HHsearch alignment for GI: 254780624 and conserved domain: COG0421

>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism].
Probab=98.35  E-value=6.6e-07  Score=64.66  Aligned_cols=103  Identities=17%  Similarity=0.207  Sum_probs=78.7

Q ss_pred             CCCCCEEEECCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHCCC--C-CCCCCCCCCCCCC-CCCCCCCCCC
Q ss_conf             6799779860233557777766413886327872133222211110000011--2-2222222222333-4575544674
Q gi|254780624|r   68 KSKDYRVLDVAGGTGDVAFRIAEASDNRSQIVVADINNEMLSVGRDRAFKEN--L-QDCITFIEANAET-LPFEANSFDA  143 (265)
Q Consensus        68 ~~~~~~iLDiGcGTG~~~~~l~~~~~~~~~v~giD~s~~Ml~~a~~r~~~~~--~-~~~i~~~~~da~~-lp~~d~sfD~  143 (265)
T Consensus        74 h~~pk~VLiiGgGdG~tlRevlkh~-~ve~i~~VEID~~Vi~~ar~~l~~~~~~~~dpRv~i~i~Dg~~~v~~~~~~fDv  152 (282)
T COG0421          74 HPNPKRVLIIGGGDGGTLREVLKHL-PVERITMVEIDPAVIELARKYLPEPSGGADDPRVEIIIDDGVEFLRDCEEKFDV  152 (282)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHCC-CCCEEEEEECCHHHHHHHHHHCCCCCCCCCCCCEEEEECCHHHHHHHCCCCCCE
T ss_conf             7997769998897669999998368-843379997088999999986667543357973689961079998748876778


Q ss_pred             CEEEEEECCCHHH---------HHHHCCCCHHCCCCCEEEEE
Q ss_conf             0366420132134---------43201210004852117763
Q gi|254780624|r  144 CTLAFGIRNMPHI---------TLVLQEIYRILKCGGRLLVL  176 (265)
Q Consensus       144 V~~sf~l~~~~d~---------~~~l~e~~RvLKpGG~~~i~  176 (265)
T Consensus       153 Ii~D-----~tdp~gp~~~Lft~eFy~~~~~~L~~~Gi~v~q  189 (282)
T COG0421         153 IIVD-----STDPVGPAEALFTEEFYEGCRRALKEDGIFVAQ  189 (282)
T ss_pred             EEEC-----CCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEE
T ss_conf             9985-----889988430237799999999862889689994