HHsearch alignment for GI: 254780624 and conserved domain: COG0030

>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis].
Probab=98.31  E-value=9.1e-07  Score=63.76  Aligned_cols=90  Identities=19%  Similarity=0.249  Sum_probs=69.5

Q ss_pred             HCCCH----HHHHHHHHHHHCCCCCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCCCCCCC
Q ss_conf             14801----79999998520644679977986023355777776641388632787213322221111000001122222
Q gi|254780624|r   49 SLGLH----RFWKEAMVTNLNPRKSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKENLQDCI  124 (265)
Q Consensus        49 S~G~~----r~Wr~~~i~~l~~~~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~~~~~i  124 (265)
T Consensus         7 ~~GQnFL~d~~v~~kIv~~a~~~~--~d~VlEIGpG~GaLT~~Ll~~~---~~v~aiEiD~~l~~~L~~~~~---~~~n~   78 (259)
T COG0030           7 RLGQNFLIDKNVIDKIVEAANISP--GDNVLEIGPGLGALTEPLLERA---ARVTAIEIDRRLAEVLKERFA---PYDNL   78 (259)
T ss_pred             CCCCCCCCCHHHHHHHHHHCCCCC--CCEEEEECCCCCHHHHHHHHHC---CEEEEEEECHHHHHHHHHHHC---CCCCE
T ss_conf             766454147879999998557899--9869997898778899999606---957999968899999997506---56655


Q ss_pred             CCCCCCCCCCCCCCC-CCCCCEE
Q ss_conf             222222333457554-4674036
Q gi|254780624|r  125 TFIEANAETLPFEAN-SFDACTL  146 (265)
Q Consensus       125 ~~~~~da~~lp~~d~-sfD~V~~  146 (265)
T Consensus        79 ~vi~~DaLk~d~~~l~~~~~vVa  101 (259)
T COG0030          79 TVINGDALKFDFPSLAQPYKVVA  101 (259)
T ss_pred             EEEECCHHCCCCHHHCCCCEEEE
T ss_conf             99947242475135157888998