score = 27.7 bits (61), Expect = 8.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Query: 282 GFFHADLHPGNLFVDSKGYIVAVDMG 307 G H D+ P N+ +D G I D G Sbjct: 1354 GIVHRDIKPANILLDFNGLIKYGDFG 1379 >gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12, is predominantly expressed in skeletal muscle. Unlike p38alpha and p38beta, p38gamma is insensitive to pyridinylimidazoles. It displays an antagonizing function compared to p38alpha. p38gamma inhibits, while p38alpha stimulates, c-Jun phosphorylation and AP-1 mediated transcription. p38gamma also plays a role in the signaling between Ras and the estrogen receptor and has been implicated to increase cell invasion and breast cancer progression. In Xenopus, p38gamma is critical in the meiotic maturation of oocytes. Length = 343 Score = 27.6 bits (61), Expect = 8.9 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 7/52 (13%) Query: 264 ERLSVTLVQSFLLHTLRD-------GFFHADLHPGNLFVDSKGYIVAVDMGI 308 E+LS +Q + L+ G H DL PGNL V+ + +D G+ Sbjct: 113 EKLSEDRIQFLVYQMLKGLKYIHAAGIIHRDLKPGNLAVNEDCELKILDFGL 164 >gnl|CDD|36652 KOG1439, KOG1439, KOG1439, RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones]. Length = 440 Score = 27.5 bits (61), Expect = 8.9 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Query: 455 LVQAAPQLSISVEKILKSLVESSVKDKYLDFPKKESSRVYD 495 V P+ ++ +++K L+ + V +YL+F S VY Sbjct: 73 NVDLIPKFLMANGELVKILIHTGV-TRYLEFKSISGSFVYK 112 >gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found in the testis, but is also present in the cerebellum and kidney. It is expressed as multiple splice variants with different domain architectures. It is post-translationally palmitoylated and localized in the membrane. GRK4 polymorphisms are associated with hypertension and salt sensitivity, as they cause hyperphosphorylation, desensitization, and internalization of the dopamine 1 (D1) receptor while increasing the expression of the angiotensin II type 1 receptor. GRK4 plays a crucial role in the D1 receptor regulation of sodium excretion and blood pressure. Length = 285 Score = 27.6 bits (61), Expect = 9.3 Identities = 11/38 (28%), Positives = 22/38 (57%) Query: 280 RDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRER 317 R+ + DL P N+ +D +G+I D+G+ ++ + E Sbjct: 120 RERIVYRDLKPENILLDDRGHIRISDLGLAVQIPEGET 157 >gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developmental pathways, such as stomata and leaf development. CdkB has been shown to associate with both cyclin B, which controls G2/M transition, and cyclin D, which acts as a mediator in linking extracellular signals to the cell cycle. Length = 295 Score = 27.5 bits (61), Expect = 9.6 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 8/51 (15%) Query: 266 LSVTLVQSF-------LLHTLRDGFFHADLHPGNLFVD-SKGYIVAVDMGI 308 L ++SF + H + G H DL P NL VD KG + D+G+ Sbjct: 107 LPAKTIKSFMYQLLKGVAHCHKHGVMHRDLKPQNLLVDKQKGLLKIADLGL 157 >gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. It is not essential for yeast viability and is the functional homolog of mammalian CDK5, which plays a role in central nervous system development. Length = 284 Score = 27.4 bits (61), Expect = 9.8 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 7/50 (14%) Query: 266 LSVTLVQSFLLHTLR-------DGFFHADLHPGNLFVDSKGYIVAVDMGI 308 L V+SF L+ + H DL P NL ++ +G + D G+ Sbjct: 97 LDPNTVKSFTYQLLKGIAFCHENRVLHRDLKPQNLLINKRGELKLADFGL 146 >gnl|CDD|35802 KOG0582, KOG0582, KOG0582, Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]. Length = 516 Score = 27.3 bits (60), Expect = 9.8 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRLSKRERR 318 LH ++G H D+ GN+ +DS G + D G++ L R Sbjct: 142 LH--QNGHIHRDVKAGNILIDSDGTVKLADFGVSASLFDSGDR 182 >gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include the MAPKKs Pek1/Skh1 from Schizosaccharomyces pombe and MKK2 from Saccharomyces cerevisiae, and related proteins. Both fission yeast Pek1 and baker's yeast MKK2 are components of the cell integrity MAPK pathway. In fission yeast, Pek1 phosphorylates and activates the MAPK Pmk1/Spm1 and is regulated by the MAPKKK Mkh1. In baker's yeast, the pathway involves the MAPK Slt2, the MAPKKs MKK1 and MKK2, and the MAPKKK Bck1. The cell integrity MAPK cascade is activated by multiple stress conditions, and is essential in cell wall construction, morphogenesis, cytokinesis, and ion homeostasis. Length = 287 Score = 27.4 bits (61), Expect = 9.9 Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Query: 276 LHTLRDGFFHADLHPGNLFVDSKGYIVAVDMGITGRL 312 LH+ + H D+ P N+ + KG + D G++G L Sbjct: 121 LHSRK--IIHRDIKPSNILLTRKGQVKLCDFGVSGEL 155 >gnl|CDD|73356 cd03378, beta_CA_cladeC, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.. Length = 154 Score = 27.4 bits (61), Expect = 9.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 19 VIVSLPSDRLPPIIVFGKKIASLFVRRN 46 VI+S R+PP I+F + + LFV R Sbjct: 42 VILSCSDSRVPPEIIFDQGLGDLFVVRV 69 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.139 0.408 Gapped Lambda K H 0.267 0.0787 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 6,391,627 Number of extensions: 346594 Number of successful extensions: 1393 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1376 Number of HSP's successfully gapped: 154 Length of query: 517 Length of database: 6,263,737 Length adjustment: 98 Effective length of query: 419 Effective length of database: 4,146,055 Effective search space: 1737197045 Effective search space used: 1737197045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 60 (26.8 bits)